G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30025775
Length (bp)1215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025775) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025775) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025775) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025775) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025775

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025775SMESG000039899.1 SmedASXL_010103SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30025775SMESG000039899.1 dd_Smed_v4_21853_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025775SMESG000039899.1 dd_Smed_v4_21853_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-10 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:O45096])

HSP 1 Score: 50.0618 bits (118), Expect = 1.355e-6
Identity = 53/236 (22.46%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  384 FYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVG--TVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIR---RSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQE--LSILILSMKSDFSFVLHCWVCDKF-GAALKRMFC 1067
            F+R+   IF L       S W    + ++R++ V +P + +R+ ++    IT+   +   + + K+PS      +E  ++++ +    E+ K+    E +  ++   +   ++P+ ++IF+NA +I  +R   R+   M       + K E+ ERK+T +   + M F IC  P         ++     Y N     Q   LS +++ + S  + +++C    +F  AALK + C
Sbjct:   27 FWRVTVSIFPLSLIAQAGSVWTYVAVTVDRFIAVCFP-IKRRVWSTRSNTITVLFVITFISAIFKLPSF-----FEVRLDHNGEVEPTELRKNEFYIEFYLFYLY-VTFIQLIPWTLIIFLNAIIIHKVRLAYRAQEAMVHNSGKLNTKREDAERKVTVMATVMTMIFIICNIP-------PGINYLVDRYSNPTVYRQRIPLSNVLVCVNSASNMMIYCVFNSRFRRAALKLLGC 248          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-3 (FMRFamide Peptide Receptor family; VRFamide receptor 1 [Source:UniProtKB/TrEMBL;Acc:G5EG36])

HSP 1 Score: 49.2914 bits (116), Expect = 2.711e-6
Identity = 47/171 (27.49%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  393 IYQY-IFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIE-------KSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFIC 881
            +Y Y + I+F++V   S WL   + I+RYL V +PF+       +R LIT    VG V++   +  L+  +E  +N D     + IE       ++  +F LW   +         P  VL  +N ++  TI  +S   R+  A+  R     E     +MI V++ F +C
Sbjct:   82 VYLYPVTIMFQSV---SVWLLVSITIDRYLAVCHPFMVNTYCTRNRALIT----VGVVVIFSVAYNLIRIWEYTINFDVAPENRTIEDLVVPKLRANPHFLLWYQNVATLVSQFAFPLTVLCVLNIQVARTIIEASEQRRELVASVKR-----EHSTAKMMIMVVLVFLVC 240          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: gfra3 (GDNF family receptor alpha 3 [Source:Xenbase;Acc:XB-GENE-988962])

HSP 1 Score: 49.6766 bits (117), Expect = 5.902e-6
Identity = 45/222 (20.27%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  444 WLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHNFELWQ-SWIVDF-SLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNINPE-RENTIN 1100
            W  ++L  ERY+V+  P    R+   H  L  +F +V + +  IP  +   +Y +       +     E + ++ E+   ++I+ F +   + P  V+     +L+  +R+ S    +  + R       E+++T +++ +I+AF IC  P+  ++ L   H       +    L  +        S ++ +++ ++  +F   L +MF   +PE +E+ +N
Sbjct:  121 WSLSVLAFERYIVICRPLGNLRLQGKHSALAIIFVWVFSFVWTIPPTMGWSSYTT------SKIGTTCEPNWYSGEMRDHTYIITFLTTCFVFPLLVIFMSYGKLMRKLRKVSDTQGRLGSTRK-----PEKEVTRMVVIMILAFLICWTPYAAFSILITAH----PTIDLDPRLAAIPAFFAKTASMYNPIIYVYMNKQFRRCLYQMFNINDPEAKESNLN 327          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|O42490|OPSP_PETMA (Pineal opsin OS=Petromyzon marinus OX=7757 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.440e-6
Identity = 50/213 (23.47%), Postives = 93/213 (43.66%), Query Frame = 3
Query:  333 IASLDYFVLNYTINMPIFYRIYQYIFILFEAVLL----------LSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINY-ESIVNNDFQQHTQEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITY----TALSNVHL 926
            +A+ D  V     ++  F  I  Y F+   A +L          ++ W   +L  ERY V+  P    R+ + H  L     +V ++   +P ++   +Y  S++    + +    E   H F L     + FS   I P  V+ F   +LI  ++++S   R   + R       E+++T +++ +I+AF +C  P+ T+    TA   +HL
Sbjct:   89 LAAADLLVSAIGGSVSFFTNIKGYFFLGVHACVLEGFAVTYFGVVALWSLALLAFERYFVICRPLGNFRLQSKHAVLGLAVVWVFSLACTLPPVLGWSSYRPSMIGTTCEPNWYSGELHDHTFIL-----MFFSTCFIFPLAVIFFSYGKLIQKLKKASETQRGLESTRR-----AEQQVTRMVVVMILAFLVCWMPYATFSIVVTACPTIHL 291          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3SPR4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS6974 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.274e-29
Identity = 109/362 (30.11%), Postives = 179/362 (49.45%), Query Frame = 3
Query:  171 RVIKNYLTPLMXXXXXXXXXXXXXXXHKRNL-WISTRIYITAXXXXXXXXXXXXTIASLDYFVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHN--------------------------------------------FELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIEN---EERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNINPERENTINYSMH 1112
            +VI++ +TP + +IS+  ++ TL+++H++ L  I+  IY+  +G VD+L L+ + I SLDY   ++         ++  +F      L  SNWL T   IER + +S PF  K+I   HR+++    F+ +VL  IP+L+L I    +    +Q+   +  K                                                FE  QSW+V F LF I+PF  L   +  L+  ++ S RF+RQ+C     +  N   EE ++T + +C+I AFFICQ PF+ Y A ++V L  +   +  S+++ L  L L++KSD +FV HCW+  +F  AL+RM C+ +    NT +   H
Sbjct:   35 QVIRHIITPAVCLISMGALIFTLILLHRKKLVRITALIYLKCMGFVDLLSLIFIFILSLDYSSKSFFKAQKFSPALHGCLF----GFLFTSNWLMTAQAIERTIAISKPFKAKQIREKHRRIVVSVIFILSVLFTIPTLVLDI----MQTERYQEDPGDFHKDGDGFFHFFNKFKNDINLPQFDINQTYSLESFVPVSPSKDKWPRYLVIFEKVQSWLVYFVLFFILPFVCLCLTSFYLLSAVKMSGRFVRQHCIRGGVEFRNTLREEARMTVLTLCLIGAFFICQSPFVIYQAFTHVGLLSRP-SHEMSLVRALIHLALALKSDCTFVFHCWLNQRFALALRRMLCSFS---SNTASGRCH 384          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5K3F5F3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.906e-29
Identity = 112/391 (28.64%), Postives = 193/391 (49.36%), Query Frame = 3
Query:  105 INSSLNKSTDSLIIPTMIKIQNRVIKNYLTPLMXXXXXXXXXXXXXXXHKRNL-WISTRIYITAXXXXXXXXXXXXTIASLDYFVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLI---------------------------------NYESIVN--------------------------NDFQQHTQEIEKS----LHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIEN---EERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNIN 1076
            I S L+ S ++L+          VI++++TP + ++SI  ++ TL  +H+R L  ++  IY+  +G +D+L L++L ++SLDYF+ +  +++       + ++     +LL SNWL T   IER + +S PF  K+I   HR++      V  +L+ IP+L+L I                                 N+E + N                          +   Q T  +E S    L  ++  Q+W+V F +F ++PF  L   +  L+  +R S RF+RQ+C     +  N   EE ++T +++C+I AFFICQ PF+ Y+A   V +  +   +G S+L+    L L++KSD +FV HCW+  +F  AL+RM C+ +
Sbjct:   26 IESLLSGSDEALVT------SYHVIRHFITPAICLLSIGALIFTLFFLHRRKLVRVTALIYLKFMGFIDLLSLIVLFVSSLDYFMSSRQVHVYYTSAFARCLYGCLLGLLLTSNWLMTAQAIERTIAISRPFKAKQIREKHRRIAVSAICVLALLLTIPTLVLDIMELTRYRQCWGTPHSDKPCIDIDQVAERFQMAYNHEHMTNALNETTSMLYLKLIQQGKHSKPETFSHTGHQLTTYVEDSWPEPLKQYQAAQAWLVHFFIFFVLPFVFLCLASFCLLSAVRMSGRFVRQHCIRGGVEFRNTLREEARMTILILCLIGAFFICQSPFVAYSACHKVGILSKP-SHGHSLLRAAITLALALKSDCTFVFHCWLNQRFALALRRMLCSFS 409          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7TMC4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_215199 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 7.427e-29
Identity = 89/320 (27.81%), Postives = 176/320 (55.00%), Query Frame = 3
Query:  150 TMIKIQNRVIKNYLTPLMXXXXXXXXXXXXXXXHKRNLWISTRIYITAXXXXXXXXXXXXTIASLDYFVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHR-KLITLFCFVGTVLVKIPSL---ILLINYESIVNNDFQ-QHTQEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMR-------QYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVH--LFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFC 1067
            T   I  RV   Y+ P++    I  I++T++++ ++N+  ST  ++ AL + D+L L++L+   ++  + ++T     F     Y  I     L+ S WLT +L +ERY+ +  PFL  ++ +  R ++  +  +V   LV++P+     ++  ++++ N       + E+  ++H   +   W+VD  L  I+PF +L+ +N RLI  +R+S+R+++                I+ EE +IT ++I +I+ FFICQ P++ YTA+ +++  +       G  +  +L+I++L+ KS  +F+++CW  +KF A LK++FC
Sbjct:   25 TAASITLRVTNQYILPIICCFGILGIILTVIVLSRKNMCTSTNCHLMALAIADLLFLLLLSTRQIENHLTHWTSGYYQFSIYLDYAVIFMHVFLMASIWLTVMLAVERYIAICQPFLAAKVCSVKRARIFVVSIYVFAFLVRLPAFWEHEVVTRFDTLSNTSISYTKSTELASNVHYLRI-NPWVVDGILMSILPFILLLVLNVRLIWEVRKSTRYLQATMVASVSAPGRSAGTIKKEELQITVMLISIIIVFFICQAPYVVYTAIFSINKDILSSGSSTGFLIFHQLAIVVLAFKSAVNFIIYCWFSEKFWATLKKIFC 343          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A210PPP6 (FMRFamide receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT25244 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.228e-25
Identity = 82/281 (29.18%), Postives = 146/281 (51.96%), Query Frame = 3
Query:  252 KRNLWISTRIYITAXXXXXXXXXXXXTIASLDYFVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHR-KLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHN---FELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCA---NRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDY---KNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMF 1064
            ++N+  ST  Y+T+L + D+  LVIL+   L+Y +  Y  ++   Y  Y  IF+     LL S WLT +L IERY+ + +P     I    R ++I +  FV +   ++P+              + +    +   L     +++  +W+VD  +  I+PF  L+F+N RLI+ IR+S++++R +     N    + NE+ KIT ++I +I  FF+CQ P++   A  N+H +            ++ + +I +L++KS  +F+L+CW  +KF    KR F
Sbjct:   84 RKNMCTSTNCYLTSLSIADLGFLVILSTKFLEYRITGYPFHVFDIYFTYAQIFL--HTFLLASVWLTVMLAIERYIAICHPLRAISICTVRRARIIIVVIFVFSFYCRVPNFFEQEIKTVTPCPGYPEFRHMVLTKLGQNLTYKISYAWVVDCIICAILPFIALLFLNIRLIIEIRKSTKYLRYHLGTDSNMQNAVSNEQLKITMMLISIIFVFFVCQAPYVITMAYRNIHQYTSRTILRSLTMEIVADATIFMLALKSAINFILYCWFSEKFWNTFKRAF 362          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3VTF0 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS509 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.904e-22
Identity = 54/143 (37.76%), Postives = 88/143 (61.54%), Query Frame = 3
Query:  657 LHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIEN---EERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNIN 1076
            L  F++ Q+W+V F +F ++PF  L   +  L+  +R S RF+RQ+C     +  N   EE ++T +++C+I AFFICQ PF+ Y+A   V +  +  + G S+L+    L L++KSD +FV HCW+  +F  AL+RM C+ +
Sbjct:   70 LKQFQIVQAWLVHFFIFFVLPFVFLCLASFCLLSAVRMSGRFVRQHCIRGGVEFRNTLREEVRMTVLILCLIGAFFICQSPFVAYSACHKVGILSKPSR-GHSLLRAAITLALALKSDCTFVFHCWLNQRFALALRRMLCSFS 211          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO35688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKS2])

HSP 1 Score: 48.9062 bits (115), Expect = 1.913e-6
Identity = 21/69 (30.43%), Postives = 37/69 (53.62%), Query Frame = 3
Query:  684 WIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGP 890
            W+V+   F+I+PF ++      + + +RR  +  +   AN H   + + RKI  +  C++ AF IC GP
Sbjct:  188 WMVNAVTFIILPFAIITIFYVAIFIELRRQLKKSKGMMANSHTLRQKQNRKIAKLAFCIVFAFGICYGP 256          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: mlnr (growth hormone secretagogue receptor type 1-like [Source:NCBI gene;Acc:101173159])

HSP 1 Score: 53.5286 bits (127), Expect = 1.889e-7
Identity = 58/236 (24.58%), Postives = 105/236 (44.49%), Query Frame = 3
Query:  390 RIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVG-TVLVKIPSLILL-INYESIVNNDFQ----QHTQ-EIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQE----LSILILSMKSDFSFVLHCWVCDKFGAALKRMF 1064
            R Y Y+F    +  +L     T L IERYL +S+P  +K +    R    +F   G  +L   P+L L+ + Y++  N DF     +HT   I     +  LW S     + +   P   L+F+   +   + +S   +   C       E   R+   I++ V++AF IC   ++ Y    N+     DY+   +ML +     S+++  + +  + V++  +  K+ AA +R+F
Sbjct:  113 RFYHYVFEGCTSATILH---ITALSIERYLAISFPLRSKVVVTRRRVQYIIFALWGFALLSAAPTLFLVGVEYDNETNPDFNTGQCKHTSNAISSGQLHIMLWVS-----TTYFFFPMFCLVFLYGSIGCKLWKSKGDLYGPCMLAR---ERSHRQTVKILVVVVLAFIIC---WLPYHIGRNLFAQVDDYET--AMLSQNFNMASMVLCYLSASINPVVYNLMSRKYRAAARRLF 332          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000039899.1 (SMESG000039899.1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 344/344 (100.00%), Postives = 344/344 (100.00%), Query Frame = 3
Query:   93 MMHLINSSLNKSTDSLIIPTMIKIQNRVIKNYLTPLMXXXXXXXXXXXXXXXHKRNLWISTRIYITAXXXXXXXXXXXXTIASLDYFVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNINPERENTINYSMHIASK 1124
            MMHLINSSLNKSTDSLIIPTMIKIQNRVIKNYLTPLMSVISITVIVITLLIIHKRNLWISTRIYITALGLVDILGLVILTIASLDYFVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNINPERENTINYSMHIASK
Sbjct:    1 MMHLINSSLNKSTDSLIIPTMIKIQNRVIKNYLTPLMSVISITVIVITLLIIHKRNLWISTRIYITALGLVDILGLVILTIASLDYFVLNYTINMPIFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNINPERENTINYSMHIASK 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078268.1 (SMESG000078268.1)

HSP 1 Score: 135.961 bits (341), Expect = 3.226e-36
Identity = 100/303 (33.00%), Postives = 168/303 (55.45%), Query Frame = 3
Query:  252 KRNLWISTRIYITAXXXXXXXXXXXXTIASLDYFVLNYTI-NMPIFYRIYQYIFILFE---AVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIEN-----EERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSMKSDFSFVLHCWVCDKFGAALKRMFCNINPERENTINYSMHIASK*MY 1133
            K+ +W+STR+++T +G+VD+  LV+  I +++  ++   + N  +  + +    IL E    ++ +SNW+T +LG ERY+ V YP  ++RI   HRK+     FV  ++ K+P +I++  +     +D +     I K   + +L   WI+   LFLIVPF  L  +N +LIL +RRSSRF+RQ C+N++   +N     EE KIT ++I +I+ FF+ QGPF  Y  L       Q +      L+ +S ++LS+KS   F L+CW C+KF   L  + C  + +  ++   +     + MY
Sbjct:   47 KKGIWLSTRMFMTIMGIVDLFALVLFIIFNIEKPLIELELLNFEMISKWFNVKMILAEFLHGLIFISNWITVLLGFERYIAVCYPLYSRRIDYIHRKIAVAVIFVVIIIFKLPLIIMIYLHRF---HDLRIQRNFIYKLYTHVQL---WIITLFLFLIVPFVCLALINFQLILAVRRSSRFLRQ-CSNQNPNYQNSNSRTEEHKITFVLIGIIVIFFVFQGPFGIYVTL-------QSFNYHSISLRGISSILLSLKSIVHFFLYCWFCEKFRQILYHLLCRSSRQEISSFTLADQSTQQLMY 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061117.1 (SMESG000061117.1)

HSP 1 Score: 113.62 bits (283), Expect = 7.068e-28
Identity = 66/212 (31.13%), Postives = 122/212 (57.55%), Query Frame = 3
Query:  414 LFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLILLINYESIVNNDFQQHT-----QEIEKSLHNFELWQSWIVDFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKI-ENEERKITCIMICVIMAFFICQGPFITYTALSNVHL--FHQDYKNGQSMLQELSILILSMKSDFSFVLHCW 1025
            L + +LL SNW+TT+LG+ER + V  PFL KRITN HR        V   +++IP+ IL I  + ++ N  +  +      + +K++   +  Q+W VDF +F +VPF ++ +++  L+  IR S +F++   +N  +   +  E+KIT  +  V++ F I QGP   YT LS++ +  ++  +   Q +++   + I S+K++ +F+L+ +
Sbjct:  110 LLDIILLSSNWITTLLGLERCVAVRDPFLAKRITNRHRYFSISIVIVTAAILRIPNAILAIWKQEMIFNSLENTSLVNVQSKFQKNILILQNIQNWFVDFCIFFVVPFSLMCWMSYVLLRAIRSSQQFLQYRISNEIKSFNQKNEQKITIFLFVVLLNFIIFQGPLALYTGLSSIGMANYYSIFTQYQFVIRPSCVFIFSIKNEANFILYLY 321          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061235.1 (SMESG000061235.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.763e-8
Identity = 63/260 (24.23%), Postives = 117/260 (45.00%), Query Frame = 3
Query:  381 IFYRIYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITLFCFVGTVLVKIPSLI---LLINYESIVNNDFQQ----HTQEIEKSLHNFELWQSW-IVDFSLFLIVPFCVLIFVNARLILTIRRS----SRFM---RQYCANRHRKIENEERKITCIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSI---LILSMKSDFSFVLHCWVCDKFGA-ALKRMFC---NINPERENT 1094
            +F R+ Q+I +   +  L+S WL  ++ IER +++  P   K+IT   +K I       T++    SL+        ++ V   F +    H  E          ++ W I+D SL+ ++PFCVLI +N  ++  I RS    S  M    Q C+   +K+  +   ++  +I V   F I   P + +  L  +H   +D      ++Q L +   +++      +F+L+C   ++F    L  + C   ++N   +NT
Sbjct:  141 LFCRLTQFIGV---SSSLVSVWLIVVMTIERVIIIYLPLRAKQIT---QKKIARAVISSTIICS--SLVASHFFFTVDTHVTKQFNKTNLIHFGECTAKPQFHYFYRVWTILDASLYSLIPFCVLISLNVLIVREILRSKNNRSILMNNFNQACSKSIKKVSTDTHHLSVTLIAVSFIFLITTTPLVVHKLL--IHFRDKDEVYHSGIIQFLDVIFEMLMYTNHSINFLLYCATGNRFRQHVLSLLLCRTLSLNRPADNT 390          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
frpr-101.355e-622.46FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-32.711e-627.49FMRFamide Peptide Receptor family; VRFamide recept... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gfra35.902e-620.27GDNF family receptor alpha 3 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O42490|OPSP_PETMA6.440e-623.47Pineal opsin OS=Petromyzon marinus OX=7757 PE=1 SV... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SPR42.274e-2930.11G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A5K3F5F35.906e-2928.64Uncharacterized protein OS=Mesocestoides corti OX=... [more]
R7TMC47.427e-2927.81G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A210PPP66.228e-2529.18FMRFamide receptor OS=Mizuhopecten yessoensis OX=6... [more]
A0A0R3VTF02.904e-2237.76Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO356881.913e-630.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mlnr1.889e-724.58growth hormone secretagogue receptor type 1-like [... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000039899.10.000e+0100.00SMESG000039899.1[more]
SMESG000078268.13.226e-3633.00SMESG000078268.1[more]
SMESG000061117.17.068e-2831.13SMESG000061117.1[more]
SMESG000061235.11.763e-824.23SMESG000061235.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025775 ID=SMED30025775|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1215bp
TAATTCATCATTGAAATAGTATGAAGTGTTTTGCCGATATCCTCAACAGT
TGTCAATTATAAAGTAAATTAAATTTTTTTTTCAAGTGAGAAATGATGCA
TTTAATAAATTCGAGTCTCAATAAGTCCACCGACAGCCTCATCATTCCAA
CAATGATAAAAATACAGAATCGGGTTATAAAAAATTATCTGACTCCCCTC
ATGAGTGTCATCAGTATAACTGTGATTGTAATCACTTTATTAATAATCCA
CAAAAGAAATCTCTGGATCTCAACACGGATTTATATAACAGCTCTCGGCC
TAGTGGACATTCTAGGTTTGGTAATTCTAACTATTGCAAGTCTTGATTAT
TTTGTACTGAATTATACAATAAATATGCCTATTTTCTATCGAATTTATCA
GTACATTTTCATCCTTTTCGAAGCAGTTCTATTGTTAAGCAATTGGCTAA
CAACGATTTTGGGAATCGAAAGATATTTGGTGGTCTCTTATCCGTTTCTG
ACAAAACGAATCACCAATTCTCACCGGAAGTTGATCACACTGTTTTGTTT
TGTCGGAACGGTTTTGGTAAAAATTCCGAGTTTAATTCTTTTAATTAACT
ACGAATCAATTGTGAACAATGATTTCCAGCAGCACACTCAGGAAATTGAA
AAAAGTCTTCACAATTTCGAACTCTGGCAATCTTGGATAGTTGATTTCAG
TTTGTTTTTGATTGTTCCGTTTTGCGTATTAATATTCGTTAACGCTCGCT
TGATTTTAACCATTCGTCGATCAAGCCGATTCATGAGGCAATATTGCGCC
AATCGGCACAGAAAGATTGAAAACGAAGAAAGAAAAATCACCTGCATTAT
GATTTGCGTAATAATGGCTTTCTTCATTTGCCAAGGACCTTTTATCACTT
ACACAGCCTTGTCGAATGTTCACTTGTTTCACCAAGACTACAAAAATGGC
CAGTCAATGCTTCAAGAACTTTCAATATTGATTCTTTCAATGAAAAGTGA
TTTCAGTTTTGTTCTTCACTGTTGGGTTTGCGACAAATTTGGAGCGGCTT
TAAAACGGATGTTTTGTAATATAAATCCCGAGAGAGAAAACACTATAAAC
TATTCAATGCACATCGCGTCGAAATAAATGTACAGGTGACAATTCCTTTT
AAGCTAGAAAAAGACTACGTTTCCATTCAAAATGACCCATTTGCAAGAGG
ATTGGACAGATCGGA
back to top

protein sequence of SMED30025775-orf-1

>SMED30025775-orf-1 ID=SMED30025775-orf-1|Name=SMED30025775-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=345bp
MMHLINSSLNKSTDSLIIPTMIKIQNRVIKNYLTPLMSVISITVIVITLL
IIHKRNLWISTRIYITALGLVDILGLVILTIASLDYFVLNYTINMPIFYR
IYQYIFILFEAVLLLSNWLTTILGIERYLVVSYPFLTKRITNSHRKLITL
FCFVGTVLVKIPSLILLINYESIVNNDFQQHTQEIEKSLHNFELWQSWIV
DFSLFLIVPFCVLIFVNARLILTIRRSSRFMRQYCANRHRKIENEERKIT
CIMICVIMAFFICQGPFITYTALSNVHLFHQDYKNGQSMLQELSILILSM
KSDFSFVLHCWVCDKFGAALKRMFCNINPERENTINYSMHIASK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 109..131
score: 21.76
coord: 198..221
score: 16.04
coord: 61..82
score: 22.41
coord: 249..273
score: 22.1
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 46..294
e-value: 5.5E-18
score: 65.2
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 18..334
e-value: 2.5E-33
score: 117.4
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 28..333
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 28..316
e-value: 3.68147E-21
score: 89.9996
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 29..329
NoneNo IPR availableTMHMMTMhelixcoord: 60..82
NoneNo IPR availableTMHMMTMhelixcoord: 199..221
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
NoneNo IPR availableTMHMMTMhelixcoord: 31..53
NoneNo IPR availableTMHMMTMhelixcoord: 249..271
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 42..309
score: 20.592