Serine/threonine-protein kinase PLK

Overview
NameSerine/threonine-protein kinase PLK
Smed IDSMED30025780
Length (bp)1900
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase PLK (SMED30025780) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase PLK (SMED30025780) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase PLK (SMED30025780) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase PLK (SMED30025780) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025780

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025780SMESG000022441.1 SmedASXL_001438SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025780SMESG000022441.1 SmedASXL_001438SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30025780SMESG000022441.1 dd_Smed_v6_4273_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30025780SMESG000022441.1 SMED30025780smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30025780SMESG000022441.1 dd_Smed_v4_4273_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025780SMESG000022441.1 SMED30025780smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30025780SMESG000022441.1 SMED_07484_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025780SMESG000022441.1 SMED_07484_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025780SMESG000022441.1 SMED_16511_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025780SMESG000022441.1 SMED_16511_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Human
Match: PLK1 (polo like kinase 1 [Source:HGNC Symbol;Acc:HGNC:9077])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 286/577 (49.57%), Postives = 416/577 (72.10%), Query Frame = 2
Query:   98 PEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF----DNIQIKN-KPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            PE++ D    +RY +G+ LG+GGFAKC+E+ D++  E+FAGKI+ KS +     REK+  EI+IHR+L+++++V F+ +FEDN  V+++LELC+ +SLLELHKRRK +TEPE RY+ +QI   C+Y+H+ ++IHRDLKL N+FLN+D+ VK+GDFGLATK+EYDGERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYSIP ++      +I+ +L +D   RP++N+LL  EF+  G+IP+ LP + +T  PRF     ++   N KPL+ +   +  P+            E +   +G+    + ++ D+++Q+ +V        +A  PS++ L   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+IL  +  +LQYIE++GTE   T++S+P+ L KK+TLL+YF+ YM E+L+ AG N+   + + + RLPY++ WFRT+SAI+L+LSNG+VQIN F DHTKLI+CPL+ AVTYID  +DFRT++L  L   G   E+  RL+Y   M++++ SS S + R++ +
Sbjct:   41 PEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPE----RPREKEEPVVRETGE--VVDCHLSDMLQQLHSV--------NASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS 603          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Human
Match: PLK2 (polo like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19699])

HSP 1 Score: 388.652 bits (997), Expect = 4.602e-126
Identity = 219/614 (35.67%), Postives = 350/614 (57.00%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF-------------------------------DNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILP-----GPSGDENYNNR-YIVDLIRQI-----------KNVIVDMKIINSADYPSKKMLDLMEESEEPNLAP-------VYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESM--IRLP--YVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            II D +  +RY +GK+LG+GGFAKCYE+ D +NN+++A KII  S +     REK+ +EI +HR L ++++V+FYHYFED  N+YI+LE C  +S+  + K RK +TEPE RY+ +QI    +Y+H+Q+I+HRDLKL N F+N+ M +K+GDFGLA +LE    R++T+CGTPNY++PEVL K+GH  E D W+LGC++YT+L+G+PPFET  L++TY  I++  Y++P +L    + +I ++L  +   RPS++ ++  +F+ +GF P  L +S   TVP F                               + +  +++ +  + + +    I+          E+ P       SG     N+  I D IR I              + D  + + AD  ++ +   +E   E +  P         WV KWVDYS++YG GYQLSD + GV+FN+ + + L  + + + Y  + G   ++  T  P++   +VT+L+YF  YM ENLM  G     D  S+  IR P  Y+  W ++  A+++  ++GT Q+N + DHTK+I+C       +TYI+  +   TF+L +L   G ++E+  R++Y L M+
Sbjct:   58 IIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGG-----DLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNML 666          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Human
Match: PLK2 (polo like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19699])

HSP 1 Score: 389.037 bits (998), Expect = 5.554e-126
Identity = 219/614 (35.67%), Postives = 350/614 (57.00%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF-------------------------------DNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILP-----GPSGDENYNNR-YIVDLIRQI-----------KNVIVDMKIINSADYPSKKMLDLMEESEEPNLAP-------VYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESM--IRLP--YVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            II D +  +RY +GK+LG+GGFAKCYE+ D +NN+++A KII  S +     REK+ +EI +HR L ++++V+FYHYFED  N+YI+LE C  +S+  + K RK +TEPE RY+ +QI    +Y+H+Q+I+HRDLKL N F+N+ M +K+GDFGLA +LE    R++T+CGTPNY++PEVL K+GH  E D W+LGC++YT+L+G+PPFET  L++TY  I++  Y++P +L    + +I ++L  +   RPS++ ++  +F+ +GF P  L +S   TVP F                               + +  +++ +  + + +    I+          E+ P       SG     N+  I D IR I              + D  + + AD  ++ +   +E   E +  P         WV KWVDYS++YG GYQLSD + GV+FN+ + + L  + + + Y  + G   ++  T  P++   +VT+L+YF  YM ENLM  G     D  S+  IR P  Y+  W ++  A+++  ++GT Q+N + DHTK+I+C       +TYI+  +   TF+L +L   G ++E+  R++Y L M+
Sbjct:   72 IIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGG-----DLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNML 680          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Human
Match: PLK3 (polo like kinase 3 [Source:HGNC Symbol;Acc:HGNC:2154])

HSP 1 Score: 376.711 bits (966), Expect = 1.119e-121
Identity = 209/580 (36.03%), Postives = 331/580 (57.07%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRDS-NNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTI----------------SVPIISGIGVTGTGHSEILP------GPS-------GDENYNNR-YIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLA------PVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVC---PLVGAVTYIDGTKDFRTFKLESLRHKGMTNE 1720
            +I D    + Y KG+LLG+GGFA+CYE  D+     +A K+I +S +     REK+  EI +HR+L + +IV+F H+FED  N+YI LELC  KSL  + K R  + EPE RY+ +QI    +Y+HQ+ I+HRDLKL N F+ ++M +K+GDFGLA +LE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTLL G PPFET  L++TY  IK+  Y++P +L    ++++ A+L +    RPS++++L  +F+ KG+ P  LP S   TVP            + +  ++                   ++SG+  T  GH +  P      GP+         E+ + R  +       +  +    ++ SA    +  +  M  +E+ N A      P+ WV+KWVDYS+++G GYQLS     V+FND + + L+AN + + Y   +   F +++ + P  L+ ++ +L+YF +YM ++LM  G+    ++  +   P +  W +T  A+++  S+GTVQ+N +GDHTKLI+    PL+  VT++   +   T+    LR  G + +
Sbjct:   52 LITDPRSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKNHAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDGFEEGLTVATVVESALCALRNCIAFMPPAEQ-NPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLL--VTFVARNRSACTYLASHLRQLGCSPD 628          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Human
Match: PLK4 (polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11397])

HSP 1 Score: 191.43 bits (485), Expect = 5.210e-51
Identity = 99/250 (39.60%), Postives = 154/250 (61.60%), Query Frame = 2
Query:  143 GKLLGRGGFAKCYELRDSNNEI-FAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRR-KKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEF 886
            G LLG+G FA  Y     +  +  A K+I K  +  +G  +++Q E+ IH  L + +I++ Y+YFED+  VY++LE+C    +    K R K  +E E R+F  QI     Y+H   I+HRDL L+N+ L ++M +K+ DFGLAT+L+   E+  T+CGTPNYI+PE+  +  H  E D WSLGC+ YTLLIG+PPF+T+T+++T  K+   +Y +P  L    +++I  LL  +   R S++ +L+  F
Sbjct:   15 GNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPF 264          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Celegans
Match: plk-2 (Serine/threonine-protein kinase plk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9N2L7])

HSP 1 Score: 501.901 bits (1291), Expect = 4.550e-171
Identity = 264/572 (46.15%), Postives = 365/572 (63.81%), Query Frame = 2
Query:   92 NTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYK-GFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGP----SGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDL------MEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSY-PDKLKKKVTLLQYFQTYMIENLMTAGENMFND-KESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI 1765
            + P++I D  R  RY KGK LG+GGFA CYELR+ S  E+FAGK++ K+ +     R+K+ QE+ IHRNL + N+VK YH+FED  NVYI LELC  +SL+ELHKRRK +TEPE RYF+ QI +   Y+H  KI+HRDLKL N+FLN ++ VK+GDFGLAT  + D ERKKT+CGTPNYIAPEVL K GHSFEVD W++GCI+Y LL G PPFE+++L +TY++IK N Y IP +   +  ++IR LLD    +RP+   +    F+K GF+P+ LP S +T VP  ++ +   + +S  G       I   G    G S +   P    S +      + ++  RQ  +  +   +    D  +    D+      ++  + P   PV+W++KWVDYSD+YG+GYQL D S GV+FND SRI+L      L YIEK   E  + + S  P  L+KK+TLL+YF++YM ++L+ AG+ +     + + RLP ++ WFRTKSAIVL+LSNGTVQIN F DH K+++CPL+ AVT+ID  K   T+K   L   G   +   R+QY   MI+R+
Sbjct:   22 DVPDVILDGERKTRYEKGKFLGKGGFAHCYELRNKSTGELFAGKVVPKALLIKQYQRDKMAQEVQIHRNLQHRNVVKLYHFFEDKSNVYITLELCPRRSLMELHKRRKAVTEPEARYFTYQIVEGVLYLHNLKIVHRDLKLGNLFLNDELQVKIGDFGLATTCDND-ERKKTLCGTPNYIAPEVLNKIGHSFEVDLWAIGCILYILLFGHPPFESKSLEETYSRIKNNNYVIPTSASAAASQLIRVLLDPVPSRRPNARAVCRDHFFKSGFMPARLPVSCLTMVPHLNDDEYAEENVSPSGT------IDQRGPHQAGRSGLSAIPAHLVSRNSERQQTHRMEAYRQPTDCYLSNLLAQVNDLLATPTADIDDAEAALDSYQSPEALPVFWISKWVDYSDKYGIGYQLCDNSVGVLFNDNSRIMLDTAGTQLTYIEKTEKEHYFDMESAIPSGLQKKMTLLKYFRSYMNDHLLQAGQQVTRKVGDDLARLPTLRVWFRTKSAIVLHLSNGTVQINFFNDHIKMVLCPLMQAVTFIDENKRMFTYKFSHLAENGCPEKFLHRIQYAKCMIQRL 586          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Celegans
Match: plk-1 (Serine/threonine-protein kinase plk-1 [Source:UniProtKB/Swiss-Prot;Acc:P34331])

HSP 1 Score: 491.886 bits (1265), Expect = 7.951e-167
Identity = 261/581 (44.92%), Postives = 368/581 (63.34%), Query Frame = 2
Query:   95 TPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYK-GFIPSGLPTSVMTTVPRFD----NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEES------EEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITS--YPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDK-ESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGR 1792
             P +I D+ R   Y KG+ LG+GGFA CYEL + +  E+ AGK++ KS +     R+K+ QE+ IHR L + NIVK +++FEDN NVYI LELC  +SL+ELHKRRK +TEPE RYF+ QI     Y+H   IIHRD+KL N+FLN D++VK+GDFGLAT +  D ERKKT+CGTPNYIAPEVL K GHSFEVD W++GCI+Y LL G+PPFE+++L +TY++I+ N Y+IP         +IR +LD +  +RP+  ++    F+K GF+P+ LP S +T VP+F     ++  +N     +      P+    G++      I+   +  E    +      R+ ++  +       A    +++  L EE       + P   PV+W++KWVDYSD+YG+GYQL D S GV+FND SRI+L      L YIEK+  E  +++ S   P  L KKVTLL+YF++YM ++L+ AGE       + + RLP ++ WFRTKSAIVL+LSNGTVQIN F DH K+++CPL+ AVT+ID  K   T+KL +L+  G   +   RL+Y   MIER+ S  ++  +
Sbjct:   25 VPALIADKDRGTYYEKGRFLGKGGFAHCYELTNRATREVVAGKVVPKSMLVKQYQRDKMTQEVQIHRELGHINIVKLFNFFEDNLNVYITLELCARRSLMELHKRRKAVTEPEARYFTHQIVDGVLYLHDLNIIHRDMKLGNLFLNDDLVVKIGDFGLATTVNGD-ERKKTLCGTPNYIAPEVLNKAGHSFEVDIWAVGCILYILLFGQPPFESKSLEETYSRIRHNNYTIPSIATQPAASLIRKMLDPEPTRRPTAKQVQRDGFFKSGFMPTRLPVSCLTMVPKFGGHETSMMEENVAPRGVDARSQRPLNGRAGLSALPQ-HIVSNNADRERAQQQAAEATFREPEDAYLSQLFHQVAVLLEQRIPGLEEEEAALDGYQSPECLPVFWISKWVDYSDKYGIGYQLCDNSVGVLFNDNSRIMLDQAGNELTYIEKSNKEHYFSMHSGEMPGLLNKKVTLLKYFRSYMNDHLVKAGEGSEQRAGDDLARLPTLRVWFRTKSAIVLHLSNGTVQINFFNDHVKMMMCPLMQAVTFIDQNKRMLTYKLNNLQRNGCPEKFLHRLKYAKTMIERLMSDANVVSQ 603          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Celegans
Match: plk-1 (Serine/threonine-protein kinase plk-1 [Source:UniProtKB/Swiss-Prot;Acc:P34331])

HSP 1 Score: 484.182 bits (1245), Expect = 6.300e-164
Identity = 261/582 (44.85%), Postives = 367/582 (63.06%), Query Frame = 2
Query:   95 TPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQE-ITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYK-GFIPSGLPTSVMTTVPRFD----NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEES------EEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITS--YPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDK-ESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGR 1792
             P +I D+ R   Y KG+ LG+GGFA CYEL + +  E+ AGK++ KS +     R+K+  E I IHR L + NIVK +++FEDN NVYI LELC  +SL+ELHKRRK +TEPE RYF+ QI     Y+H   IIHRD+KL N+FLN D++VK+GDFGLAT +  D ERKKT+CGTPNYIAPEVL K GHSFEVD W++GCI+Y LL G+PPFE+++L +TY++I+ N Y+IP         +IR +LD +  +RP+  ++    F+K GF+P+ LP S +T VP+F     ++  +N     +      P+    G++      I+   +  E    +      R+ ++  +       A    +++  L EE       + P   PV+W++KWVDYSD+YG+GYQL D S GV+FND SRI+L      L YIEK+  E  +++ S   P  L KKVTLL+YF++YM ++L+ AGE       + + RLP ++ WFRTKSAIVL+LSNGTVQIN F DH K+++CPL+ AVT+ID  K   T+KL +L+  G   +   RL+Y   MIER+ S  ++  +
Sbjct:   25 VPALIADKDRGTYYEKGRFLGKGGFAHCYELTNRATREVVAGKVVPKSMLVKQYQRDKVDNERILIHRELGHINIVKLFNFFEDNLNVYITLELCARRSLMELHKRRKAVTEPEARYFTHQIVDGVLYLHDLNIIHRDMKLGNLFLNDDLVVKIGDFGLATTVNGD-ERKKTLCGTPNYIAPEVLNKAGHSFEVDIWAVGCILYILLFGQPPFESKSLEETYSRIRHNNYTIPSIATQPAASLIRKMLDPEPTRRPTAKQVQRDGFFKSGFMPTRLPVSCLTMVPKFGGHETSMMEENVAPRGVDARSQRPLNGRAGLSALPQ-HIVSNNADRERAQQQAAEATFREPEDAYLSQLFHQVAVLLEQRIPGLEEEEAALDGYQSPECLPVFWISKWVDYSDKYGIGYQLCDNSVGVLFNDNSRIMLDQAGNELTYIEKSNKEHYFSMHSGEMPGLLNKKVTLLKYFRSYMNDHLVKAGEGSEQRAGDDLARLPTLRVWFRTKSAIVLHLSNGTVQINFFNDHVKMMMCPLMQAVTFIDQNKRMLTYKLNNLQRNGCPEKFLHRLKYAKTMIERLMSDANVVSQ 604          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Celegans
Match: plk-3 (Serine/threonine-protein kinase plk-3 [Source:UniProtKB/Swiss-Prot;Acc:Q20845])

HSP 1 Score: 360.918 bits (925), Expect = 1.975e-116
Identity = 221/597 (37.02%), Postives = 344/597 (57.62%), Query Frame = 2
Query:   86 MDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSN-NEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQI---KNKPLSSIGNTISVPIISGIGVTGTGHSEI-------LPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTIT-SYPDKLKKKVTLLQYFQTYMIENL-----MTAGENMFNDKESM---IRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVAE*CR 1816
            + N P II+D  +   Y KG  LG GGFA C+E R  + N+  A K++ K  +  S +REKL +E+ IHR LS+ NIV+F+H+FED+ NVY  LELC   SL+EL+K+R  +TE E R+++ Q+A+  +++H  +IIHRDLKL N+FLN+ + VK+GDFGLAT  E   E+K T  GTPNYIAPEVL + GH+FEVD W++GCI+Y LL G PPFE+  +++TY +IK N+Y +P N   +   +IR+LLD    +RP+   +L  +F+K  I    P  V   + +  +++     N  L  +   IS PI   +    T  SEI            GDE      +  L  QI +++    ++ S +  S +       +  P   P++WV++WV + + +G+GY+L + S+G++FND +++ + +    L ++++N TE  YT+    P  L+ K+ +    Q+YM  +L     + A +   N    +    RLP ++ WF TKSA++ +LSNGTVQIN F DH K+++CPL+ +VT+I+  K   TF   ++       +   R++Y    I+ +  + +    V V   CR
Sbjct:   20 VPNVPPIIYDDMQ-VPYEKGAFLGEGGFAHCFEFRKLDCNDRLAVKVVPKVILLKSTAREKLTREVEIHRQLSHRNIVQFHHFFEDSQNVYFTLELCSKNSLMELNKQRGPLTEHEARFYTIQVAEGVKHLHNLQIIHRDLKLGNLFLNEHLQVKIGDFGLATFCE-KNEKKMTRGGTPNYIAPEVLNETGHAFEVDIWAIGCILYVLLFGSPPFESRRVQETYVRIKNNDYVVPENASPTANRLIRSLLDPVPDRRPTAEAVLLDQFFKTTIEPTYP-PVHQQLHKEQDVKYFAPINPVLPHVEEPIS-PIYQEVANEET--SEIRRFVKTEQASSFGDE------LSQLQAQISHIL--QNVVASKNKSSTR----FGLNHSPEATPIFWVSQWVHFPN-HGIGYRLCENSSGMLFNDNTQMKVNSAGNQLTFVDENNTEQFYTMNDQVPMNLQTKINIFSNVQSYMNTHLEADTHLEAEDQCVNKVPPLRNFARLPTIQNWFETKSAVIFHLSNGTVQIN-FLDHVKMVLCPLLKSVTFIEENKRVSTFTFANILTNSCPKKYLSRIEYAQAKIKLLRPTNNQEHVVYVDSPCR 596          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Celegans
Match: plk-3 (Serine/threonine-protein kinase plk-3 [Source:UniProtKB/Swiss-Prot;Acc:Q20845])

HSP 1 Score: 360.918 bits (925), Expect = 1.975e-116
Identity = 221/597 (37.02%), Postives = 344/597 (57.62%), Query Frame = 2
Query:   86 MDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSN-NEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQI---KNKPLSSIGNTISVPIISGIGVTGTGHSEI-------LPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTIT-SYPDKLKKKVTLLQYFQTYMIENL-----MTAGENMFNDKESM---IRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVAE*CR 1816
            + N P II+D  +   Y KG  LG GGFA C+E R  + N+  A K++ K  +  S +REKL +E+ IHR LS+ NIV+F+H+FED+ NVY  LELC   SL+EL+K+R  +TE E R+++ Q+A+  +++H  +IIHRDLKL N+FLN+ + VK+GDFGLAT  E   E+K T  GTPNYIAPEVL + GH+FEVD W++GCI+Y LL G PPFE+  +++TY +IK N+Y +P N   +   +IR+LLD    +RP+   +L  +F+K  I    P  V   + +  +++     N  L  +   IS PI   +    T  SEI            GDE      +  L  QI +++    ++ S +  S +       +  P   P++WV++WV + + +G+GY+L + S+G++FND +++ + +    L ++++N TE  YT+    P  L+ K+ +    Q+YM  +L     + A +   N    +    RLP ++ WF TKSA++ +LSNGTVQIN F DH K+++CPL+ +VT+I+  K   TF   ++       +   R++Y    I+ +  + +    V V   CR
Sbjct:   20 VPNVPPIIYDDMQ-VPYEKGAFLGEGGFAHCFEFRKLDCNDRLAVKVVPKVILLKSTAREKLTREVEIHRQLSHRNIVQFHHFFEDSQNVYFTLELCSKNSLMELNKQRGPLTEHEARFYTIQVAEGVKHLHNLQIIHRDLKLGNLFLNEHLQVKIGDFGLATFCE-KNEKKMTRGGTPNYIAPEVLNETGHAFEVDIWAIGCILYVLLFGSPPFESRRVQETYVRIKNNDYVVPENASPTANRLIRSLLDPVPDRRPTAEAVLLDQFFKTTIEPTYP-PVHQQLHKEQDVKYFAPINPVLPHVEEPIS-PIYQEVANEET--SEIRRFVKTEQASSFGDE------LSQLQAQISHIL--QNVVASKNKSSTR----FGLNHSPEATPIFWVSQWVHFPN-HGIGYRLCENSSGMLFNDNTQMKVNSAGNQLTFVDENNTEQFYTMNDQVPMNLQTKINIFSNVQSYMNTHLEADTHLEAEDQCVNKVPPLRNFARLPTIQNWFETKSAVIFHLSNGTVQIN-FLDHVKMVLCPLLKSVTFIEENKRVSTFTFANILTNSCPKKYLSRIEYAQAKIKLLRPTNNQEHVVYVDSPCR 596          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0074839)

HSP 1 Score: 488.034 bits (1255), Expect = 3.115e-166
Identity = 257/573 (44.85%), Postives = 382/573 (66.67%), Query Frame = 2
Query:   83 KMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGF-IPSGLPTSVMTTVPRF---DNIQ--IKNKPLSSI-GNTISVPIISGIGVTGTGHSEILPGPS---GDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFN-DKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI 1765
            K  + P+ + D ++ + Y + +  G+GGFAKCYE+ D   +++FAGKI+ K  +     +EK  QEITIHR+L++ NIVKF++YFED+ N+YI+LELCK +S++ELHKRRK ITE E RY+  QI +  +Y+H  +IIHRDLKL N+FLN  + VK+GDFGLAT++EY+GERKKT+CGTPNYIAPE+L K+GHSFEVD WS+GC++YTLL+G+PPFET+TL+DTY+KIKK EY +P  L     +++ A+L  +   RP++ +LL  EF KG  +P  LP+S +T  PR    D I+  +  KPL  + G       +    +    H  I          E+Y +  I  L +Q+ N+I           P     +L +E+ +P   P++W++KWVDYSD+YG GYQL D   GV+FND +++IL  N  N+ +I+K+G E   T T Y   L KK+ LL YF+ YMIE+L+ AG N  N + + + R+P++ +WFRT  A+V++L+NG+VQ+N F DH KLI+CP + A+TY+D  K+FRT++  ++   G++ +++Q+++Y    + ++
Sbjct:    8 KSTDIPDRLVDINQRKTYKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKLMIKHNQKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYRVPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKVPMFLPSSCLTMAPRIGSNDTIEDSMHRKPLMEMNGIRPDDTRLESTFLKANLHDAITASAQVCRHSEDYRSD-IESLYQQLTNLI--------NGKPRILQGNLGDENTDPAAQPLFWISKWVDYSDKYGFGYQLCDEGIGVMFNDTTKLILLPNQINVHFIDKDGKETYMTTTDYCKSLDKKMKLLSYFKRYMIEHLVKAGANNVNIESDQISRMPHLHSWFRTTCAVVMHLTNGSVQLN-FSDHMKLILCPRMSAITYMDQEKNFRTYRFSTIVENGVSKDLYQKIRYAQEKLRKM 570          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0100318)

HSP 1 Score: 488.034 bits (1255), Expect = 3.115e-166
Identity = 257/573 (44.85%), Postives = 382/573 (66.67%), Query Frame = 2
Query:   83 KMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGF-IPSGLPTSVMTTVPRF---DNIQ--IKNKPLSSI-GNTISVPIISGIGVTGTGHSEILPGPS---GDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFN-DKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI 1765
            K  + P+ + D ++ + Y + +  G+GGFAKCYE+ D   +++FAGKI+ K  +     +EK  QEITIHR+L++ NIVKF++YFED+ N+YI+LELCK +S++ELHKRRK ITE E RY+  QI +  +Y+H  +IIHRDLKL N+FLN  + VK+GDFGLAT++EY+GERKKT+CGTPNYIAPE+L K+GHSFEVD WS+GC++YTLL+G+PPFET+TL+DTY+KIKK EY +P  L     +++ A+L  +   RP++ +LL  EF KG  +P  LP+S +T  PR    D I+  +  KPL  + G       +    +    H  I          E+Y +  I  L +Q+ N+I           P     +L +E+ +P   P++W++KWVDYSD+YG GYQL D   GV+FND +++IL  N  N+ +I+K+G E   T T Y   L KK+ LL YF+ YMIE+L+ AG N  N + + + R+P++ +WFRT  A+V++L+NG+VQ+N F DH KLI+CP + A+TY+D  K+FRT++  ++   G++ +++Q+++Y    + ++
Sbjct:    8 KSTDIPDRLVDINQRKTYKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKLMIKHNQKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYRVPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKVPMFLPSSCLTMAPRIGSNDTIEDSMHRKPLMEMNGIRPDDTRLESTFLKANLHDAITASAQVCRHSEDYRSD-IESLYQQLTNLI--------NGKPRILQGNLGDENTDPAAQPLFWISKWVDYSDKYGFGYQLCDEGIGVMFNDTTKLILLPNQINVHFIDKDGKETYMTTTDYCKSLDKKMKLLSYFKRYMIEHLVKAGANNVNIESDQISRMPHLHSWFRTTCAVVMHLTNGSVQLN-FSDHMKLILCPRMSAITYMDQEKNFRTYRFSTIVENGVSKDLYQKIRYAQEKLRKM 570          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 186.037 bits (471), Expect = 7.129e-50
Identity = 93/253 (36.76%), Postives = 150/253 (59.29%), Query Frame = 2
Query:  134 YTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVY-IMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEF 886
            Y    LLG+GGFA  Y+ R    ++  A K+I K  I+ +G   +++QE+ IH  L + ++++ Y +F+D   VY ++      +    ++   +  TE E     KQ+     Y+H   I+HRD+ L+N+ L+++M VK+ DFGLAT+L+   ER  TMCGTPNYI+PEV+ +  H    D WS+GC++YTLL+G+PPFET+ ++ T  K+  +EY +P +L    Q++I  LL     +R ++  +L   F
Sbjct:   14 YEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPF 266          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 136.346 bits (342), Expect = 1.097e-34
Identity = 95/281 (33.81%), Postives = 148/281 (52.67%), Query Frame = 2
Query:   80 SKMDNTPEIIFDQSRNQRYTKGKLLGRGGFA--KCYELRDSNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFL---NKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKN--EYSIPF--NLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKG 895
            +K  +  E+    S  ++Y    LLG G F+  +  E +DS  E FA KII K  +K  G  E L+ EI + R L++ NIV+    +ED   VY+++EL     L +    +   TE +  +  +QI +A +Y+H+Q ++HRDLK  N+     + D  + + DFGL +K+E D     T CGTP Y+APEVL ++ +   VD WS+G I Y LL G PPF  E   + + +I K   E+  P+   + +S +  I+ L+     KR +  + L   +  G
Sbjct:   13 AKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALK--GKEESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGL-SKME-DSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISG 289          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0086450)

HSP 1 Score: 140.969 bits (354), Expect = 1.428e-34
Identity = 85/246 (34.55%), Postives = 139/246 (56.50%), Query Frame = 2
Query:  146 KLLGRGGFAKCYELRD--SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLR-KEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLL 874
            K +G+G FAK    +   +  E+ A KII K+ + N GS +KL +E+ I + L + NIVK +   E    +Y+++E      + +      ++ E E R   +QI  A +Y HQ++IIHRDLK  N+ L+ ++ +K+ DFG + +    G +  T CG+P Y APE+ + K+    EVD WSLG I+YTL+ G  PF+  TLR+   ++ + +Y IPF +    + ++R  L  +  KR S+  ++
Sbjct:  257 KTIGKGNFAKVKLAKHLPTGKEV-AIKIIDKTQL-NPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFT-PGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIM 499          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Zebrafish
Match: plk1 (polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-021115-7])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 285/577 (49.39%), Postives = 401/577 (69.50%), Query Frame = 2
Query:   77 NSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFD------NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGS 1780
            ++ +   P+++ D    +RY +G+ LG+GGFAKCYE+ D +  E+FAGK++ KS +     +EK+  EI IH++L N ++V F+ +FED+  VY++LE+C+ +SLLELHKRRK +TEPE RYF +Q  +  +Y+H  ++IHRDLKL N+FLN DM VK+GDFGLATK+E+DGERKKT+CGTPNYIAPEVL K+GHSFEVD WSLGCI+YTLL+GKPPFET  L++TY +IKKNEYS+P ++      +IR +L +D   RPS+ +LL  EF+  G+ P  LPTS +T  PRF       +  +  KPLSS+      P I  +G       E L    G E  +  ++ D+++Q       + ++N+A  PS +     EE+E+P   PV+W++KWVDYSD+YGLGYQLSD S GV+FND +R+I+ A+  +LQYI++N  E   ++ SYP  L KK+TLL+YF+ YM E+L+ AG N+   + + + RLPY++ WFRTKSAIVL+LSNGTVQIN F DHTKLI+CPL+GAVTYI+  ++F T+K+  +   G   E+  RL+Y   M+E++ +  S
Sbjct:   20 SAPLKEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPRFSIAPSSLDPALLRKPLSSLNKGTDSP-IEKMGKMDQPQREDLQQRDGPEQPDT-HLTDMLQQ-------LAVVNAAK-PSDRDFIRQEEAEDPACIPVFWISKWVDYSDKYGLGYQLSDNSVGVLFNDSTRLIMCADGDSLQYIDRNSLESYLSVRSYPSALSKKITLLKYFRNYMSEHLLKAGANITPREGDELTRLPYLRHWFRTKSAIVLHLSNGTVQINFFQDHTKLILCPLMGAVTYINEKREFYTYKMTLIEEFGCCKELASRLRYARNMVEKLMACKS 586          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Zebrafish
Match: plk1 (polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-021115-7])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 285/577 (49.39%), Postives = 401/577 (69.50%), Query Frame = 2
Query:   77 NSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFD------NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGS 1780
            ++ +   P+++ D    +RY +G+ LG+GGFAKCYE+ D +  E+FAGK++ KS +     +EK+  EI IH++L N ++V F+ +FED+  VY++LE+C+ +SLLELHKRRK +TEPE RYF +Q  +  +Y+H  ++IHRDLKL N+FLN DM VK+GDFGLATK+E+DGERKKT+CGTPNYIAPEVL K+GHSFEVD WSLGCI+YTLL+GKPPFET  L++TY +IKKNEYS+P ++      +IR +L +D   RPS+ +LL  EF+  G+ P  LPTS +T  PRF       +  +  KPLSS+      P I  +G       E L    G E  +  ++ D+++Q       + ++N+A  PS +     EE+E+P   PV+W++KWVDYSD+YGLGYQLSD S GV+FND +R+I+ A+  +LQYI++N  E   ++ SYP  L KK+TLL+YF+ YM E+L+ AG N+   + + + RLPY++ WFRTKSAIVL+LSNGTVQIN F DHTKLI+CPL+GAVTYI+  ++F T+K+  +   G   E+  RL+Y   M+E++ +  S
Sbjct:   20 SAPLKEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPRFSIAPSSLDPALLRKPLSSLNKGTDSP-IEKMGKMDQPQREDLQQRDGPEQPDT-HLTDMLQQ-------LAVVNAAK-PSDRDFIRQEEAEDPACIPVFWISKWVDYSDKYGLGYQLSDNSVGVLFNDSTRLIMCADGDSLQYIDRNSLESYLSVRSYPSALSKKITLLKYFRNYMSEHLLKAGANITPREGDELTRLPYLRHWFRTKSAIVLHLSNGTVQINFFQDHTKLILCPLMGAVTYINEKREFYTYKMTLIEEFGCCKELASRLRYARNMVEKLMACKS 586          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Zebrafish
Match: plk2b (polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-070720-17])

HSP 1 Score: 283.878 bits (725), Expect = 2.740e-86
Identity = 136/283 (48.06%), Postives = 201/283 (71.02%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF 946
            II D +  + Y +GK+LG+GGFAKCYE+ D S+++I+A KII  + +     REK+ +EI +HR LS+++IV FYH+FED  N+YI+LE C  +SL  + K RK +TEPE RY+ KQ   A +Y+H  +I+HRDLKL N+F++  M +K+GDFGLA KLE    R+KT+CGTPNY++PEVL K+GH +E D W+LGCI+YT+L+GKPPFET  L++TY  I++  Y++P +L    +++I  +L  + + RP ++ ++  EF+ +GF+P  LP S   + P F
Sbjct:   44 IITDPNTGKCYCRGKVLGKGGFAKCYEMTDLSSSKIYAAKIIPHTRVSKPHQREKINREIELHRTLSHKHIVHFYHHFEDKDNIYILLEYCGRRSLAHILKARKVLTEPEVRYYLKQTVSALKYLHDLEILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDVWALGCIMYTMLLGKPPFETTNLKETYRCIREARYTLPSSLSLPAKQLISGMLAQNPVDRPHLDDIIRHEFFTQGFMPETLPVSCCLSAPDF 326          

HSP 2 Score: 129.028 bits (323), Expect = 9.159e-31
Identity = 64/179 (35.75%), Postives = 105/179 (58.66%), Query Frame = 2
Query: 1226 WVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            WV KWVDYS++YG GYQLSD + GV+FN  + + L ++ + +      G + ++++   P+     VT+L+YF  YM ENLM  G+ +        R+ Y+  W ++  A+++  ++GT Q+N + DHTKLI+C       +TYI+  +   TF+L +L   G T ++  RL+Y L M+
Sbjct:  475 WVTKWVDYSNKYGFGYQLSDNTVGVLFNSGTHMSLLSDKKTVHQYAALGQKSVFSVIEAPECAVAHVTILKYFAHYMEENLMDGGDVISEPDIQKTRI-YLLQWLKSDRALLMLFNDGTFQVNFYHDHTKLILCTQQDEYLLTYINEERTSATFQLSTLLSAGCTADLRSRLEYALNML 652          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Zebrafish
Match: plk2b (polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-070720-17])

HSP 1 Score: 283.878 bits (725), Expect = 2.740e-86
Identity = 136/283 (48.06%), Postives = 201/283 (71.02%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF 946
            II D +  + Y +GK+LG+GGFAKCYE+ D S+++I+A KII  + +     REK+ +EI +HR LS+++IV FYH+FED  N+YI+LE C  +SL  + K RK +TEPE RY+ KQ   A +Y+H  +I+HRDLKL N+F++  M +K+GDFGLA KLE    R+KT+CGTPNY++PEVL K+GH +E D W+LGCI+YT+L+GKPPFET  L++TY  I++  Y++P +L    +++I  +L  + + RP ++ ++  EF+ +GF+P  LP S   + P F
Sbjct:   44 IITDPNTGKCYCRGKVLGKGGFAKCYEMTDLSSSKIYAAKIIPHTRVSKPHQREKINREIELHRTLSHKHIVHFYHHFEDKDNIYILLEYCGRRSLAHILKARKVLTEPEVRYYLKQTVSALKYLHDLEILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDVWALGCIMYTMLLGKPPFETTNLKETYRCIREARYTLPSSLSLPAKQLISGMLAQNPVDRPHLDDIIRHEFFTQGFMPETLPVSCCLSAPDF 326          

HSP 2 Score: 129.028 bits (323), Expect = 9.159e-31
Identity = 64/179 (35.75%), Postives = 105/179 (58.66%), Query Frame = 2
Query: 1226 WVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            WV KWVDYS++YG GYQLSD + GV+FN  + + L ++ + +      G + ++++   P+     VT+L+YF  YM ENLM  G+ +        R+ Y+  W ++  A+++  ++GT Q+N + DHTKLI+C       +TYI+  +   TF+L +L   G T ++  RL+Y L M+
Sbjct:  475 WVTKWVDYSNKYGFGYQLSDNTVGVLFNSGTHMSLLSDKKTVHQYAALGQKSVFSVIEAPECAVAHVTILKYFAHYMEENLMDGGDVISEPDIQKTRI-YLLQWLKSDRALLMLFNDGTFQVNFYHDHTKLILCTQQDEYLLTYINEERTSATFQLSTLLSAGCTADLRSRLEYALNML 652          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Zebrafish
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 280.026 bits (715), Expect = 7.523e-85
Identity = 136/285 (47.72%), Postives = 202/285 (70.88%), Query Frame = 2
Query:  101 EIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFD 949
            +++ D    + Y KGKLLG+GGFA+CYE+ D +NN+++A K+I +S +     REK+  EI +H++L ++++VKF H+FED  N+YI LELC  KSL  + K R  +T+PE RY+ +QI  + +Y+H + I+HRDLKL N F+N++M ++LGDFGLA KLE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTLL G PPFET  L++TY  IK+ +YS+P +L  S Q++I ++L  +   R +++++L  +++ KGF P  LP S    VP  +
Sbjct:   48 QVVVDAKTGRSYCKGKLLGKGGFARCYEMTDLANNKMYAVKVIPQSRVSKPHQREKIINEIELHKSLQHKHVVKFSHHFEDQDNIYIFLELCSRKSLAHIWKARHTLTDPEVRYYLRQIISSLKYLHNKGILHRDLKLGNFFVNENMELRLGDFGLAAKLETVEQRKKTICGTPNYLAPEVLNRQGHGTESDVWSLGCVMYTLLCGNPPFETLDLKETYKCIKEVKYSLPSSLTPSAQKLISSILQKNPCDRLTLDQILAHDYFTKGFTPEKLPPSSCVMVPELN 332          

HSP 2 Score: 122.865 bits (307), Expect = 8.067e-29
Identity = 62/189 (32.80%), Postives = 105/189 (55.56%), Query Frame = 2
Query: 1217 PVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA---VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSS 1774
            P  WV KWVDYS++YG GYQLS+ + GV+FN+ + + L    + + Y   N   F +   + P+KL+ +  ++     YM +NLM  G+    D +S    P +  W +T  A+V+   N T+Q+N + DHTK+I+C    A   VT+I   +   ++ L  L   G + E+ QRL Y +++++  +++
Sbjct:  473 PFIWVTKWVDYSNKYGFGYQLSNQNVGVLFNEGTHLSLCDQRRTVHYCLTNNKHFSFPANALPEKLQSQKHIVDLMANYMEQNLMEGGDINCED-QSSSSSPLLLQWIKTDHALVMLFDNRTLQVNFYTDHTKIILCKPSDASYLVTFISKERVSYSYPLNVLSELGCSPELRQRLHYVVQLLQHYTNA 660          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Xenopus
Match: plk1 (polo like kinase 1 [Source:NCBI gene;Acc:407937])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 283/585 (48.38%), Postives = 404/585 (69.06%), Query Frame = 2
Query:   74 TNSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNI-----QIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            ++S +   PEI+ D    +RY +G+ LG+GGFAKCYE+ D  + E+FAGKI+ K+ +     ++K+  EI I R+L + ++V F+ +FEDN  VY++LELC+ +SLLELHKRRK +TEPE RY+ KQ    C+Y+H  ++IHRDLKL N+FLN +M VK+GDFGLATK+EYDGERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYS+P ++      +I+ +L S+   RP+++ LL  EF+  G+IPS LPT+ +T  PRF        Q   KPL++I      P++    V      E +  P   E  +  Y+ ++++Q+  V        +A  PS++ +   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+I+  +  +LQYIE+N +E    + SYP  L KK+TLL+YF+ YM E+L+ AG N+   + + + RLP+++ WFRT+SAI+L+LSNGTVQIN F DHTK+I+CPL+ AV+YID  ++F T+KL  ++  G   E+  RL+Y   M+E++ SS S    V+ +
Sbjct:   24 SSSSVKEIPEILVDPRTRRRYLRGRFLGKGGFAKCYEITDLESREVFAGKIVPKTMLLKPHQKDKMTMEIAIQRSLDHRHVVGFHGFFEDNDFVYVVLELCRRRSLLELHKRRKAVTEPEARYYLKQTILGCQYLHSNRVIHRDLKLGNLFLNDEMEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVGKPPFETSCLKETYMRIKKNEYSVPKHINPMATALIQKMLRSEPTSRPTIDDLLNDEFFTTGYIPSRLPTTCLTVPPRFSIAPSTIDQSLRKPLTAINKGQDSPLVEKQSV--PAKEEEMQQPESTEPADC-YLSEMLQQLTCV--------NAVKPSERAVIRQEEAEDPASVPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLIMYNDGDSLQYIERNNSESYLNVRSYPAALTKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPFLRTWFRTRSAIILHLSNGTVQINFFQDHTKIILCPLMAAVSYIDEKREFHTYKLSLIQEFGCCKELASRLRYARTMVEKLQSSKSGVAHVKAS 597          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Xenopus
Match: plk1 (polo like kinase 1 [Source:NCBI gene;Acc:407937])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 283/585 (48.38%), Postives = 404/585 (69.06%), Query Frame = 2
Query:   74 TNSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNI-----QIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            ++S +   PEI+ D    +RY +G+ LG+GGFAKCYE+ D  + E+FAGKI+ K+ +     ++K+  EI I R+L + ++V F+ +FEDN  VY++LELC+ +SLLELHKRRK +TEPE RY+ KQ    C+Y+H  ++IHRDLKL N+FLN +M VK+GDFGLATK+EYDGERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYS+P ++      +I+ +L S+   RP+++ LL  EF+  G+IPS LPT+ +T  PRF        Q   KPL++I      P++    V      E +  P   E  +  Y+ ++++Q+  V        +A  PS++ +   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+I+  +  +LQYIE+N +E    + SYP  L KK+TLL+YF+ YM E+L+ AG N+   + + + RLP+++ WFRT+SAI+L+LSNGTVQIN F DHTK+I+CPL+ AV+YID  ++F T+KL  ++  G   E+  RL+Y   M+E++ SS S    V+ +
Sbjct:   12 SSSSVKEIPEILVDPRTRRRYLRGRFLGKGGFAKCYEITDLESREVFAGKIVPKTMLLKPHQKDKMTMEIAIQRSLDHRHVVGFHGFFEDNDFVYVVLELCRRRSLLELHKRRKAVTEPEARYYLKQTILGCQYLHSNRVIHRDLKLGNLFLNDEMEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVGKPPFETSCLKETYMRIKKNEYSVPKHINPMATALIQKMLRSEPTSRPTIDDLLNDEFFTTGYIPSRLPTTCLTVPPRFSIAPSTIDQSLRKPLTAINKGQDSPLVEKQSV--PAKEEEMQQPESTEPADC-YLSEMLQQLTCV--------NAVKPSERAVIRQEEAEDPASVPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLIMYNDGDSLQYIERNNSESYLNVRSYPAALTKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPFLRTWFRTRSAIILHLSNGTVQINFFQDHTKIILCPLMAAVSYIDEKREFHTYKLSLIQEFGCCKELASRLRYARTMVEKLQSSKSGVAHVKAS 585          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Xenopus
Match: plk1 (polo like kinase 1 [Source:NCBI gene;Acc:407937])

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 278/585 (47.52%), Postives = 392/585 (67.01%), Query Frame = 2
Query:   74 TNSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNI-----QIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            ++S +   PEI+ D    +RY +G+ LG+GGFAKCYE+ D  + E+FAGKI+ K+ +     ++K+  EI I R+L + ++V F+ +FEDN  VY++LELC+ +SLLELHKRRK +TEPE RY+ KQ    C+Y+H  ++IHRDLKL N+FLN +M VK+GDFGLATK+EYDGERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYS+P ++      +I+ +L S+   RP+++ LL  EF+  G+IPS LPT+ +T  PRF        Q   KPL++I      P++                    EN+                   + I +++Y S       EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+I+  +  +LQYIE+N +E    + SYP  L KK+TLL+YF+ YM E+L+ AG N+   + + + RLP+++ WFRT+SAI+L+LSNGTVQIN F DHTK+I+CPL+ AV+YID  ++F T+KL  ++  G   E+  RL+Y   M+E++ SS S    V+ +
Sbjct:   44 SSSSVKEIPEILVDPRTRRRYLRGRFLGKGGFAKCYEITDLESREVFAGKIVPKTMLLKPHQKDKMTMEIAIQRSLDHRHVVGFHGFFEDNDFVYVVLELCRRRSLLELHKRRKAVTEPEARYYLKQTILGCQYLHSNRVIHRDLKLGNLFLNDEMEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVGKPPFETSCLKETYMRIKKNEYSVPKHINPMATALIQKMLRSEPTSRPTIDDLLNDEFFTTGYIPSRLPTTCLTVPPRFSIAPSTIDQSLRKPLTAINKGQDSPLV--------------------ENW-------------------EYIEASEYNS--CCSFSEEAEDPASVPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLIMYNDGDSLQYIERNNSESYLNVRSYPAALTKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPFLRTWFRTRSAIILHLSNGTVQINFFQDHTKIILCPLMAAVSYIDEKREFHTYKLSLIQEFGCCKELASRLRYARTMVEKLQSSKSGVAHVKAS 587          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Xenopus
Match: plk3 (polo-like kinase 3 [Source:NCBI gene;Acc:448451])

HSP 1 Score: 400.979 bits (1029), Expect = 1.015e-131
Identity = 222/566 (39.22%), Postives = 355/566 (62.72%), Query Frame = 2
Query:  101 EIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEP-NLA-PVY--WVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSS 1774
            ++I D    + YTKG+LLG+GGFA+CYE+ + + N+ +A K+I  S +     REK+  EI +HR L ++++VKF H+FED+ N+YI LE+C  KSL  + K R  + EPE RYF KQI    +Y+H + I+HRDLKL N F+N+ M +K+GDFGLA +LE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTLL G PPFET  L++TY  IK+ +Y++P  L  + + ++  +L     +R +++++LE EF+ KG+ P  LP S    VP   ++   N P  S+   ++  +       G   S+ +        +   Y VD     ++ +    +I +A    K  L  M     P +LA P +  WV+KWVDYS++YG GYQLS+ S GV+FN  + ++L A+ +++ Y   N   F++  ++ P++L+ ++++LQYF TYM +NLM  G+   +++ S   L  ++ W +T+ A+++  SNGT+Q+N + DHTK+I+C    A  +TYI+  ++ +TF L +L   G ++EM+ RL+YT++++++ + S
Sbjct:   49 KLITDPLTGKAYTKGRLLGKGGFARCYEMTEVATNKTYAVKVIPHSRVAKPHQREKIVNEIDLHRELHHKHVVKFSHHFEDSENIYIFLEICSRKSLAHIWKARHTLLEPEVRYFLKQIISGLKYLHLKGILHRDLKLGNFFINESMELKVGDFGLAARLEPPEQRKKTICGTPNYLAPEVLYRQGHGPESDIWSLGCVMYTLLCGTPPFETSDLKETYRCIKQVKYTLPACLSSAAKHLLMGILKRTPGERLTLDQILEHEFFTKGYTPDKLPPSSCVMVP---DLHPPN-PAKSLFTKVAKSLF------GKTKSKSMYLLLSLFFFFMYYHVD---SFEDCVTASGVIETALAVLKDSLSSMPAEGNPTSLAKPEHFVWVSKWVDYSNKYGFGYQLSNRSIGVLFNSGTHMVLPAHRRHVHYNLTNSRHFVFPTSAVPEQLQGQMSILQYFATYMEKNLMKGGDLPCHEEGSQTPLLLLQ-WVKTEHALLMLFSNGTLQVNFYNDHTKIILCKPQDAYLLTYINRDRNSQTFLLNTLTQTGCSSEMYHRLRYTVKLLQQKAES 600          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Xenopus
Match: plk3 (polo-like kinase 3 [Source:NCBI gene;Acc:448451])

HSP 1 Score: 399.053 bits (1024), Expect = 6.747e-131
Identity = 224/567 (39.51%), Postives = 355/567 (62.61%), Query Frame = 2
Query:  101 EIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESE--EPNLA-PVY--WVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSS 1774
            ++I D    + YTKG+LLG+GGFA+CYE+ + + N+ +A K+I  S +     REK+  EI +HR L ++++VKF H+FED+ N+YI LE+C  KSL  + K R  + EPE RYF KQI    +Y+H + I+HRDLKL N F+N+ M +K+GDFGLA +LE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTLL G PPFET  L++TY  IK+ +Y++P  L  + + ++  +L     +R +++++LE EF+ KG+ P  LP S    VP   ++   N P  S+   ++  +       G   S+ +   S     N+  +  L  +     V   I  S    S    D  E+SE    +LA P +  WV+KWVDYS++YG GYQLS+ S GV+FN  + ++L A+ +++ Y   N   F++  ++ P++L+ ++++LQYF TYM +NLM  G+   +++ S   L  ++ W +T+ A+++  SNGT+Q+N + DHTK+I+C    A  +TYI+  ++ +TF L +L   G ++EM+ RL+YT++++++ + S
Sbjct:   57 KLITDPLTGKAYTKGRLLGKGGFARCYEMTEVATNKTYAVKVIPHSRVAKPHQREKIVNEIDLHRELHHKHVVKFSHHFEDSENIYIFLEICSRKSLAHIWKARHTLLEPEVRYFLKQIISGLKYLHLKGILHRDLKLGNFFINESMELKVGDFGLAARLEPPEQRKKTICGTPNYLAPEVLYRQGHGPESDIWSLGCVMYTLLCGTPPFETSDLKETYRCIKQVKYTLPACLSSAAKHLLMGILKRTPGERLTLDQILEHEFFTKGYTPDKLPPSSCVMVP---DLHPPN-PAKSLFTKVAKSLF------GKTKSKSIHAVSA----NSSPVDTLTEEASGKSVSRSIRGSLVSSS----DAFEDSEGNPTSLAKPEHFVWVSKWVDYSNKYGFGYQLSNRSIGVLFNSGTHMVLPAHRRHVHYNLTNSRHFVFPTSAVPEQLQGQMSILQYFATYMEKNLMKGGDLPCHEEGSQTPLLLLQ-WVKTEHALLMLFSNGTLQVNFYNDHTKIILCKPQDAYLLTYINRDRNSQTFLLNTLTQTGCSSEMYHRLRYTVKLLQQKAES 604          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Mouse
Match: Plk1 (polo like kinase 1 [Source:MGI Symbol;Acc:MGI:97621])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 284/581 (48.88%), Postives = 411/581 (70.74%), Query Frame = 2
Query:   98 PEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPG-PSGDENYNNR--------YIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            PE++ D    ++Y +G+ LG+GGFAKC+E+ D++  E+FAGKI+ KS +     +EK+  EI+IHR+L+++++V F+ +FED+  V+++LELC+ +SLLELHKRRK +TEPE RY+ +QI   C+Y+H+ ++IHRDLKL N+FLN+D+ VK+GDFGLATK+EY+GERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYSIP ++      +I+ +L +D   RP++++LL  EF+  G+IP+ LP + +T  PRF          SS+  +   P    + V   G    LP  P   E    R        ++ DL++Q+ +V        +A  PS++ L   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+IL  +  +LQYIE++GTE   T++S+P+ L KK+TLL YF+ YM E+L+ AG N+   + + + RLPY++ WFRT+SAI+L+LSNGTVQIN F DHTKLI+CPL+ AVTYI+  +DF+T++L  L   G   E+  RL+Y   M++++ SS S + R++ +
Sbjct:   41 PEVLVDPRSRRQYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHDFFEDSDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELLNDEFFTSGYIPARLPITCLTIPPRFSIAP------SSLDPSSRKP----LKVLNKGVENPLPDRPREKEEPVVRETNEAIECHLSDLLQQLTSV--------NASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLNYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGTVQINFFQDHTKLILCPLMAAVTYINEKRDFQTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS 603          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Mouse
Match: Plk2 (polo like kinase 2 [Source:MGI Symbol;Acc:MGI:1099790])

HSP 1 Score: 389.808 bits (1000), Expect = 1.640e-126
Identity = 220/625 (35.20%), Postives = 345/625 (55.20%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFD------------------------------------------------NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQI-----------KNVIVDMKIINSADYPSKKMLDLMEESEEPNLAP-------VYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESM--IRLP--YVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            II D +  +RY +GK+LG+GGFAKCYE+ D +NN+++A KII  S +     REK+ +EI +HR L ++++V+FYHYFED  N+YI+LE C  +S+  + K RK +TEPE RY+ +QI    +Y+H+Q+I+HRDLKL N F+N+ M +K+GDFGLA +LE    R++T+CGTPNY++PEVL K+GH  E D W+LGC++YT+L+G+PPFET  L++TY  I++  Y++P +L    + +I ++L  +   RPS++ ++  +F+ +GF P  L +S   TVP F                                                  + I  +P     +    P  + +  +GT   E           N + I D IR I              + D  + + AD  ++ +   +E   E +  P         WV KWVDYS++YG GYQLSD + GV+FN+ + + L  + + + Y  + G   ++  T  P++   +VT+L+YF  YM ENLM  G     D  S+  IR P  Y+  W ++  A+++  ++GT Q+N + DHTK+I+C       +TYI+  +   TF+L +L   G + E+  R++Y L M+
Sbjct:   69 IIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRLLHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKNFFKKAAAALFGGKKDKARYNDTHNKVSKEDEDIYKLRHDLKKVSITQQPSKHRADEEPQPPPTTVARSGTSAVE-----------NKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGG-----DLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICNQSEEYLLTYINEDRISTTFRLTTLLMSGCSLELKNRMEYALNML 677          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Mouse
Match: Plk3 (polo like kinase 3 [Source:MGI Symbol;Acc:MGI:109604])

HSP 1 Score: 383.645 bits (984), Expect = 1.318e-124
Identity = 218/595 (36.64%), Postives = 337/595 (56.64%), Query Frame = 2
Query:   65 VLFTNSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEI-FAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPR------------------FDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQ--------------IKNVIVDMKIINSADYPSKKMLDLMEESEEPNLA------PVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVC---PLVGAVTYIDGTKDFRTFKLESLRHKGMTNE 1720
            VL      D    +I D    + YTKG+LLG+GGFA+CYE  D+ + I +A K+I +S +     REK+  EI +HR+L + +IV+F H+FED  N+YI LELC  KSL  + K R  + EPE RY+ +QI    +Y+HQ+ I+HRDLKL N F+  +M +K+GDFGLA +LE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTLL G PPFET  L++TY  IK+  Y++P +L    ++++ A+L +    RPS+ ++L  +F+ KG+ P  LP S   TVP                   F   + KNK  S   + +S  ++SG+  T  GH ++ P            +V+   +               +  +    ++ SA    +  +  M  +E+ N A      P+ WV+KWVDYS+++G GYQLS     V+FND + + L+AN + + Y   +   F +++ S P  L+ ++ +L+YF +YM ++LM  G+    ++  +   P +  W +T  A+++  S+GTVQ+N +GDHTKLI+    PL+  VT++   +   T+    LR  G + +
Sbjct:   40 VLAGPRAPDPPGRLITDPLSGRTYTKGRLLGKGGFARCYEATDTESGIAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITDNMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIEQILRHDFFTKGYTPDRLPVSSCVTVPDLTPPNPARSLFAKVTKSLFGRKKNKNKNHSEDQDNVSC-LVSGLMRTSIGHPDVRPEAPVVSGQAPASLVETAAEDSSPRGTLASSGDGFEEGLTVATVVESALCALRNCVAFMPPAEQ-NPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSMGSVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEAEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLL--VTFVARNRSACTYLASHLRQLGCSPD 630          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Mouse
Match: Plk3 (polo like kinase 3 [Source:MGI Symbol;Acc:MGI:109604])

HSP 1 Score: 379.793 bits (974), Expect = 1.410e-123
Identity = 217/588 (36.90%), Postives = 335/588 (56.97%), Query Frame = 2
Query:   65 VLFTNSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEI-FAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPR------------------FDNIQIKNKPLSSIGNTIS--VPIISG---IGVTGTGHSEILP----GPSGDENYNNRYIVDLIRQ----IKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVC---PLVGAVTYIDGTKDFRTFKLESLRHKGMTNE 1720
            VL      D    +I D    + YTKG+LLG+GGFA+CYE  D+ + I +A K+I +S +     REK+  EI +HR+L + +IV+F H+FED  N+YI LELC  KSL  + K R  + EPE RY+ +QI    +Y+HQ+ I+HRDLKL N F+  +M +K+GDFGLA +LE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTLL G PPFET  L++TY  IK+  Y++P +L    ++++ A+L +    RPS+ ++L  +F+ KG+ P  LP S   TVP                   F   + KNK  S   + +S   P++SG     +  T   +  P      SGD       +  ++      ++N +  M        P+++    + + E     P+ WV+KWVDYS+++G GYQLS     V+FND + + L+AN + + Y   +   F +++ S P  L+ ++ +L+YF +YM ++LM  G+    ++  +   P +  W +T  A+++  S+GTVQ+N +GDHTKLI+    PL+  VT++   +   T+    LR  G + +
Sbjct:   19 VLAGPRAPDPPGRLITDPLSGRTYTKGRLLGKGGFARCYEATDTESGIAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITDNMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIEQILRHDFFTKGYTPDRLPVSSCVTVPDLTPPNPARSLFAKVTKSLFGRKKNKNKNHSEDQDNVSCLAPVVSGQAPASLVETAAEDSSPRGTLASSGDGFEEGLTVATVVESALCALRNCVAFMP-------PAEQNPAPLAQPE-----PLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSMGSVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEAEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLL--VTFVARNRSACTYLASHLRQLGCSPD 592          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Mouse
Match: Plk5 (polo like kinase 5 [Source:MGI Symbol;Acc:MGI:3026984])

HSP 1 Score: 306.605 bits (784), Expect = 1.404e-95
Identity = 185/539 (34.32%), Postives = 284/539 (52.69%), Query Frame = 2
Query:  113 DQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTI------SVPI----ISGIGVTGT--GHSEILPGPSGDENYN-----NRYIVDLIRQIKNVIVDMK--IINSADYPSKKM---LDL--MEESEEPN-LAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKA--------WFRTKSAIVLYLSNGTVQINLFGDHTKLIV 1624
            D    + Y +GKL+G+G F++CY+L D S + +FA K++ + G      R K+++EI +H  L + NIV F+ +F D  +VY++LE C  +SL  + K R+ +TEPE RY+ + +     Y+HQQ+I+HRDLK +N FLNK+M VK+GD GLA ++   G   + +CGTPN+ APEV+ + GHS + D W+LGCI+YT+L G PPF    L + Y  I+   Y  P +L  S + +I  LL  D  +RPS++ LL+ +F+ +GF P  LP     + P F       +    +G  +        P      SG G  GT   H E     +G+E  +      R  +  +   +  +   K  +    +  ++K+   LD   M   + P    PV W  KWVDYS +YG GYQLSDG +GV+F D S + L     ++ Y    GT + +T+   P  L+ K+ +L+ F  YM   L          +E  + +P   A        +     A+V+  SNGTVQ++L    T+L++
Sbjct:   20 DPGSGRVYRRGKLIGKGAFSRCYKLTDMSTSAVFALKVVPRGGAGRLRLRGKVEREIALHSRLRHRNIVAFHAHFADRDHVYMVLEYCSRQSLAHVLKVRRTLTEPEVRYYLRGLVSGLRYLHQQRIVHRDLKPSNFFLNKNMEVKIGDLGLAARVGPAGRCHRVLCGTPNFQAPEVVSRNGHSCKSDIWALGCIMYTVLTGTPPFAAAPLSEMYQNIRDGHYLEPTHLSPSARSLIARLLAPDPAERPSLDHLLQDDFFSQGFTPERLPPHSCHSPPVFAFPPPLGRLFRKVGQLLLTQCRPPCPFTSKEASGPGEEGTEPDHME-----AGNEERDPLCTEGRIHLLTLGTPRTGLAGPKGSLALQLEVATRKLFLCLDAGPMAGQDPPGEQRPVLWAPKWVDYSLKYGFGYQLSDGGSGVLFRDGSHMALRPQGGHVSYQPDQGTLWTFTLRDVPSPLRAKLAVLRLFACYMQRRL---------REEGTVPMPATPASPDISLLSFIADSQAMVMLFSNGTVQVSLKTSQTQLVL 544          
BLAST of Serine/threonine-protein kinase PLK vs. UniProt/SwissProt
Match: sp|Q62673|PLK1_RAT (Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus OX=10116 GN=Plk1 PE=2 SV=2)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 281/577 (48.70%), Postives = 409/577 (70.88%), Query Frame = 2
Query:   98 PEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF----DNIQIKN-KPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            PE++ D    ++Y +G+ LG+GGFAKC+E+ DS+  E+F GKI+ KS +     +EK+  EI+IHR+L+++++V F+ +FED+  V+++LELC+ +SLLELHKRRK +TEPE RY+ +QI   C+Y+H+ ++IHRDLKL N+FLN+D+ VK+GDFGLATK+EY+GERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYSIP ++      +I+ +L +D   RP++++LL  EF+  G+IP+ LP + +T  PRF     ++   N KPL+ +   +  P+            +  P           ++ DL++Q+ +V        +A  PS++ L   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+IL  +  +LQYIE++GTE   T++S+P+ L KK+TLL YF+ YM E+L+ AG N+   + + + RLPY++ WFRT+SAI+L+LSNGTVQIN F DHTKLI+CPL+ AVTYI+  +DFRT++L  L   G   E+  RL+Y   M++++ SS S   R++ +
Sbjct:   41 PEVLMDPRSRRQYVRGRFLGKGGFAKCFEISDSDTKEVFPGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFFEDSDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGVENPL------PDRPREKEEPVVRETNEAIECHLSDLLQQLTSV--------NASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLNYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGTVQINFFQDHTKLILCPLMAAVTYINEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSACNRLKAS 603          
BLAST of Serine/threonine-protein kinase PLK vs. UniProt/SwissProt
Match: sp|Q07832|PLK1_MOUSE (Serine/threonine-protein kinase PLK1 OS=Mus musculus OX=10090 GN=Plk1 PE=1 SV=2)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 284/581 (48.88%), Postives = 411/581 (70.74%), Query Frame = 2
Query:   98 PEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPG-PSGDENYNNR--------YIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            PE++ D    ++Y +G+ LG+GGFAKC+E+ D++  E+FAGKI+ KS +     +EK+  EI+IHR+L+++++V F+ +FED+  V+++LELC+ +SLLELHKRRK +TEPE RY+ +QI   C+Y+H+ ++IHRDLKL N+FLN+D+ VK+GDFGLATK+EY+GERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYSIP ++      +I+ +L +D   RP++++LL  EF+  G+IP+ LP + +T  PRF          SS+  +   P    + V   G    LP  P   E    R        ++ DL++Q+ +V        +A  PS++ L   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+IL  +  +LQYIE++GTE   T++S+P+ L KK+TLL YF+ YM E+L+ AG N+   + + + RLPY++ WFRT+SAI+L+LSNGTVQIN F DHTKLI+CPL+ AVTYI+  +DF+T++L  L   G   E+  RL+Y   M++++ SS S + R++ +
Sbjct:   41 PEVLVDPRSRRQYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHDFFEDSDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELLNDEFFTSGYIPARLPITCLTIPPRFSIAP------SSLDPSSRKP----LKVLNKGVENPLPDRPREKEEPVVRETNEAIECHLSDLLQQLTSV--------NASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLNYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGTVQINFFQDHTKLILCPLMAAVTYINEKRDFQTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS 603          
BLAST of Serine/threonine-protein kinase PLK vs. UniProt/SwissProt
Match: sp|P53350|PLK1_HUMAN (Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 286/577 (49.57%), Postives = 416/577 (72.10%), Query Frame = 2
Query:   98 PEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF----DNIQIKN-KPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            PE++ D    +RY +G+ LG+GGFAKC+E+ D++  E+FAGKI+ KS +     REK+  EI+IHR+L+++++V F+ +FEDN  V+++LELC+ +SLLELHKRRK +TEPE RY+ +QI   C+Y+H+ ++IHRDLKL N+FLN+D+ VK+GDFGLATK+EYDGERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYSIP ++      +I+ +L +D   RP++N+LL  EF+  G+IP+ LP + +T  PRF     ++   N KPL+ +   +  P+            E +   +G+    + ++ D+++Q+ +V        +A  PS++ L   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+IL  +  +LQYIE++GTE   T++S+P+ L KK+TLL+YF+ YM E+L+ AG N+   + + + RLPY++ WFRT+SAI+L+LSNG+VQIN F DHTKLI+CPL+ AVTYID  +DFRT++L  L   G   E+  RL+Y   M++++ SS S + R++ +
Sbjct:   41 PEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPE----RPREKEEPVVRETGE--VVDCHLSDMLQQLHSV--------NASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS 603          
BLAST of Serine/threonine-protein kinase PLK vs. UniProt/SwissProt
Match: sp|Q2TA25|PLK1_BOVIN (Serine/threonine-protein kinase PLK1 OS=Bos taurus OX=9913 GN=PLK1 PE=2 SV=2)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 282/577 (48.87%), Postives = 411/577 (71.23%), Query Frame = 2
Query:   98 PEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF----DNIQIKN-KPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            PE++ D    +RY +G+ LG+GGFAKC+E+ D++  E+FAGKI+ KS +     +EK+  EI+IHR+L+++++V F+ +FEDN  V+++LELC+ +SLLELHKRRK +TEPE RY+ +QI   C+Y+H  ++IHRDLKL N+FLN+D+ VK+GDFGLATK+EYDGERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IK NEYSIP ++      +I+ +L  D   RP++++LL  EF+  G+IP+ LP + +T  PRF     ++   N KPL+ +   +  P+            +  P         + ++ D+++Q+ +V        +A  PS++ L   EE+E+P   P++WV+KWVDYSD+YGLGYQL D S GV+FND +R+IL ++  +LQYIE++G+E   T++S+P+ L KK+TLL+YF+ YM E+L+ AG N+   + + + RLPY++ WFRT+SAI+L+LSNG VQIN F DHTKLI+CPL+ AVTYID  +DFRT++L  L   G + E+  RL+Y   M++++ SS S A R++ +
Sbjct:   39 PEVLVDPRSRRRYLRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHGNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKNNEYSIPKHINPVASSLIKKMLQPDPTARPTIHELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGMENPM------PERPREKEEPVVREASEPVDCHLSDMLQQLHSV--------NASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYSDGDSLQYIERDGSESYLTVSSHPNSLIKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGCVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCSKELASRLRYARAMVDKLLSSRSAANRLKAS 601          
BLAST of Serine/threonine-protein kinase PLK vs. UniProt/SwissProt
Match: sp|P70032|PLK1_XENLA (Serine/threonine-protein kinase PLK1 OS=Xenopus laevis OX=8355 GN=plk1 PE=1 SV=1)

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 285/585 (48.72%), Postives = 403/585 (68.89%), Query Frame = 2
Query:   74 TNSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNI-----QIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVA 1804
            ++S +   PEI+ D    +RY +G+ LG+GGFAKCYE+ D  + E+FAGKI+ K+ +     ++K+  EI I R+L + ++V F+ +FEDN  VY++LELC+ +SLLELHKRRK +TEPE RY+ KQ    C+Y+H  ++IHRDLKL N+FLN +M VK+GDFGLATK+EYDGERKKT+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L++TY +IKKNEYSIP ++      +I+ +L SD   RP+++ LL  EF+  G+IPS LPT+ +T  PRF        Q   KPL++I      P++           E +  P   E  +  Y+ ++++Q+  +        +A  PS++ L   EE+E+P   P++W++KWVDYSD+YGLGYQL D S GV+FND +R+I+  +  +LQYIE+N TE    + SYP  L KK+TLL+YF+ YM E+L+ AG N    + + + RLP+++ WFRT+SAI+L+LSNGTVQIN F DHTK+I+CPL+ AV+YID  ++FRT+KL  ++  G   E+  RL+Y   M+E++ SS S    V+ +
Sbjct:   24 SSSAVKEIPEILVDPRTRRRYLRGRFLGKGGFAKCYEITDLESREVFAGKIVPKTMLLKPHQKDKMTMEIAIQRSLDHRHVVGFHGFFEDNDFVYVVLELCRRRSLLELHKRRKAVTEPEARYYLKQTISGCQYLHSNRVIHRDLKLGNLFLNDEMEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVGKPPFETSCLKETYMRIKKNEYSIPKHINPVAAALIQKMLRSDPTSRPTIDDLLNDEFFTSGYIPSRLPTTCLTVPPRFSIAPSTIDQSLRKPLTAINKGQDSPLVE--KQVAPAKEEEMQQPEFTEPADC-YLSEMLQQLTCL--------NAVKPSERALIRQEEAEDPASIPIFWISKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLIMYNDGDSLQYIERNNTESYLNVRSYPTTLTKKITLLKYFRNYMSEHLLKAGANTTPREGDELARLPFLRTWFRTRSAIILHLSNGTVQINFFQDHTKIILCPLMAAVSYIDEKREFRTYKLSLIQEFGCCKELASRLRYARTMVEKLQSSKSAVAHVKAS 597          
BLAST of Serine/threonine-protein kinase PLK vs. TrEMBL
Match: A0A2T7PIK5 (Serine/threonine-protein kinase PLK OS=Pomacea canaliculata OX=400727 GN=C0Q70_04504 PE=3 SV=1)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 303/591 (51.27%), Postives = 417/591 (70.56%), Query Frame = 2
Query:   89 DNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKN-----KPLSSIGNTISVPIISGI--------GVTGTGHSEILPGP-----SGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI--SSSGSMAGR 1792
            D  P++I DQS  +RY KG+ LG+GGFAKC+EL D +  EIFAGKI+ KS +     ++K+ QEI IHR+L++++IV+F+ +FED  NVYI+LELC+ +SL+ELHKRRK +TEPE RYF +Q+  AC+Y+H  K+IHRDLKL N+F+N DM VK+GDFGLAT+L+YDGERK+T+CGTPNYIAPEVL K+GHSFEVD WS+GCI+YTLL+GKPPFET  L+DTYT+IKKNEY IP  +    + +I  LL +D  +RP M++++E EF+  G++P  LPTS +T  P FD +  K      KPL  + + +  P  + +               +E  P P     +GDE   + ++ DL  Q+  V+        A  P ++M   +EE+E+P   P+YWV+KWVDYSD+YGLGYQL D S GV+FND +R+IL AN +N+ YIE++G E  +T+ S+P+ L KKVTLL+YF+ YM E+L+ AG NM   + + + RLP+++ WFRT+SAIVL+LSNGT+QIN F DHTK+I+CPL+ AVTYID  +DFRT++L  +   G T ++  RL+Y   M+ER+  S SGS+  R
Sbjct:   14 DVIPDVIADQSSGKRYLKGRFLGKGGFAKCFELTDVDTKEIFAGKIVSKSLLVKQHQKDKMSQEIAIHRSLNHKHIVQFHSFFEDTDNVYILLELCRRRSLMELHKRRKAVTEPEARYFVRQVILACQYLHNNKVIHRDLKLGNLFINDDMDVKIGDFGLATRLDYDGERKRTLCGTPNYIAPEVLGKKGHSFEVDVWSMGCIVYTLLVGKPPFETSCLKDTYTRIKKNEYHIPSKISVQARNLITKLLRADPSQRPGMDQIIEDEFFTSGYLPPRLPTSCLTMAPHFDTLMAKTDLVTRKPLLDVNDGLQRPHTAEVMKQEIEKKIKKDQEPAEAAPKPDAGHRAGDEPM-DYWLSDLCSQLSAVV--------ASKPGERMASQIEEAEDPACIPIYWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILLANAENIHYIERDGQEHYHTLKSFPETLNKKVTLLKYFRNYMNEHLLKAGANMIPRESDEISRLPFLRTWFRTRSAIVLHLSNGTLQINFFQDHTKIILCPLMAAVTYIDEKRDFRTYRLNLVDQYGCTKDLASRLRYARTMVERLLTSKSGSVLTR 595          
BLAST of Serine/threonine-protein kinase PLK vs. TrEMBL
Match: A0A5J4NYI6 (Serine/threonine-protein kinase PLK OS=Paragonimus westermani OX=34504 GN=DEA37_0004246 PE=3 SV=1)

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 300/569 (52.72%), Postives = 411/569 (72.23%), Query Frame = 2
Query:   80 SKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDS-NNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFD---NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISS 1771
            SK    PEI+ D    + YT+GK LG+GGFAKCYEL D    E FAGK++ KS +  S  +EK+QQEI IHR L +ENIV F+ YFED   +YI+LELC  +SLLELHKRR+ I+EPE RYF KQI   C+Y+H+ K++HRDLKLAN+FL+ D++VK+GDFGLA+++ ++GE+KKT+CGTPNYIAPEVL K GHSFEVD WSLGCI+YTLL+G PPFET  L +TY +IK+NEY IP+ +     + IRALL ++   RPSM  +L+ EF+K + P+ LP S +TT PRFD   N QI  +PLS I     VPI SG G      S  +     +   N+R++  L ++++ ++ + K++   D  +K     +E+SE+P   P+YWV+KWVDYSD+YGLGYQL D S+GVVFND++R+IL  N QNLQYI+ +G+E  YT++ +P  L+KK+ LL YF+ YM ENL+ AGEN+   + + M RLP+++ WFRT+SAIVL+LSNGT+QIN F DHTK+I+CPL+ AVTYID  +DF+T++ + L+  G+ +++  RL+Y + MI+ +SS
Sbjct:    7 SKHKEPPEIVVDGKNKKTYTRGKFLGKGGFAKCYELVDQLTKEKFAGKVVPKSALVKSSQKEKMQQEICIHRTLKHENIVGFHGYFEDADFIYIVLELCNRRSLLELHKRRRYISEPEARYFLKQIIHGCQYLHRNKVMHRDLKLANLFLSDDLVVKIGDFGLASRIVHEGEKKKTLCGTPNYIAPEVLNKGGHSFEVDCWSLGCILYTLLVGSPPFETNKLEETYARIKQNEYKIPYRISAPASKFIRALLHAEPSMRPSMFNMLDDEFFKDYTPNCLPVSALTTCPRFDAQLNTQIGRRPLSDINPLEDVPITSGGGTLPKASSTAV-----EYQPNDRWLSTLKKELQTLLSNAKVLE--DNTAKA----LEDSEDPACCPIYWVSKWVDYSDKYGLGYQLCDNSSGVVFNDVTRLILAGNLQNLQYIDSDGSENFYTMSEHPASLEKKIVLLNYFKAYMQENLLKAGENVSRREADDMARLPFIRRWFRTRSAIVLHLSNGTLQINFFEDHTKIILCPLMRAVTYIDSNRDFKTYQFDYLQKGGIISDLVGRLEYAIVMIDTLSS 564          
BLAST of Serine/threonine-protein kinase PLK vs. TrEMBL
Match: A0A4S2LUX0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004902 PE=4 SV=1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 295/575 (51.30%), Postives = 412/575 (71.65%), Query Frame = 2
Query:   80 SKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNI---QIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAG 1789
            SK    PE+I D    + YT+GK +G+GGFA+CYEL D +  E FAGK++ KS +  S  +EK+QQEI IHR L +EN+V F+ YFED   +YI+LELC  +SLLELHKRR+ ++EPE RYF KQI   C+Y+H+ K++HRDLKLAN+FLN D+++K+GDFGLA+++  +GE+K+T+CGTPNYIAPEVL K GHSFEVD WSLGCI+YTLL+G PPFET  L +TY +IK NEY IP  +  S  + IRALL+ D  KRPSM  +LE +F+K + P+ LP S +TT PRFD+I   QI  +PLS I     +PI  G G      + +      D    + ++  L +++ +++ + KI+          +  ME+SE+P   P+YWV+KWVDYSD+YGLGYQL D S+GVVFND++R+IL AN QNLQYI+++GTE  +T+T++P  L+KK+TLL YF++YM ENL+ AGEN+   D + + RLP+++ WFRT+SA+VL+LSNGT+QIN F DH K+I+CPL+ AVTYID  +DF+T++ + L+  G+  ++ +RL+Y   MI+ +++S    G
Sbjct:    7 SKYKEPPEVIVDGKNKKTYTRGKFMGKGGFARCYELIDQATQERFAGKVVPKSALVKSSQKEKMQQEICIHRTLKHENVVGFHGYFEDVDFIYIVLELCNRRSLLELHKRRRFLSEPEARYFMKQIINGCQYLHRNKVMHRDLKLANLFLNDDLVIKIGDFGLASRIVNEGEKKRTLCGTPNYIAPEVLTKGGHSFEVDCWSLGCILYTLLVGNPPFETNKLEETYARIKMNEYKIPIRVSASASKFIRALLNKDPSKRPSMFTMLEDDFFKEYTPTSLPVSALTTCPRFDSIVTPQIGRRPLSDINPLEDIPITHGGGTVVKSTTSV------DNQPGDCWLEKLKQELNSLMAEAKILRD------NTVKAMEDSEDPACCPIYWVSKWVDYSDKYGLGYQLCDNSSGVVFNDVTRLILAANLQNLQYIDQDGTESFFTMTTHPPILEKKITLLNYFKSYMQENLLKAGENVARRDSDDLARLPFLRRWFRTRSAMVLHLSNGTLQINFFEDHAKIILCPLMRAVTYIDSNRDFKTYQFQMLQTGGIIQDLVKRLEYAKTMIDTLTASLPQGG 569          
BLAST of Serine/threonine-protein kinase PLK vs. TrEMBL
Match: A0A3R7DNG4 (Serine/threonine-protein kinase PLK1 OS=Clonorchis sinensis OX=79923 GN=Plk1 PE=4 SV=1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 294/575 (51.13%), Postives = 412/575 (71.65%), Query Frame = 2
Query:   80 SKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNI---QIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAG 1789
            SK    PE+I D    + YT+GK +G+GGFA+CYEL D +  E FAGK++ KS +  S  +EK+QQEI IHR L +EN+V F+ YFED   +YI+LELC  +SLLELHKRR+ ++EPE RYF KQI   C+Y+H+ K++HRDLKLAN+FLN D+++K+GDFGLA+++  +GE+K+T+CGTPNYIAPEVL K GHSFEVD WSLGCI+YTLL+G PPFET  L +TY +IK NEY IP  +  S  + IRALL+ D  KRPSM  +LE +F+K + P+ LP S +TT PRFD+I   QI  +PLS I     +PI  G G      + +      D    + ++  L +++ +++ + K++          +  ME+SE+P   P+YWV+KWVDYSD+YGLGYQL D S+GVVFND++R+IL AN QNLQYI+++GTE  +T+T++P  L+KK+TLL YF++YM ENL+ AGEN+   D + + RLP+++ WFRT+SA+VL+LSNGT+QIN F DH K+I+CPL+ AVTYID  +DF+T++ + L+  G+  ++ +RL+Y   MI+ +++S    G
Sbjct:    7 SKYKEPPEVIVDGKNKRTYTRGKFMGKGGFARCYELIDQATQERFAGKVVPKSALVKSSQKEKMQQEICIHRTLKHENVVGFHGYFEDIDFIYIVLELCNRRSLLELHKRRRFLSEPEARYFMKQIINGCQYLHRNKVMHRDLKLANLFLNDDLVIKIGDFGLASRIVNEGEKKRTLCGTPNYIAPEVLTKGGHSFEVDCWSLGCILYTLLVGNPPFETNKLEETYARIKMNEYKIPIRVSASASKFIRALLNKDPSKRPSMFTMLEDDFFKEYTPTSLPVSALTTCPRFDSIVTPQIGRRPLSDINPLEDIPITHGGGTVVKSTASV------DNQPGDCWLEKLKQELNSLMAEAKVLRD------NTVKAMEDSEDPACCPIYWVSKWVDYSDKYGLGYQLCDNSSGVVFNDVTRLILAANLQNLQYIDQDGTESFFTMTTHPPILEKKITLLNYFKSYMQENLLKAGENVARRDSDDLARLPFLRRWFRTRSAMVLHLSNGTLQINFFEDHAKIILCPLMRAVTYIDSNRDFKTYQFQMLQTGGIIQDLLKRLEYAKTMIDTLTASLPQGG 569          
BLAST of Serine/threonine-protein kinase PLK vs. TrEMBL
Match: A0A1S3J0I1 (Serine/threonine-protein kinase PLK OS=Lingula unguis OX=7574 GN=LOC106169017 PE=3 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 301/577 (52.17%), Postives = 412/577 (71.40%), Query Frame = 2
Query:   83 KMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCD-STQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQI--KNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRV 1795
            ++   P+++ D +  +RY KG+ LG+GGFAKCYEL D     ++AGK++ K+ +     ++K+ QEI IHR+L+N ++V F+ +FEDN NVYI+LELC+ +SL+ELHKRR+ +TEPE RYF KQI +AC Y+HQ K+IHRDLKL N+FLN +M VK+GDFGLATKL+YDGERK+T+CGTPNYIAPEVL K+GHS+EVD+WSLGCI+YTLLIGKPPFET +L+DTY KIKKNEY +P + C    + +++ LL +D   RPSM  +L+ +F+  GF+PS LPTS +T  PRFD +      KPL  +  T        +     G S         E  ++ Y+ DL  QI  V+        A  P+ K++   EE+E+P   P+YWV+KWVDYSD+YGLGYQL D S GV+FND +R+ILT+N +N+QYIE++GTE  +T+  +P+ L KKVTLL+YF+ YM E+L+ AG N+   + + M+RLP+++ WFRT+SAIVL+LSNGT+QIN F DHTK+I+CP++GAVTYID  ++FRTFK   +   G + E+  RL+Y   MIER+ SS S  G+ 
Sbjct:    8 RVKEVPDVVVDPTSRRRYMKGRFLGKGGFAKCYELTDMETKAVYAGKVVSKALLVKQHQKDKMTQEINIHRSLNNRHVVGFHGFFEDNDNVYILLELCRRRSLMELHKRRRAVTEPEARYFLKQITEACVYLHQNKVIHRDLKLGNLFLNDEMEVKIGDFGLATKLDYDGERKRTLCGTPNYIAPEVLGKKGHSYEVDAWSLGCILYTLLIGKPPFETSSLKDTYMKIKKNEYHMPSSRCSPQAKSLVQKLLRNDPTDRPSMEIILQDDFFTTGFLPSRLPTSCLTMAPRFDQLSKLDARKPLVELNGTEGSNTRQLVKKESEGASRPESSDKSTEP-SDCYLSDLFTQISAVL--------AANPADKVVIQEEEAEDPACVPIYWVSKWVDYSDKYGLGYQLVDNSVGVLFNDSTRLILTSNGENIQYIERDGTEHFHTLRVFPETLTKKVTLLKYFRNYMSEHLLKAGANIIPREGDEMVRLPFLRTWFRTRSAIVLHLSNGTLQINFFQDHTKIILCPVMGAVTYIDEKREFRTFKSCLIEKHGCSKELASRLRYARTMIERLISSKSATGKA 575          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Cavefish
Match: plk1 (polo like kinase 1 [Source:NCBI gene;Acc:103034005])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 285/590 (48.31%), Postives = 404/590 (68.47%), Query Frame = 2
Query:   77 NSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFD------NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI---------SSSGSMAGR 1792
            ++ +   P+I+ D    +RY +G+ LG+GGFAKCYE+ D    E+FAGK++ KS +     +EK+  EI IH++L N ++V F+ +FED+  V+++LE+C+ +SLLELHKRRK +TEPE RYF +Q  +   Y+H  ++IHRDLKL N+FL+ DM VK+GDFGLATK+E+DGERKKT+CGTPNYIAPEVL K+GHSFEVD WSLGCI+YTLL+GKPPFET  L++TY +IKKNEYSIP  +      +IR +L +D   RPS+  LL  EF+  G++P  LPTS +T  PRF       +  +  +PL+++ NT S   I  +G       E L    G E  ++ ++ D+++Q+ +V        +A  PS++     EE+E+P   PV+W++KWVDYSD+YGLGYQL D S GV+FND +R+I+  +  +LQYI++N  E   ++ SYP  L KK+TLL+YF+ YM E+L+ AG N+   D + + RLPY++ WFRTKSAIVL LSNGTVQIN F DHTKLI+CPL+GAVTYI+  ++F T+K+  +   G   E+  RL+Y   M+E++         +++G+ +GR
Sbjct:   19 SAPLKEIPDILVDPRTMKRYMRGRFLGKGGFAKCYEITDMETKEVFAGKVVPKSLLMKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVFVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVHYLHNNRVIHRDLKLGNLFLSDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDVWSLGCILYTLLVGKPPFETSCLKETYVRIKKNEYSIPRQINPVAASLIRRMLHADPTLRPSVADLLTDEFFTSGYVPLRLPTSCLTVPPRFSIAPSSLDPGLLRRPLTAL-NTDSP--IEKMGKGDQPQKEELQQRDGPEQPDS-HLTDMLQQLNSV--------NASRPSERDFVRQEEAEDPACIPVFWISKWVDYSDKYGLGYQLCDNSVGVLFNDFTRLIMYEDGDSLQYIDRNAAESYLSVRSYPPALSKKITLLKYFRNYMSEHLLKAGANITPRDGDELTRLPYLRHWFRTKSAIVLNLSNGTVQINFFQDHTKLILCPLMGAVTYINERREFCTYKMSLIEEYGCCKELASRLRYARSMVEKLMACKNTVAATATGASSGR 596          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Cavefish
Match: plk1 (polo like kinase 1 [Source:NCBI gene;Acc:103034005])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 280/590 (47.46%), Postives = 401/590 (67.97%), Query Frame = 2
Query:   77 NSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFD------NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI---------SSSGSMAGR 1792
            ++ +   P+I+ D    +RY +G+ LG+GGFAKCYE+ D    E+FAGK++ KS +     +EK+  EI IH++L N ++V F+ +FED+  V+++LE+C+ +SLLELHKRRK +TEPE RYF +Q  +   Y+H  ++IHRDLKL N+FL+ DM VK+GDFGLATK+E+DGERKKT+CGTPNYIAPEVL K+GHSFEVD WSLGCI+YTLL+GKPPFET  L++TY +IKKNEYSIP  +      +IR +L +D   RPS+  LL  EF+  G++P  LPTS +T  PRF       +  +  +PL+++   + V  I            ++ GP   ++    ++ D+++Q+ +V        +A  PS++     EE+E+P   PV+W++KWVDYSD+YGLGYQL D S GV+FND +R+I+  +  +LQYI++N  E   ++ SYP  L KK+TLL+YF+ YM E+L+ AG N+   D + + RLPY++ WFRTKSAIVL LSNGTVQIN F DHTKLI+CPL+GAVTYI+  ++F T+K+  +   G   E+  RL+Y   M+E++         +++G+ +GR
Sbjct:   19 SAPLKEIPDILVDPRTMKRYMRGRFLGKGGFAKCYEITDMETKEVFAGKVVPKSLLMKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVFVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVHYLHNNRVIHRDLKLGNLFLSDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDVWSLGCILYTLLVGKPPFETSCLKETYVRIKKNEYSIPRQINPVAASLIRRMLHADPTLRPSVADLLTDEFFTSGYVPLRLPTSCLTVPPRFSIAPSSLDPGLLRRPLTALNTGMLVLFI------------LVDGPEQPDS----HLTDMLQQLNSV--------NASRPSERDFVRQEEAEDPACIPVFWISKWVDYSDKYGLGYQLCDNSVGVLFNDFTRLIMYEDGDSLQYIDRNAAESYLSVRSYPPALSKKITLLKYFRNYMSEHLLKAGANITPRDGDELTRLPYLRHWFRTKSAIVLNLSNGTVQINFFQDHTKLILCPLMGAVTYINERREFCTYKMSLIEEYGCCKELASRLRYARSMVEKLMACKNTVAATATGASSGR 584          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Cavefish
Match: plk2a (serine/threonine-protein kinase PLK2 [Source:NCBI gene;Acc:103036971])

HSP 1 Score: 374.4 bits (960), Expect = 6.557e-121
Identity = 220/622 (35.37%), Postives = 335/622 (53.86%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVP-----------------------------------------------RFD--NIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQI-----------KNVIVDMKIINSADYPSKKMLDLMEESEEPNLAP-------VYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA--VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            II D S  + Y +GK+LG+GGFAKCYE  D S+ +++A KII  + +     REK+ +EI +HR L +++IV+FYH+FED  N+YI+LE C  +SL  + K RK +TEPE RY+ +QI    +Y+H+Q+I+HRDLKL N F+N+ M +K+GDFGLA KLE    R++T+CGTPNY++PEVL K+GH  E D W+LGC++YT+L+G+PPFET  L++TY  I++  YS+P  L    + +I  +L      R  ++ +L  +F+ +GF P  L +S   T P                                               R D     I N+P        S P +  IG  G         P+ D + N + I D IR I              + D  +   AD  ++ +   +E   E N  P         WV KWVDYS++YG GYQLSD + GV+FN+ + + L ++ + + Y  + G   ++     P++   +VT+L+YF  YM ENLM  G+       S  RL Y+  W ++  A+++  ++GT Q+N + DHTK+I+C       +TYI+  +   T +L +L   G + ++  R++Y L M+
Sbjct:   43 IISDSSTGRCYCRGKVLGKGGFAKCYEFTDLSSGKVYAVKIIPHTRVSKPHQREKIDREIELHRTLHHKHIVQFYHHFEDKENIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQIVTGLKYLHEQEILHRDLKLGNFFINEGMELKIGDFGLAAKLEPVENRRRTICGTPNYLSPEVLNKQGHGCESDVWALGCVMYTMLLGRPPFETTNLKETYRCIREARYSMPSTLSPQAKHLISNMLAKSPEDRLRLDDVLRHDFFSQGFTPDRLSSSCCHTAPDLQHTSPAKSFFKKAAAALFGSKKDKAKYLETLNKLTVKEEEDIHRLRHDLRKASISNQPCRP-ATEDSKPPVPPIGKPGV--------PAKDGSSNKQQIRDTIRMIVRGTLGSCSSSSECLEDSTMGTVADSVARVLRGCLENMPEVNEIPKESLSCSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGTHMSLLSDKKTVHYYAELGQCMVFPTAEAPEQFVGQVTILKYFAHYMEENLMDGGDLPNVTDVSKPRL-YLLQWLKSDRALMMLFNDGTFQVNFYHDHTKIILCNQNEEYLLTYINEERVSTTLRLSTLLRCGCSADLRSRMEYALNML 654          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Cavefish
Match: plk2b (serine/threonine-protein kinase PLK2 [Source:NCBI gene;Acc:103027010])

HSP 1 Score: 287.345 bits (734), Expect = 1.105e-87
Identity = 138/283 (48.76%), Postives = 199/283 (70.32%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF 946
            II D +  + Y +GK+LG+GGFAKCYEL D S  +++A KII  S +     REK+ +EI +HR LS+++IV FYH FED  N+YI+LE C  +SL  + K RK +TEPE RY+ +Q   A +Y+H Q+I+HRDLKL N+F++  M +K+GDFGLA KLE    R+KT+CGTPNY++PEVL K+GH +E D W+LGC++YT+L+GKPPFET  LR+TY  I++  YS+P  +  S +++I ++L  +   RP +++++  EF  +GF+P  LP S   + P F
Sbjct:   45 IITDPATGKCYCRGKVLGKGGFAKCYELTDLSAGKVYAAKIIPHSRVAKPHQREKINREIELHRALSHKHIVHFYHSFEDKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLRQTVSALKYLHDQEILHRDLKLGNLFVSDSMELKVGDFGLAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDIWALGCVMYTMLLGKPPFETTNLRETYRCIREARYSLPSTISLSARQLIASMLSRNPTDRPRLDEIIRHEFLTQGFMPETLPASCCLSAPDF 327          

HSP 2 Score: 126.716 bits (317), Expect = 4.262e-30
Identity = 70/188 (37.23%), Postives = 110/188 (58.51%), Query Frame = 2
Query: 1226 WVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQN-LQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVG--AVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGS 1780
            WV KWVDYS++YG GYQLSD + GV+FN  + + L A+    LQ+ E      +YT T  P+    +VT+L+YF  YM ENLM  G +M  D ++     Y+  W ++  A+++  S+GT Q+N + DHTKLI+C       +TYI+  +   TFKL +L   G ++++  R++    ++ R  ++ S
Sbjct:  475 WVTKWVDYSNKYGFGYQLSDNTVGVLFNSGTHMSLLADKTTVLQHAEMGQCAVMYT-TDVPENCVGQVTILKYFAHYMEENLMDGG-DMVIDIDAEKPSIYLLQWLKSDRALMMLFSDGTFQVNFYHDHTKLILCTQQNDYLLTYINEERVSSTFKLSALLSAGCSSDLRNRMEALQILVRRCGATLS 660          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Cavefish
Match: plk3 (polo like kinase 3 [Source:NCBI gene;Acc:103024965])

HSP 1 Score: 276.944 bits (707), Expect = 1.006e-83
Identity = 136/285 (47.72%), Postives = 198/285 (69.47%), Query Frame = 2
Query:  101 EIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFD 949
            +++ D    + YTKGKLLG+GGFA+CYE+ D +++ ++A K+I +S +     REK+  EI +H+ L ++++VKF H+FED  N+YI LELC  KSL  + K R  +T+PE RY+ +QI    +Y+H + I+HRDLKL N F+N++M ++LGDFGLA KLE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTLL G PPFET  L++TY  IK+  YS+P +L  + Q++I A+L  +   R +++++L  E++ KGF P  LP S    VP   
Sbjct:   54 QVVVDPKSGRSYTKGKLLGKGGFARCYEMTDLASSRMYAVKVIPQSRVSKPHQREKITNEIELHKTLQHKHVVKFSHHFEDQDNIYIFLELCSRKSLAHIWKARHTLTDPEVRYYLRQIISGLKYLHNKGILHRDLKLGNFFVNENMELRLGDFGLAAKLETVEQRKKTICGTPNYLAPEVLNRQGHGTESDVWSLGCVMYTLLCGNPPFETLDLKETYKCIKEVRYSLPPSLSPAAQKLISAVLQKNPSDRLTLDQILVHEYFSKGFTPDKLPPSSCVMVPELS 338          

HSP 2 Score: 123.635 bits (309), Expect = 3.916e-29
Identity = 60/190 (31.58%), Postives = 109/190 (57.37%), Query Frame = 2
Query: 1217 PVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKA-WFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGA---VTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSS 1774
            P  WV+KWVDYS++YG GYQLS+ + GV+FN+ + + L    + + Y   N   F +   S P+ L+++  +++    YM +NLM  G+  F ++      P +   W +T+ A+V+  +NG+VQ+N + DHTK+I+     +   +TYI   +   ++ L  L   G ++E+  RL Y +++++  +S+
Sbjct:  478 PFLWVSKWVDYSNKYGFGYQLSNQNVGVLFNEGTHLSLCDQRRTVHYCLTNNKHFTFQADSLPEPLQRQKHIVELMAKYMEQNLMEGGDLGFEEQPPPSASPPLLLQWIKTEHALVMLFNNGSVQVNFYADHTKVILSKSADSSYLLTYISRERVSTSYPLHVLSESGCSSELRHRLHYVVQLLQHYASA 667          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 244.973 bits (624), Expect = 6.939e-73
Identity = 128/302 (42.38%), Postives = 185/302 (61.26%), Query Frame = 2
Query:   98 PEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEI-FAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTI 997
            P +I D SR+  Y++G+LLG+GGFA+CY + +      FA KII K  ++  G R K++QEI++HR L + +IV+F   F+D   +YI+LELC  +SL  + + RK +TE E +Y+ +Q+     Y+HQ  ++HRDLKL N F+   M VK+GD GLAT LE    RK+T+CGTPNY+APEVL K GH  E D WSLGC ++T+L G+PPF T  L +TY  I+   ++ P +L  + ++++ + L  D   R S+  L    F  +GF+P  LPTS   + P F       + L     TI
Sbjct:   15 PRVIRDASRDILYSRGRLLGKGGFARCYLVTEEYTGCHFAAKIITKQRVEKPGHRAKIEQEISLHRKLHHRHIVQFISSFKDENFIYIILELCNGQSLAHMLRSRKVLTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPEMRKRTVCGTPNYLAPEVLNKRGHGPEADIWSLGCAVFTMLAGRPPFSTSDLANTYACIRSGRFNFPPSLSHAARDLLTSALTPDPDLRASLLDLQSHPFLTQGFVPDRLPTSSHLSPPIFRTPSSAGRLLRKAAATI 316          

HSP 2 Score: 100.138 bits (248), Expect = 2.686e-22
Identity = 48/134 (35.82%), Postives = 79/134 (58.96%), Query Frame = 2
Query: 1226 WVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMI-RLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIV 1624
            WV KWVD+S+R G GY+LSDGS GV+ N+ S   L ++   +Q+  + GT   + +TS P  + + V  L+YF  +M ++L+   + +    E       ++  W +T  A+++  SN TVQ+N + DHTK++V
Sbjct:  430 WVTKWVDHSNRLGFGYKLSDGSVGVLSNEGSHFRLLSDATTVQHQAEVGTATTFDLTSPPRHMTRVVATLRYFTQFMDQHLLEGVDAVSQRVERRSDEAIFLVQWVKTDRAVLMLFSNNTVQVNFYRDHTKVVV 563          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002824.1 (pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215:-1 gene:ENSPMAG00000002574.1 transcript:ENSPMAT00000002824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 7.943e-47
Identity = 90/249 (36.14%), Postives = 143/249 (57.43%), Query Frame = 2
Query:  149 LLGRGGFAKCYELRDSNNEI-FAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKK--ITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEF 886
            LLG+G FA  Y  R  +  I  A K+I K  ++ +G  ++++ E+ IH  L +  I++ Y  FED+  VY++LE+C    +    K + +    E E R F ++I+    Y+H   +IHRDL LAN+ L  DM  ++ DFGLA +L   GE + T+CGTPNY++PEV  +  H    D+W+LGC  Y +L+G+PPF+   +  T  ++    + +P  L  + ++++R LL  D  KRP +  +LE  F
Sbjct:   18 LLGKGSFACVYRARSCHTGIEVAIKMIDKQAMRRAGMVDRVRAEVEIHSQLKHPAILEMYGCFEDDNYVYLVLEMCHNGEMSRYLKNQGRPFTEEQEARQFLREISSGLLYLHAHGVIHRDLTLANLLLASDMSTRIADFGLAARLPLPGESRLTVCGTPNYMSPEVASRGPHGTPADAWALGCAAYAMLVGRPPFQASAVPATLARVLAR-FELPPTLSPAARDLLRRLLRRDPGKRPGLPAVLEHPF 265          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010749.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010749.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.77 bits (408), Expect = 2.199e-42
Identity = 80/220 (36.36%), Postives = 127/220 (57.73%), Query Frame = 2
Query:  230 KSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRR-KKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEF 886
            +  +K +G     + E+ IH  L + ++++ Y  FED   VY++LE+C    +    K +    +E + R+F KQ      Y+H   I+HRDL L+N+ L  DM +K+ DFGLA +L    E+  TMCGTPNYI+PE+  +  H  E D WSLGC++YT+L+G+PPF+T+ +  T  ++   EYS P +L    + +I  LL  + + R  +  +L+  F
Sbjct:    1 QKAMKKAGMLNTFRNEVEIHCQLKHPSVLELYTCFEDQNYVYLVLEMCNNGEVGRYLKAKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLLTADMNIKIADFGLAAQLRLPEEKHFTMCGTPNYISPEIATRGAHGLESDVWSLGCMLYTMLVGRPPFDTDAIGTTLNRVVLGEYSEPMHLSKPARSLIHQLLQKNPVDRLGLACVLDHPF 220          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010747.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.77 bits (408), Expect = 2.241e-42
Identity = 80/220 (36.36%), Postives = 127/220 (57.73%), Query Frame = 2
Query:  230 KSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRR-KKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEF 886
            +  +K +G     + E+ IH  L + ++++ Y  FED   VY++LE+C    +    K +    +E + R+F KQ      Y+H   I+HRDL L+N+ L  DM +K+ DFGLA +L    E+  TMCGTPNYI+PE+  +  H  E D WSLGC++YT+L+G+PPF+T+ +  T  ++   EYS P +L    + +I  LL  + + R  +  +L+  F
Sbjct:    1 QKAMKKAGMLNTFRNEVEIHCQLKHPSVLELYTCFEDQNYVYLVLEMCNNGEVGRYLKAKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLLTADMNIKIADFGLAAQLRLPEEKHFTMCGTPNYISPEIATRGAHGLESDVWSLGCMLYTMLVGRPPFDTDAIGTTLNRVVLGEYSEPMHLSKPARSLIHQLLQKNPVDRLGLACVLDHPF 220          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 150.599 bits (379), Expect = 2.810e-41
Identity = 86/252 (34.13%), Postives = 141/252 (55.95%), Query Frame = 2
Query:  143 GKLLGRGGFAKCYELRDSNNE-IFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKG 895
            G+ LG+G F   Y  R+ + + I A K++ KS ++ SG   +L++EI I  +L + NI++ Y YF D   VY++LE      L +L ++  K  E  +  +   +A A  Y H +K+IHRD+K  N+ L     +K+ DFG +  +     R+ T+CGT +Y+ PE++    H  +VD WSLG + Y  L+G+PPFE+ET  +TY +I K +   P +L D  +++I  LL  +   R  +  +L+  + K 
Sbjct:   18 GRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRHPNILRLYGYFHDRTRVYLILEYAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKGELKIADFGWS--VHAPSSRRATLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLVGRPPFESETHNETYRRISKVDLRFPSHLSDGAKDLIANLLKHNPHTRLQLASVLQHPWVKA 267          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 275.789 bits (704), Expect = 9.307e-84
Identity = 138/296 (46.62%), Postives = 207/296 (69.93%), Query Frame = 2
Query:   80 SKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVL--RKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFN--LCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNI 955
            S +  TP  +  ++R + Y +G  LG GGFA+C++++D + EIFA K + K+ IK+  +R+KL  EI IH+++S+ NIV+F   FED+ NVYI+LE+C   SL+EL KRRK +TEPE R+F+ QI  A +Y+H +++IHRDLKL NIF + +  +K+GDFGLA  L  + ERK T+CGTPNYIAPEVL  +  GHSFEVD WSLG ++Y LLIGKPPF+   +   Y +IK  ++S P +  + D  + +IR +L  D ++RPS+ ++++  +++G  P  +P++VM+  P F++I
Sbjct:   65 SALCKTPPSLI-KTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDI 359          

HSP 2 Score: 78.5666 bits (192), Expect = 1.260e-15
Identity = 50/171 (29.24%), Postives = 86/171 (50.29%), Query Frame = 2
Query: 1187 MEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFL----YTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKL 1687
            + +S  P +     V KWVDYS+++G  YQLS    GV+FN+ + ++  A+ +   YI  +  E      Y ++  P +L + + ++ +F  YM  NL     + F  +E      +++ + R K  ++  LS+GT Q N F DH K+ +      VTYI  + +  T+ L
Sbjct:  500 LPKSRLPKIKHPMIVTKWVDYSNKHGFSYQLSTEDIGVLFNNGTTVLRLADAEEFWYISYDDREGWVASHYLLSEKPRELSRHLEVVDFFAKYMKANLSRV--STFGREEYHKDDVFLRRYTRYKPFVMFELSDGTFQFN-FKDHHKMAISDGGKLVTYISPSHESTTYPL 667          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 139.813 bits (351), Expect = 2.388e-35
Identity = 92/295 (31.19%), Postives = 157/295 (53.22%), Query Frame = 2
Query:   74 TNSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKC-YELRDSNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSF-EVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDN 952
            +NS ++N    + D +    Y   K LG G F K       +  +  A KII K  +  S  + ++++EI+  R L + +I+K Y   +    + IM+       L +   +R K++E E R F +QI  A EY H+ KI+HRDLK  N+ L++ + VK+ DFGL+  +  DG   KT CG+PNY APEV+  + ++  EVD WS G I+Y +L  + PF+ E++   +  I    Y++P  L      +I+ +L  + + R S++++++ +++K  +P  L    +   P  +N
Sbjct:   35 SNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEI-IMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMT-DGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLKPHPEEEN 327          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 125.946 bits (315), Expect = 1.560e-31
Identity = 87/261 (33.33%), Postives = 137/261 (52.49%), Query Frame = 2
Query:  128 QRYTKGKLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIK-NSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANI-FLNK--DMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFN------LCDSTQEIIRALLDSDAMKRPSMNKLLE 877
            ++Y  GK LG G F    + +++   E  A KI++K  +K N    E L  E+ I + L + NIV F  +FE     YI+ +L K   L +   ++ K TE +      +I  A +Y+H Q I+HRDLK  N+ +++K  +  + + DFG+A +L+ D E      G+  Y+APEVL ++GH    D WS+G I YTLL G   F  E ++D   +    EY + F+      + +  ++ I   L+ D  KRP+  +LLE
Sbjct:   35 KKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLE 295          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 122.094 bits (305), Expect = 1.032e-30
Identity = 69/216 (31.94%), Postives = 119/216 (55.09%), Query Frame = 2
Query:  206 IFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKR 853
            I A K++ K  I     +++ ++E+ I  +L++ N+ K Y YF D   VY+++E      + +L +      +     +  QIA A +Y+H++ IIHRD+K  NI +  + ++KL DFG +  +     R+KT+CGT +Y++PE++    +   +D+W+LG + + LL G PPFE E    TY +I   +  +P N+    Q++I  LL  D   R
Sbjct:  129 ICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSI-INPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDR 343          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 121.324 bits (303), Expect = 2.602e-30
Identity = 71/237 (29.96%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  146 KLLGRGGFAKCYELRDSNN-EIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKR 853
            + LG G F + + +R ++N   +A K + K  I      E    E  +   +S+  I++ +  F+D+  V+++++  +   L  L ++ ++   P  ++++ ++  A EY+H + II+RDLK  NI L+K+  +K+ DFG A   +Y  +   T+CGTP+YIAPEV+  + ++  VD WS G +IY +L G  PF       TY  I   E   P       Q++++ L+  D  +R
Sbjct:   92 RTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFA---KYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSER 325          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Nematostella
Match: EDO37827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEP8])

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 288/582 (49.48%), Postives = 381/582 (65.46%), Query Frame = 2
Query:  101 EIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYK---GFIPSGLPTSVMTTVPRFDNIQIKN-------KPLSSIGNTISVPIIS-------------GIGVTGTGHSEILPGPSGDENY----------NNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYT 1744
            +II D  R +RY +GK LG+GGFAKCYEL D   N+I+AGKII KS +     +EK+  EI IH  + +++IV F+ YFED   +YI+LELC  +SL+ELHKRR+ +TEPE RYF KQI  AC Y+H+ +IIHRDLKL N+FLN DM VK+GDFGLAT+ E +GERKKT+CGTPNYIAPEVL K GHSFEVD WS+GCI+YTLL+GKPPFET++L+ TY +IK+NEY IP  +  + Q +I  LL  D   RP+M ++L+ +F+K   G++P+ LP S +T  PRF      N        PLS + +  +   I+             GI VTG     I P  + D+             + Y+ DL +Q+ N++     +N AD   K      +++EEP   PVYWV+KWVDYSD+YGLGY LSD S GV+FND +R+IL  + +NLQYI KNG E  +T+  +PD L KKVTLL+YF+ YM E+L+ AG +     E    LP++++WFRT   I+L+LSNG +QIN F DHTK+I+CP +GAVTYID  K FRTF    +   G + E+  RL Y 
Sbjct:   12 QIIVDADRKKRYYRGKFLGKGGFAKCYELTDLDTNKIYAGKIISKSMLTKPHQKEKMAMEIEIHGKVMHKHIVGFHGYFEDRDYIYILLELCPRRSLMELHKRRRALTEPEVRYFMKQIIDACIYLHKSRIIHRDLKLGNLFLNDDMEVKVGDFGLATRAE-EGERKKTLCGTPNYIAPEVLSKRGHSFEVDVWSVGCILYTLLVGKPPFETQSLKTTYDRIKRNEYYIPSKVSHTAQLLIIKLLRPDPTTRPTMQQVLDDDFFKPSSGYMPTRLPVSCLTMPPRFATGSSSNLLQPGGRPPLSELNSQETTARITSKPSDVYSKRKSLGIRVTGAVSKLIQPEEAADDEVKEEAEEDETPKDYYLSDLKKQLTNLLA----LNPADMKYKNE----DDAEEPAATPVYWVSKWVDYSDKYGLGYTLSDNSVGVLFNDHTRLILCEDGENLQYILKNGQESFHTMKGFPDSLHKKVTLLKYFRNYMTEHLLKAGGSRGTKDEESAHLPFLRSWFRTSKGIILHLSNGILQINFFKDHTKIIMCPRMGAVTYIDENKRFRTFPFTQIEKHGCSQELSNRLLYA 584          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Nematostella
Match: EDO33652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL3])

HSP 1 Score: 375.555 bits (963), Expect = 4.261e-123
Identity = 207/565 (36.64%), Postives = 340/565 (60.18%), Query Frame = 2
Query:   86 MDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGI-KNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLV--GAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI 1765
            + + P++I D    +RY +G+LLG+GGFA+ YE+ D S N+I+A K++ K  + K++    K++ EI +HR L +  +V F+  F+D  N YI+LELC  KSL+++ K R K+TEPE R+F +Q  +AC Y+H+Q++IHRD+K+ N F+N +M ++LGDFGLA +L+ D  + +TMCGTPNYIAPEVL KEGHS+EVD+W+LGC++YT+L+G PPFET++LR+TY +I+ N+Y+IP  + DS   +I+ +L ++   RP ++ +   +F+ KGF+P+ LP + +   P++ + + ++   S   + +    ++          E     S D           +   K   V   +++  D  + +     EE  E       ++AKWVDYS++YG G QLSDG   V FND S+I L ++ +++ Y +++     ++ +  P  L  KVTLL YF  YM ++L+  G+           +P++  WFRT   +V+YLSNG +Q+N F DHTK+++ P        YI+  ++  +  L  L    ++ E+  RL Y  +++ ++
Sbjct:    2 LPDVPKVI-DNGNGRRYFRGRLLGKGGFARVYEVTDMSTNKIYALKVVPKKRLSKSTKEYRKIEMEIELHRTLRHHYVVGFHGSFQDEMNFYILLELCSRKSLVQMLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRDIKVGNFFINSNMELRLGDFGLAVRLKPDEYKIRTMCGTPNYIAPEVLSKEGHSYEVDTWALGCVMYTMLVGHPPFETKSLRETYRRIRNNDYTIPSRVSDSAARLIQRMLHANPENRPKLSDIFSDDFFAKGFLPNELPLTCLCGTPKWSDYEKRSTADSKKEHVLLSQALNRKLRINADEKEEQEQKSND-----------MCNTKLQGVAKPLLSRDDAKNHQNNKDREEFAE------VFIAKWVDYSNKYGFGAQLSDGCVTVRFNDCSKIALASDKRSICYRDEDQPLLRFSTSYVPSNLHSKVTLLTYFANYMDKHLLKGGDPADVIPSHPDSIPFIDIWFRTDITMVMYLSNGAMQVNFFKDHTKVVLIPGEDNALFIYINEHRESTSRLLSELNQDTVSWEVIGRLIYCKQVLRKV 548          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Nematostella
Match: EDO34707 (Serine/threonine-protein kinase PLK4 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN5])

HSP 1 Score: 189.504 bits (480), Expect = 5.985e-51
Identity = 97/248 (39.11%), Postives = 147/248 (59.27%), Query Frame = 2
Query:  149 LLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVY-IMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEF 886
            LLG+GGFA  Y  R  +  +  A K+I K  ++ +G   ++  E+ IH  L + +I++ Y YFED+  VY ++      ++   L K+   + E E R    Q+ K   Y+H   IIHRDL L NI L+ DM  K+ DFGLAT+L    E+  TMCGTPNYI+PE+  ++ H  E D WS+GC+++TLL+GKPPF+TE +R T  K+   EY IP ++    +++I  LL  +   R +++ +L+  F
Sbjct:   18 LLGKGGFACVYRGRCLATGQEVAIKMIDKKAMRTAGMVNRVCNEVEIHCRLKHPSILELYTYFEDDNYVYLVLELAENGEANRYLRKQGHTLKESEVRRIMLQVVKGVLYLHSHGIIHRDLSLGNILLSSDMDAKIADFGLATRLSLPDEKHYTMCGTPNYISPEIATRDPHGLESDVWSIGCMLFTLLVGKPPFDTEAVRSTLNKVVLAEYDIPNHVSIEARDLISKLLKKNPQDRLTLSGILDHPF 265          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 147.517 bits (371), Expect = 1.140e-39
Identity = 81/245 (33.06%), Postives = 136/245 (55.51%), Query Frame = 2
Query:  143 GKLLGRGGFAKCYELRDSNNE-IFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLL 874
            GK LG+G F   Y  R+  ++ I A K++ KS ++ S    +L++EI I  +L + NI++ + YF D+  VY++LE      L +     +K  E     + +Q+A A  Y H +K+IHRD+K  N+ LN    +K+ DFG +  +     R+ T+CGT +Y+ PE++  + H  +VD WS+G + Y  L+GKPPFE E   +TY +I + +   P ++    +++I  LL  +   R  +  +L
Sbjct:   51 GKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWS--VHAPSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVL 293          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Nematostella
Match: EDO28119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7D2])

HSP 1 Score: 138.658 bits (348), Expect = 5.863e-39
Identity = 57/115 (49.57%), Postives = 88/115 (76.52%), Query Frame = 2
Query:  605 MCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF 946
            MCGTPNYIAPEVL KEGHS+EVD+W+LGC++YT+L+G PPFET++LR+TY +I+ N+Y+IP  + DS   +I+ +L ++   RP ++ +   +F+ KGF+P+ LP + +   P++
Sbjct:    1 MCGTPNYIAPEVLSKEGHSYEVDTWALGCVMYTMLVGHPPFETKSLRETYRRIRNNDYTIPSRVSDSAARLIQRMLHANPENRPKLSDIFSDDFFAKGFLPNELPLTCLCGTPKW 115          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Medaka
Match: PLK1 (polo like kinase 1 [Source:NCBI gene;Acc:101170155])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 281/573 (49.04%), Postives = 397/573 (69.28%), Query Frame = 2
Query:   77 NSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQ------IKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNR-YIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI 1765
            ++ +   PE++ D    +RY+KG+ LG+GGFAKC+E+ D    ++FAGKI+ KS I     REK+  EI+IH++L++ NIV F+ +FED+  VY++LE+C+ +SLLELHKRRK +TEPE RY+  Q+ K   Y+H  K+IHRDLKL NIFLN DM VK+GDFGLATK+E+DGERKKT+CGTPNYIAPEVL K+GHS+EVD WSLGCI+YTLL+GKPPFET  L+DTY +IKKN Y+IP+ +  S   +I+ +L +D  +RP++  L   EF+  G++P  LPT+ +T  PRF           + +PL++I N             GT   ++   P+  E      Y+ D+++Q+ ++I        +  PS+K +   EE+E+P   P++W++KWVDYSD+YGLGYQL D S GV+FND +R+I+ A+  +LQYI+K   E   ++ S+P  L KK+TLL+YF+ YM E+L+ AG N+   + + + RLPY+  WFRTKSAI+L+LSNGTVQIN F DHTKLI+CPL+ AVTYI+  +DFRT+KL  L   G + E+  R++Y   M+E++
Sbjct:   19 SAPLKEIPEVLVDPRTLRRYSKGRFLGKGGFAKCFEITDMETKQVFAGKIVPKSLILKQHQREKMSSEISIHKSLNHANIVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYYMTQLLKGVHYLHSNKVIHRDLKLGNIFLNDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSYEVDVWSLGCILYTLLVGKPPFETSCLKDTYNRIKKNNYTIPWQINPSASALIKRMLHADPAQRPTITDLQTDEFFTSGYVPLRLPTTCLTVPPRFSIAPSMAAELSQRRPLTAINNK-----------AGTEKVDMKDEPAPLEAEPEECYLKDMLQQLNSII--------SAKPSEKAVIRQEEAEDPACIPIFWISKWVDYSDKYGLGYQLCDNSVGVLFNDFTRLIMYADGDSLQYIDKKAAESYLSVRSFPASLNKKITLLKYFRNYMSEHLLKAGANIARREGDELARLPYLCLWFRTKSAIILHLSNGTVQINFFQDHTKLILCPLMAAVTYINEKRDFRTYKLSLLEEFGCSKELASRMRYAKLMVEKL 572          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Medaka
Match: PLK1 (polo like kinase 1 [Source:NCBI gene;Acc:101170155])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 280/572 (48.95%), Postives = 396/572 (69.23%), Query Frame = 2
Query:   77 NSKMDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQ------IKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMF-NDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERI 1765
            ++ +   PE++ D    +RY+KG+ LG+GGFAKC+E+ D    ++FAGKI+ KS I     REK+  EI+IH++L++ NIV F+ +FED+  VY++LE+C+ +SLLELHKRRK +TEPE RY+  Q+ K   Y+H  K+IHRDLKL NIFLN DM VK+GDFGLATK+E+DGERKKT+CGTPNYIAPEVL K+GHS+EVD WSLGCI+YTLL+GKPPFET  L+DTY +IKKN Y+IP+ +  S   +I+ +L +D  +RP++  L   EF+  G++P  LPT+ +T  PRF           + +PL++I N  + P           +   L     +E     Y+ D+++Q+ ++I        +  PS+K +   EE+E+P   P++W++KWVDYSD+YGLGYQL D S GV+FND +R+I+ A+  +LQYI+K   E   ++ S+P  L KK+TLL+YF+ YM E+L+ AG N+   + + + RLPY+  WFRTKSAI+L+LSNGTVQIN F DHTKLI+CPL+ AVTYI+  +DFRT+KL  L   G + E+  R++Y   M+E++
Sbjct:   19 SAPLKEIPEVLVDPRTLRRYSKGRFLGKGGFAKCFEITDMETKQVFAGKIVPKSLILKQHQREKMSSEISIHKSLNHANIVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYYMTQLLKGVHYLHSNKVIHRDLKLGNIFLNDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSYEVDVWSLGCILYTLLVGKPPFETSCLKDTYNRIKKNNYTIPWQINPSASALIKRMLHADPAQRPTITDLQTDEFFTSGYVPLRLPTTCLTVPPRFSIAPSMAAELSQRRPLTAINNKGNKP----------NNCPKLVEAEPEEC----YLKDMLQQLNSII--------SAKPSEKAVIRQEEAEDPACIPIFWISKWVDYSDKYGLGYQLCDNSVGVLFNDFTRLIMYADGDSLQYIDKKAAESYLSVRSFPASLNKKITLLKYFRNYMSEHLLKAGANIARREGDELARLPYLCLWFRTKSAIILHLSNGTVQINFFQDHTKLILCPLMAAVTYINEKRDFRTYKLSLLEEFGCSKELASRMRYAKLMVEKL 568          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 391.734 bits (1005), Expect = 4.467e-128
Identity = 217/583 (37.22%), Postives = 340/583 (58.32%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDL---------------IRQIKNVIVDMKIINS------ADYPSKKMLDLMEESEEPNLAP-------VYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVG--AVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            II D +  + Y +GK+LG+GGFAKCYE+ D S ++++A KII  + +     REK+ +EI +HR L++ ++V FYH+FED  N+YI+LE C  KSL  + K RK +TEPE RY+ +QI    +Y+H+Q+I+HRDLKL N F+++ M +K+GDFGLA KLE  G R+KT+CGTPNY++PEVL K+GH  E D W+LGC++YT+L+G+PPFET  L++TY  I++  YS+P +L    +++I +LL      RP+++ +L  +F+ +GF P  LP S   + P F      + P  S     +  +  G       + E L   + +E    +   DL               +R++ ++ + +  +        AD  +  +   +E     N  P       + WV KWVDYS++YG GYQLSD + GV+FN+ + + L  + + + Y  + G   ++     P+    +VT+L+YF  YM ENLM  G+        M RL Y+  W ++  A+++  ++GT Q+N + DHTK+I+C       +TYI+  +  +T+KL SL   G   ++HQRL Y+L M+
Sbjct:   41 IITDPATGKCYCRGKVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVGNRRKTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYKCIREARYSLPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFFTQGFSPERLPVSCCHSAPDFH----ISSPAKSFFKKAAAALFGG-KRDKVRYYETLNKLTKEEEEIYKLQHDLEKTVIGQQQSKNLSQVRKLFSICISVSCLEDNTTGSVADTVATVLRGCLENMPTTNDIPLTSSSCSLQWVTKWVDYSNKYGFGYQLSDNTVGVLFNNGTHMSLLPDRKTIHYYAELGQCSVFPTCEVPEHFVGQVTVLKYFSLYMEENLMDGGDLGTVTDTHMPRL-YLLQWLKSDRALMMLFNDGTFQVNFYHDHTKIILCCQRDEYVLTYINEERVSKTYKLSSLLTSGCPTDLHQRLLYSLNML 617          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Medaka
Match: plk3 (polo like kinase 3 [Source:NCBI gene;Acc:101155385])

HSP 1 Score: 390.193 bits (1001), Expect = 4.729e-127
Identity = 220/610 (36.07%), Postives = 342/610 (56.07%), Query Frame = 2
Query:  101 EIIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTI---------SVP-----------IISG---------IGVTGTGHSEIL-------------PGPSGDENYNN------RYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEE--PNLA---PVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVG---AVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIE 1759
            +++ D    + Y+KGKLLG+GGFA+CYE+ D S+N+++A K+I +S +     REK+  EI +HR L+++++VKF HYFED  N+YI LELC  KSL  + K R  +TEPE RY+ +QI    +Y+H + I+HRDLKL N F+N++M ++LGDFGLA KLE   +RKKT+CGTPNY+APEVL ++GH  E D WSLGC++YTL+ G PPFET  L++TY  IK+  Y++P +L  + Q++I  +L  +   R +++++L  EF+KGF P  LP S    VP         K  S +  ++          +P           ++SG         I     G SE+              P P+ +E+  +        +       ++V+    +  +A    K  L  M  +    P L+      WV KWVDYS++YG GYQLS+ + GV+FN+ + + L    Q + Y   N   F +   S P++L+ +  +++    YM +NLM  G+    ++ S +  P +  W +T  A+V+  +NGT+Q+N + DHTK+IVC        +TYI   +   T+ L  L+  G T+E+  RL Y +++++
Sbjct:   53 QVVTDSRTGRSYSKGKLLGKGGFARCYEMTDLSSNKMYAVKVIPQSRVSKPHQREKITNEIELHRTLAHKHVVKFSHYFEDQENIYIFLELCSRKSLAHIWKARHTLTEPEVRYYLRQIISGLKYLHNRGILHRDLKLGNFFINENMDLRLGDFGLAAKLETVEQRKKTICGTPNYLAPEVLNRQGHGTESDVWSLGCVMYTLMCGSPPFETLDLKETYKCIKEVRYNLPSSLSPAAQKLISGILQKNPSDRLTLDQILNHEFFKGFTPDKLPPSSCVMVPELHPPSPAKKFFSKMAKSLFGKKKSKVEKIPCEEKEDRDISKLVSGIVKCSINRQISYKTVGPSEVTSPTGQLVSSVPLEPTPAEEESRKSISRSFKGTMASGTEPCEDVLTPAAVAETAMKVLKDCLTAMPAANRNPPCLSRPQSFLWVTKWVDYSNKYGFGYQLSNQNIGVLFNEGTHLSLCDQRQTVHYCLTNNKHFTFAANSLPEQLRSQKQIVELMANYMEQNLMEGGDLHCEEQASALP-PLLLQWVKTDHALVMLFNNGTLQVNFYTDHTKIIVCKSSDDSYLLTYISRERVSYTYLLSMLKEMGCTSELRHRLGYVVQLLQ 661          
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Medaka
Match: plk2b (polo like kinase 2 [Source:NCBI gene;Acc:101166557])

HSP 1 Score: 283.108 bits (723), Expect = 3.953e-86
Identity = 135/283 (47.70%), Postives = 200/283 (70.67%), Query Frame = 2
Query:  104 IIFDQSRNQRYTKGKLLGRGGFAKCYELRD-SNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFY-KGFIPSGLPTSVMTTVPRF 946
            II D +  + Y +GK+LG+GGFAKCYE+ D S ++++A KII  + +     REK+ +EI +HR L++ ++V FYH+FED  N+YI+LE C  KSL  + K RK +TEPE RY+ +QI    +Y+H+Q+I+HRDLKL N F+++ M +K+GDFGLA KLE  G R+KT+CGTPNY++PEVL K+GH  E D W+LGC++YT+L+G+PPFET  L++TY  I++  YS+P +L    +++I +LL      RP+++ +L  +F+ +GF P  LP S   + P F
Sbjct:   41 IITDPATGKCYCRGKVLGKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALNHRHVVHFYHHFEDKENIYILLEYCSRKSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFVSESMELKVGDFGLAAKLEPVGNRRKTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYKCIREARYSLPSSLSPQAKQLISSLLAKIPEDRPNLDHILRHDFFTQGFSPERLPVSCCHSAPDF 323          

HSP 2 Score: 134.806 bits (338), Expect = 9.549e-33
Identity = 68/179 (37.99%), Postives = 107/179 (59.78%), Query Frame = 2
Query: 1226 WVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVG--AVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMI 1756
            WV KWVDYS++YG GYQLSD + GV+FN+ + + L  + + + Y  + G   ++     P+    +VT+L+YF  YM ENLM  G+        M RL Y+  W ++  A+++  ++GT Q+N + DHTK+I+C       +TYI+  +  +T+KL SL   G   ++HQRL Y+L M+
Sbjct:  472 WVTKWVDYSNKYGFGYQLSDNTVGVLFNNGTHMSLLPDRKTIHYYAELGQCSVFPTCEVPEHFVGQVTVLKYFSLYMEENLMDGGDLGTVTDTHMPRL-YLLQWLKSDRALMMLFNDGTFQVNFYHDHTKIILCCQRDEYVLTYINEERVSKTYKLSSLLTSGCPTDLHQRLLYSLNML 649          
BLAST of Serine/threonine-protein kinase PLK vs. Planmine SMEST
Match: SMESG000022441.1 (SMESG000022441.1)

HSP 1 Score: 1161.36 bits (3003), Expect = 0.000e+0
Identity = 574/574 (100.00%), Postives = 574/574 (100.00%), Query Frame = 2
Query:   86 MDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVAE 1807
            MDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMLELCKCKSLLELHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVAE
Sbjct:    1 MDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMLELCKCKSLLELHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISSSGSMAGRVEVAE 574          
BLAST of Serine/threonine-protein kinase PLK vs. Planmine SMEST
Match: SMESG000007751.1 (SMESG000007751.1)

HSP 1 Score: 494.582 bits (1272), Expect = 1.876e-169
Identity = 256/558 (45.88%), Postives = 367/558 (65.77%), Query Frame = 2
Query:  101 EIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMTAGENM-FNDKESMIRLPYVKAWFRTKSAIVLYLSNGTVQINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRLQYTLRMIERISS 1771
            E + D S++  YT G  LG+G FAKCY L D +  IFA K+I+K  +K+  +++K+Q+EI IH+NL+++ IV F  YF+D+ N++I+LE C C+SL EL KRRK +  PETRYF+KQI +ACEY+H   +IHRDLKLANIFLN +++VK+GDFG +T L+ + E+KKT+CGTPNY+APEV+ K+GHSFEVD WSLG IIYTL+IGKPPFET  + DTY +I    Y IP  L +  +EII ++L  D   RP+M  LLEM F+KGF P+ LP S+++  PRF                     +S   +   G  +I+  P   E Y N  +  L +Q+K+ + ++KII+   +P      LM+ESE P LAP++WV+KWVD +  YGL Y L+D S G +FND +R++L  N  N QYI  +  E  YT+  +P+K+KKKV L++  + YM  +LMTAG ++  ++++SMIRLP ++ +F   SAI   LSN T+Q+N   DH KL++CP +G+V  ID   + +T+KL SL   G+T ++  +  + + +IE   S
Sbjct:    8 EKLVDNSKDITYTVGSYLGKGAFAKCYALIDPDANIFATKVIVKKDVKSLINKDKIQKEIQIHKNLNHKYIVNFISYFQDDKNIFIVLEYCSCQSLAELSKRRKTLLIPETRYFTKQIVEACEYLHDNLVIHRDLKLANIFLNSELVVKVGDFGFSTILDTEAEKKKTLCGTPNYLAPEVILKDGHSFEVDVWSLGVIIYTLIIGKPPFETSNINDTYRRITSISYVIPEYLDEDVKEIILSVLKRDVNSRPTMKMLLEMSFFKGFTPTCLPISILSCPPRFK--------------------LSKTELLQDG--QIVDSPQLLEEYTNLKL--LQQQLKDTLTNVKIISYISHPY-----LMKESENPKLAPIFWVSKWVDITSEYGLFYMLNDNSTGSIFNDDTRLVLAPNDFNFQYIGCSNQECFYTVDDFPEKIKKKVKLIRNAKNYMNNHLMTAGGDLVVSEQDSMIRLPNLRQFFMEPSAICFMLSNDTLQVNFQEDHVKLVLCPFMGSVMIIDENSEIKTYKLSSLHDNGITEDLLSKFHFVVSIIETTVS 536          
BLAST of Serine/threonine-protein kinase PLK vs. Planmine SMEST
Match: SMESG000017012.1 (SMESG000017012.1)

HSP 1 Score: 251.906 bits (642), Expect = 7.188e-78
Identity = 132/344 (38.37%), Postives = 209/344 (60.76%), Query Frame = 2
Query:  446 KQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEILPGPSG-DENYNNRYIVDLIRQIKNVIVDMKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSDGSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLLQYFQTYMIENLMT 1474
            K I   C+Y+H    IHRDLKL N+  +K+M VK+ DFGL+ K++ D +   ++CGT  Y+APE+L K  ++  VD WS+GCIIY LL G  PF      + +       Y++P +L  ST+EII  LL+    KR S +  LE++++  FIP  LPTSV++  PRFD +  K+K       +I+  +   I    +  S +L      DE Y N ++  L  Q+ +++    ++ S +    K+LDLM +S++P+L P+YW++KWVD+++ +GLGY+L+D S GV F + + +++T N QN+Q+I+   TE+L+T  + P+KL K+  +L+Y + YM  NL T
Sbjct:    2 KHILTGCQYLHSNGYIHRDLKLDNLLFDKEMKVKIADFGLSAKVKED-KLNSSVCGTVVYMAPEMLAKSHYNCSVDMWSVGCIIYNLLFGTHPFPNNG--NEFFTCYSFSYTLPKDLTPSTKEIIHLLLEKIPSKRISASDALELDYFTEFIPDSLPTSVLSMPPRFDGLVNKDK-------SIAEDLTKTIYYNPSPFSHLLNSVEDVDEIYRNEHLKALADQLHSLLESSPVLESTETEKSKLLDLMSDSKDPSLEPIYWISKWVDFANAFGLGYKLTDASTGVFFTNKTCMVMTENQQNIQFIDDEKTEYLFTNENLPEKLFKRREILKYVENYMQINLAT 335          
BLAST of Serine/threonine-protein kinase PLK vs. Planmine SMEST
Match: SMESG000076532.1 (SMESG000076532.1)

HSP 1 Score: 189.504 bits (480), Expect = 5.745e-51
Identity = 107/303 (35.31%), Postives = 171/303 (56.44%), Query Frame = 2
Query:  146 KLLGRGGFAKCYELRDS-NNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEI 1051
            ++LGRGGFA+ Y  +    ++  A KII K  + + G   ++++E+ +H  L + +I++ Y +FED   VY++LE+C    L    +    ++E + R + KQI    +Y+H   I+HRDL LAN+ L KDM +K+ DFGLAT+LE  G    TMCGTPNYI+PEV+ +     E D WS+GC++YT+L+GK PF+T+ +R T  +++   + +P N+ +S++++I  LL ++  KR ++ +L    F +    S L          F +  I +               SGIG    GHS I
Sbjct:   18 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEA-GVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDL----------FQDFSITD---------------SGIGSMNKGHSSI 294          
BLAST of Serine/threonine-protein kinase PLK vs. Planmine SMEST
Match: SMESG000076532.1 (SMESG000076532.1)

HSP 1 Score: 189.504 bits (480), Expect = 6.276e-51
Identity = 107/303 (35.31%), Postives = 171/303 (56.44%), Query Frame = 2
Query:  146 KLLGRGGFAKCYELRDS-NNEIFAGKIILKSGIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMXXXXXXXXXXXXHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKDMIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSLGCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLDSDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSIGNTISVPIISGIGVTGTGHSEI 1051
            ++LGRGGFA+ Y  +    ++  A KII K  + + G   ++++E+ +H  L + +I++ Y +FED   VY++LE+C    L    +    ++E + R + KQI    +Y+H   I+HRDL LAN+ L KDM +K+ DFGLAT+LE  G    TMCGTPNYI+PEV+ +     E D WS+GC++YT+L+GK PF+T+ +R T  +++   + +P N+ +S++++I  LL ++  KR ++ +L    F +    S L          F +  I +               SGIG    GHS I
Sbjct:   17 EILGRGGFARVYRAKSQKTDQEVAIKIIDKKMMHHHGMTARVRKEVELHSRLKHPSILELYTFFEDANYVYLVLEMCHNGELHRRIRENGPLSEDQARKYLKQIVDGLKYLHSYDILHRDLTLANLLLTKDMKIKIADFGLATQLEA-GVEHFTMCGTPNYISPEVVSRSKQGLEADVWSVGCMLYTMLVGKAPFDTKEIRGTLNRVQSGRFHLPSNISESSRDLIAGLLQTNPDKRLNLQQLSNHSFMQVNKVSDL----------FQDFSITD---------------SGIGSMNKGHSSI 293          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLK10.000e+049.57polo like kinase 1 [Source:HGNC Symbol;Acc:HGNC:90... [more]
PLK24.602e-12635.67polo like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19... [more]
PLK25.554e-12635.67polo like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19... [more]
PLK31.119e-12136.03polo like kinase 3 [Source:HGNC Symbol;Acc:HGNC:21... [more]
PLK45.210e-5139.60polo like kinase 4 [Source:HGNC Symbol;Acc:HGNC:11... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk-24.550e-17146.15Serine/threonine-protein kinase plk-2 [Source:Uni... [more]
plk-17.951e-16744.92Serine/threonine-protein kinase plk-1 [Source:Uni... [more]
plk-16.300e-16444.85Serine/threonine-protein kinase plk-1 [Source:Uni... [more]
plk-31.975e-11637.02Serine/threonine-protein kinase plk-3 [Source:Uni... [more]
plk-31.975e-11637.02Serine/threonine-protein kinase plk-3 [Source:Uni... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polo3.115e-16644.85gene:FBgn0003124 transcript:FBtr0074839[more]
polo3.115e-16644.85gene:FBgn0003124 transcript:FBtr0100318[more]
SAK7.129e-5036.76gene:FBgn0026371 transcript:FBtr0078387[more]
CaMKI1.097e-3433.81gene:FBgn0016126 transcript:FBtr0333670[more]
par-11.428e-3434.55gene:FBgn0260934 transcript:FBtr0086450[more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk10.000e+049.39polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:Z... [more]
plk10.000e+049.39polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:Z... [more]
plk2b2.740e-8648.06polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:... [more]
plk2b2.740e-8648.06polo-like kinase 2b (Drosophila) [Source:ZFIN;Acc:... [more]
plk37.523e-8547.72polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk10.000e+048.38polo like kinase 1 [Source:NCBI gene;Acc:407937][more]
plk10.000e+048.38polo like kinase 1 [Source:NCBI gene;Acc:407937][more]
plk10.000e+047.52polo like kinase 1 [Source:NCBI gene;Acc:407937][more]
plk31.015e-13139.22polo-like kinase 3 [Source:NCBI gene;Acc:448451][more]
plk36.747e-13139.51polo-like kinase 3 [Source:NCBI gene;Acc:448451][more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plk10.000e+048.88polo like kinase 1 [Source:MGI Symbol;Acc:MGI:9762... [more]
Plk21.640e-12635.20polo like kinase 2 [Source:MGI Symbol;Acc:MGI:1099... [more]
Plk31.318e-12436.64polo like kinase 3 [Source:MGI Symbol;Acc:MGI:1096... [more]
Plk31.410e-12336.90polo like kinase 3 [Source:MGI Symbol;Acc:MGI:1096... [more]
Plk51.404e-9534.32polo like kinase 5 [Source:MGI Symbol;Acc:MGI:3026... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62673|PLK1_RAT0.000e+048.70Serine/threonine-protein kinase PLK1 OS=Rattus nor... [more]
sp|Q07832|PLK1_MOUSE0.000e+048.88Serine/threonine-protein kinase PLK1 OS=Mus muscul... [more]
sp|P53350|PLK1_HUMAN0.000e+049.57Serine/threonine-protein kinase PLK1 OS=Homo sapie... [more]
sp|Q2TA25|PLK1_BOVIN0.000e+048.87Serine/threonine-protein kinase PLK1 OS=Bos taurus... [more]
sp|P70032|PLK1_XENLA0.000e+048.72Serine/threonine-protein kinase PLK1 OS=Xenopus la... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PIK50.000e+051.27Serine/threonine-protein kinase PLK OS=Pomacea can... [more]
A0A5J4NYI60.000e+052.72Serine/threonine-protein kinase PLK OS=Paragonimus... [more]
A0A4S2LUX00.000e+051.30Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7DNG40.000e+051.13Serine/threonine-protein kinase PLK1 OS=Clonorchis... [more]
A0A1S3J0I10.000e+052.17Serine/threonine-protein kinase PLK OS=Lingula ung... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk10.000e+048.31polo like kinase 1 [Source:NCBI gene;Acc:103034005... [more]
plk10.000e+047.46polo like kinase 1 [Source:NCBI gene;Acc:103034005... [more]
plk2a6.557e-12135.37serine/threonine-protein kinase PLK2 [Source:NCBI ... [more]
plk2b1.105e-8748.76serine/threonine-protein kinase PLK2 [Source:NCBI ... [more]
plk31.006e-8347.72polo like kinase 3 [Source:NCBI gene;Acc:103024965... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk36.939e-7342.38polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000002824.17.943e-4736.14pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215... [more]
ENSPMAT00000010749.12.199e-4236.36pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
ENSPMAT00000010747.12.241e-4236.36pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
aurka2.810e-4134.13aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC59.307e-8446.62Polo-like kinase; controls targeting and activatio... [more]
SNF12.388e-3531.19AMP-activated S/T protein kinase; forms a complex ... [more]
CMK11.560e-3133.33Calmodulin-dependent protein kinase; may play a ro... [more]
IPL11.032e-3031.94Aurora kinase of chromosomal passenger complex; me... [more]
TPK32.602e-3029.96cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO378270.000e+049.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336524.261e-12336.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347075.985e-5139.11Serine/threonine-protein kinase PLK4 [Source:UniP... [more]
EDO354371.140e-3933.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281195.863e-3949.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLK10.000e+049.04polo like kinase 1 [Source:NCBI gene;Acc:101170155... [more]
PLK10.000e+048.95polo like kinase 1 [Source:NCBI gene;Acc:101170155... [more]
plk2b4.467e-12837.22polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
plk34.729e-12736.07polo like kinase 3 [Source:NCBI gene;Acc:101155385... [more]
plk2b3.953e-8647.70polo like kinase 2 [Source:NCBI gene;Acc:101166557... [more]
back to top
BLAST of Serine/threonine-protein kinase PLK vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022441.10.000e+0100.00SMESG000022441.1[more]
SMESG000007751.11.876e-16945.88SMESG000007751.1[more]
SMESG000017012.17.188e-7838.37SMESG000017012.1[more]
SMESG000076532.15.745e-5135.31SMESG000076532.1[more]
SMESG000076532.16.276e-5135.31SMESG000076532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025780 ID=SMED30025780|Name=Serine/threonine-protein kinase PLK|organism=Schmidtea mediterranea sexual|type=transcript|length=1900bp
CTGAAGTTTAGCAAAACTTTGAGTAGATTACCTTGAATTTTATTTGAAAA
GCTAATAGATCTTTGTTCTATTTACTAACAGCAAAATGGACAATACACCA
GAAATAATATTCGATCAGTCACGCAATCAAAGATATACCAAAGGGAAACT
TTTGGGACGAGGTGGATTTGCTAAATGTTATGAGTTACGAGATTCAAACA
ATGAAATATTTGCTGGTAAAATTATATTAAAAAGTGGCATTAAAAATTCT
GGAAGTCGCGAAAAATTGCAACAAGAAATTACAATTCATAGAAATCTCTC
TAATGAAAATATCGTCAAATTTTACCATTATTTTGAGGATAATTTCAATG
TGTACATTATGTTAGAATTGTGTAAGTGTAAGTCTCTTTTAGAATTGCAT
AAGCGTCGTAAAAAAATAACCGAACCAGAAACACGTTATTTTTCTAAACA
AATCGCCAAAGCCTGTGAATATATACATCAACAAAAAATTATTCATAGAG
ATCTCAAATTGGCTAATATTTTCCTTAATAAAGATATGATTGTTAAGCTT
GGAGATTTTGGCTTAGCTACGAAACTTGAATATGATGGCGAGCGTAAAAA
AACTATGTGTGGTACGCCTAATTATATTGCTCCAGAAGTTTTGCGAAAAG
AGGGACATAGTTTTGAAGTCGATTCTTGGTCTTTGGGATGCATCATCTAT
ACATTACTTATTGGAAAGCCACCATTTGAAACTGAAACTCTAAGAGATAC
ATATACTAAAATTAAAAAGAATGAATACAGTATCCCCTTTAATCTCTGCG
ATTCTACTCAAGAAATTATTAGAGCTCTTCTCGATAGCGATGCGATGAAA
CGGCCTTCGATGAATAAACTATTAGAAATGGAATTTTACAAGGGGTTCAT
ACCCAGTGGTTTACCGACGAGTGTCATGACAACTGTCCCTAGATTCGATA
ACATCCAAATCAAAAATAAGCCTCTCTCCAGCATAGGCAACACAATCAGT
GTACCGATTATCAGTGGAATAGGCGTCACCGGAACCGGACACAGTGAGAT
ATTACCAGGTCCCAGTGGGGATGAAAACTATAACAACAGATACATTGTGG
ATTTGATACGCCAGATAAAAAATGTGATTGTCGATATGAAAATAATCAAT
TCTGCAGATTACCCGTCGAAAAAAATGCTAGATCTTATGGAAGAGAGTGA
AGAACCTAATCTAGCTCCGGTTTATTGGGTAGCGAAATGGGTTGACTATT
CCGATCGGTATGGGCTTGGCTATCAGTTGAGCGACGGCTCGAATGGTGTT
GTATTCAATGATATCAGCAGAATTATTCTCACTGCCAACTGTCAAAATCT
GCAATATATTGAAAAGAACGGTACAGAATTTCTCTATACAATTACAAGTT
ACCCCGATAAGCTAAAGAAAAAAGTCACTTTGTTGCAATATTTCCAGACA
TATATGATTGAAAACTTGATGACAGCTGGTGAGAATATGTTCAATGACAA
GGAGTCCATGATCAGGTTGCCTTACGTTAAGGCTTGGTTTAGAACCAAAA
GCGCTATTGTACTTTATTTGAGTAACGGCACAGTTCAGATTAATTTATTT
GGAGATCACACAAAACTTATTGTCTGCCCACTTGTTGGAGCGGTAACCTA
TATTGACGGAACGAAAGATTTTCGAACTTTTAAATTGGAATCACTTCGTC
ACAAAGGCATGACAAACGAGATGCATCAAAGATTGCAATACACTCTTAGA
ATGATTGAAAGGATTTCCAGTTCCGGATCAATGGCTGGCCGTGTTGAGGT
GGCAGAATAATGCCGTATTTACAGACTTTCGAATCGATAAATCCAGCTTT
GTTATAGAATAAAAATAAATTGTTGTATTATTGTTGCTTATGAAAAAAAA
back to top

protein sequence of SMED30025780-orf-1

>SMED30025780-orf-1 ID=SMED30025780-orf-1|Name=SMED30025780-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=575bp
MDNTPEIIFDQSRNQRYTKGKLLGRGGFAKCYELRDSNNEIFAGKIILKS
GIKNSGSREKLQQEITIHRNLSNENIVKFYHYFEDNFNVYIMLELCKCKS
LLELHKRRKKITEPETRYFSKQIAKACEYIHQQKIIHRDLKLANIFLNKD
MIVKLGDFGLATKLEYDGERKKTMCGTPNYIAPEVLRKEGHSFEVDSWSL
GCIIYTLLIGKPPFETETLRDTYTKIKKNEYSIPFNLCDSTQEIIRALLD
SDAMKRPSMNKLLEMEFYKGFIPSGLPTSVMTTVPRFDNIQIKNKPLSSI
GNTISVPIISGIGVTGTGHSEILPGPSGDENYNNRYIVDLIRQIKNVIVD
MKIINSADYPSKKMLDLMEESEEPNLAPVYWVAKWVDYSDRYGLGYQLSD
GSNGVVFNDISRIILTANCQNLQYIEKNGTEFLYTITSYPDKLKKKVTLL
QYFQTYMIENLMTAGENMFNDKESMIRLPYVKAWFRTKSAIVLYLSNGTV
QINLFGDHTKLIVCPLVGAVTYIDGTKDFRTFKLESLRHKGMTNEMHQRL
QYTLRMIERISSSGSMAGRVEVAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036947POLO_box_dom_sf
IPR033701POLO_box_1
IPR033695POLO_box_2
IPR000719Prot_kinase_dom
IPR000959POLO_box_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 17..268
e-value: 6.7E-83
score: 291.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 17..267
e-value: 1.0E-67
score: 228.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 17..268
score: 48.089
IPR000959POLO box domainPFAMPF00659POLO_boxcoord: 486..552
e-value: 3.2E-14
score: 52.9
coord: 389..450
e-value: 1.2E-18
score: 67.0
IPR000959POLO box domainPROSITEPS50078POLO_BOXcoord: 485..554
score: 22.324
IPR000959POLO box domainPROSITEPS50078POLO_BOXcoord: 388..451
score: 19.372
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 102..271
e-value: 2.3E-57
score: 195.3
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 3..96
e-value: 1.7E-29
score: 103.8
NoneNo IPR availablePANTHERPTHR24345SERINE/THREONINE-PROTEIN KINASE PLKcoord: 8..561
NoneNo IPR availablePANTHERPTHR24345:SF57coord: 8..561
NoneNo IPR availableCDDcd14099STKc_PLKcoord: 16..267
e-value: 1.45053E-144
score: 415.799
NoneNo IPR availableSUPERFAMILYSSF82615Polo-box domaincoord: 360..468
NoneNo IPR availableSUPERFAMILYSSF82615Polo-box domaincoord: 473..559
IPR036947POLO box domain superfamilyGENE3DG3DSA:3.30.1120.30coord: 384..478
e-value: 6.2E-81
score: 272.6
IPR036947POLO box domain superfamilyGENE3DG3DSA:3.30.1120.30coord: 359..559
e-value: 6.2E-81
score: 272.6
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 23..49
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 135..147
IPR033701First polo-box domainCDDcd13118POLO_box_1coord: 378..466
e-value: 6.168E-39
score: 135.526
IPR033695Second polo-box domainCDDcd13117POLO_box_2coord: 479..560
e-value: 8.06834E-29
score: 107.283
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 14..308