E3 ubiquitin-protein ligase

Overview
NameE3 ubiquitin-protein ligase
Smed IDSMED30025761
Length (bp)975
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase (SMED30025761) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase (SMED30025761) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase (SMED30025761) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase (SMED30025761) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025761

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30025761h1SMcG0005861 SmedASXL_008715SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30025761h1SMcG0005861 Contig49342newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025761h1SMcG0005861 Contig49342uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30025761h1SMcG0005861 dd_Smed_v4_5261_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025761h1SMcG0005861 dd_Smed_v4_5261_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025761h1SMcG0005861 dd_Smed_v4_5261_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: WWTR1 (WW domain containing transcription regulator 1 [Source:HGNC Symbol;Acc:HGNC:24042])

HSP 1 Score: 54.6842 bits (130), Expect = 2.435e-8
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  124 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKAMN 160          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: WWTR1 (WW domain containing transcription regulator 1 [Source:HGNC Symbol;Acc:HGNC:24042])

HSP 1 Score: 55.0694 bits (131), Expect = 6.644e-8
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  124 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKAMN 160          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: WWTR1 (WW domain containing transcription regulator 1 [Source:HGNC Symbol;Acc:HGNC:24042])

HSP 1 Score: 55.0694 bits (131), Expect = 6.644e-8
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  124 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKAMN 160          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: WWTR1 (WW domain containing transcription regulator 1 [Source:HGNC Symbol;Acc:HGNC:24042])

HSP 1 Score: 55.0694 bits (131), Expect = 6.644e-8
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  124 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKAMN 160          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: BAG3 (BCL2 associated athanogene 3 [Source:HGNC Symbol;Acc:HGNC:939])

HSP 1 Score: 51.9878 bits (123), Expect = 8.522e-7
Identity = 25/64 (39.06%), Postives = 35/64 (54.69%), Query Frame = 1
Query:   49 NSSLYQIMSSVKNL-PLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGP 237
            +S + Q+ S   +  PLPP WE+K D  T   F+V+H ++ TTW+DPR  S   K       GP
Sbjct:    6 HSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGP 69          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Match: bag3 (BCL2 associated athanogene 3 [Source:ZFIN;Acc:ZDB-GENE-040801-40])

HSP 1 Score: 51.6026 bits (122), Expect = 6.492e-7
Identity = 25/65 (38.46%), Postives = 35/65 (53.85%), Query Frame = 1
Query:   55 SLYQIMSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRK---------KSNSTKSPQD 222
            +L  + +   N PLPP WE+K D  T   F+V+H  + TTW+DPR           S S ++PQD
Sbjct:   15 TLSPVETMATNDPLPPGWEIKIDPQTGWPFFVDHNNRTTTWNDPRHDTKKIFSNGPSMSPETPQD 79          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Match: wwtr1 (WW domain containing transcription regulator 1 [Source:ZFIN;Acc:ZDB-GENE-051101-1])

HSP 1 Score: 50.447 bits (119), Expect = 1.228e-6
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 1
Query:   61 YQIMSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRK 192
            +Q     + LPLPP WEM F    +K+F +NH  KITTW DPRK
Sbjct:  105 HQSCDVAEELPLPPGWEMAFTPNGQKYF-LNHIEKITTWHDPRK 147          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Match: fam214a (family with sequence similarity 214 member A [Source:Xenbase;Acc:XB-GENE-5816685])

HSP 1 Score: 51.2174 bits (121), Expect = 1.020e-6
Identity = 21/35 (60.00%), Postives = 25/35 (71.43%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRK 192
            LPLPP WEM F   T + +++NH  KITTW DPRK
Sbjct:  116 LPLPPGWEMAFTH-TGQRYFLNHIEKITTWQDPRK 149          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Match: plpp4 (phospholipid phosphatase 4 [Source:Xenbase;Acc:XB-GENE-6051164])

HSP 1 Score: 51.2174 bits (121), Expect = 1.519e-6
Identity = 20/33 (60.61%), Postives = 23/33 (69.70%), Query Frame = 1
Query:   91 PLPPDWEMKFDFATKKHFYVNHKTKITTWDDPR 189
            PLPP WEMK D  T   F+V+H  +ITTW DPR
Sbjct:   25 PLPPGWEMKLDPQTGWPFFVDHNNRITTWTDPR 57          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Wwtr1 (WW domain containing transcription regulator 1 [Source:MGI Symbol;Acc:MGI:1917649])

HSP 1 Score: 53.9138 bits (128), Expect = 1.130e-7
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  181 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKVMN 217          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Wwtr1 (WW domain containing transcription regulator 1 [Source:MGI Symbol;Acc:MGI:1917649])

HSP 1 Score: 53.9138 bits (128), Expect = 1.141e-7
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  124 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKVMN 160          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Bag3 (BCL2-associated athanogene 3 [Source:MGI Symbol;Acc:MGI:1352493])

HSP 1 Score: 50.447 bits (119), Expect = 1.797e-6
Identity = 26/71 (36.62%), Postives = 35/71 (49.30%), Query Frame = 1
Query:   91 PLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFV----GDDADMERIIKMTE 291
            PLPP WE+K D  T   F+V+H ++ TTW+DPR              GPKD      G   D  R++ + E
Sbjct:   23 PLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPE----------GPKDTASSANGPSRDGSRLLPIRE 83          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|Q9GZV5|WWTR1_HUMAN (WW domain-containing transcription regulator protein 1 OS=Homo sapiens OX=9606 GN=WWTR1 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 3.191e-7
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  124 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKAMN 160          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|Q9EPK5|WWTR1_MOUSE (WW domain-containing transcription regulator protein 1 OS=Mus musculus OX=10090 GN=Wwtr1 PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 7.982e-7
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSN 201
            LPLPP WEM F  AT + +++NH  KITTW DPRK  N
Sbjct:  124 LPLPPGWEMTFT-ATGQRYFLNHIEKITTWQDPRKVMN 160          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|O95817|BAG3_HUMAN (BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3)

HSP 1 Score: 51.9878 bits (123), Expect = 4.093e-6
Identity = 25/64 (39.06%), Postives = 35/64 (54.69%), Query Frame = 1
Query:   49 NSSLYQIMSSVKNL-PLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGP 237
            +S + Q+ S   +  PLPP WE+K D  T   F+V+H ++ TTW+DPR  S   K       GP
Sbjct:    6 HSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGP 69          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A210QV42 (E3 ubiquitin-protein ligase Itchy-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04052 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.228e-9
Identity = 59/211 (27.96%), Postives = 99/211 (46.92%), Query Frame = 1
Query:   91 PLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTK----SPQDDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQ---EKRKEXXXXXXXXXXXXGV---SGSKGKLCKGEQTRFSLSEISKYDAP----DSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKIL 681
            PLPP WE ++D   + +F+++H TK T+W+DPR  S +T      PQ  +   KD  G   +   +     K D + N + M    YP   ++ + +++     N     ++L +   +K  E +S  S  T        S +KGK  K      + S      AP    ++ K R  S+L+SEF  +D+ +V   L+V +Y  +++R IL
Sbjct:   12 PLPPGWEGRWDANQRTYFFIDHATKKTSWEDPRYSSQATAQPPFPPQKSLYKSKDMPGISTEPTFV-----KQDTMANKIHM---DYPRVPLDTIADIVSACNLNEQEARIMLTRMGYQKGGEANSHSSLKTEQPAFRPKSPAKGK-AKSPSRSPARSPTPPKSAPKPVSEAEKKRILSKLKSEFPALDSVVVTMALDVCEYKEDQARIIL 213          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A1S3HS30 (serine/arginine repetitive matrix protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106157671 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.924e-8
Identity = 54/212 (25.47%), Postives = 96/212 (45.28%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRK---KSNSTKSPQDDVIGPKDFVGDDADMERI----IKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKEXXXXXXXXXXXXGVSGSKGKLCKGEQTRFSLSEISKYDAP------DSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILN 684
            +PLPP +E K+D+  +++FY+NH T++T W+DPRK   +  S ++ Q   + PK                   + + D  E+    I   +P  D++ +  +L   +GN    ++   +E+ +               S S  +     QTR +    S   AP      DS K R K +L +EF++  + ++D V+EV  Y   ++R +L 
Sbjct:   13 MPLPPGFEAKYDYNQRRYFYINHNTRVTQWEDPRKAYYERQSAQTAQPIPMKPKPTPASQGTTSHGGVAETSFSRRPDDFEDKKAKIKQSFPTADMDIIVNIL---EGN--NYDLFRAREQLRSMGYSE---------SSSLARPAPA-QTRAATRSRSPSPAPAPKQLSDSEKERLKVKLTNEFSEPMS-VIDMVVEVCQYDETKARALLT 208          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A267EQ15 (WW domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026242g1 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 7.932e-8
Identity = 21/35 (60.00%), Postives = 30/35 (85.71%), Query Frame = 1
Query:   91 PLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKK 195
            P+PP WEMK+DF  K++FY++H  K+T+WDDPR+K
Sbjct:   11 PMPPGWEMKYDFTNKRYFYIDHTNKVTSWDDPRQK 45          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A267G7U8 (WW domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026242g3 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 8.270e-8
Identity = 21/35 (60.00%), Postives = 30/35 (85.71%), Query Frame = 1
Query:   91 PLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKK 195
            P+PP WEMK+DF  K++FY++H  K+T+WDDPR+K
Sbjct:   11 PMPPGWEMKYDFTNKRYFYIDHTNKVTSWDDPRQK 45          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A1S3HUV6 (serine/arginine repetitive matrix protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106157671 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.267e-7
Identity = 54/212 (25.47%), Postives = 96/212 (45.28%), Query Frame = 1
Query:   88 LPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRK---KSNSTKSPQDDVIGPKDFVGDDADMERI----IKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKEXXXXXXXXXXXXGVSGSKGKLCKGEQTRFSLSEISKYDAP------DSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILN 684
            +PLPP +E K+D+  +++FY+NH T++T W+DPRK   +  S ++ Q   + PK                   + + D  E+    I   +P  D++ +  +L   +GN    ++   +E+ +               S S  +     QTR +    S   AP      DS K R K +L +EF++  + ++D V+EV  Y   ++R +L 
Sbjct:    7 MPLPPGFEAKYDYNQRRYFYINHNTRVTQWEDPRKAYYERQSAQTAQPIPMKPKPTPASQGMASHGGVAETSFSRRPDDFEDKKAKIKQSFPTADMDIIVNIL---EGN--NYDLFRAREQLRSMGYSE---------SSSLARPAPA-QTRAATRSRSPSPAPAPKQLSDSEKERLKVKLTNEFSEPMS-VIDMVVEVCQYDETKARALLT 202          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Match: wwtr1 (WW domain containing transcription regulator 1 [Source:ZFIN;Acc:ZDB-GENE-051101-1])

HSP 1 Score: 54.6842 bits (130), Expect = 5.201e-8
Identity = 25/52 (48.08%), Postives = 32/52 (61.54%), Query Frame = 1
Query:   61 YQIMSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSP 216
            +Q     + LPLPP WEM F    +K+F +NH  KITTW DPRK   +T +P
Sbjct:  109 HQSFDVTEELPLPPGWEMAFTSNGQKYF-LNHVEKITTWHDPRKTMTATMNP 159          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Match: bag3 (BCL2 associated athanogene 3 [Source:NCBI gene;Acc:103030994])

HSP 1 Score: 51.6026 bits (122), Expect = 6.538e-7
Identity = 21/48 (43.75%), Postives = 30/48 (62.50%), Query Frame = 1
Query:   55 SLYQIMSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKS 198
            +L  + +   N PLPP WE+K D  T   F+V+H  ++TTW+DPR  S
Sbjct:   15 TLSPVEAMATNDPLPPGWEIKIDPQTGWPFFVDHNNRVTTWNDPRHDS 62          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Match: EDO45035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU79])

HSP 1 Score: 51.2174 bits (121), Expect = 2.431e-7
Identity = 16/42 (38.10%), Postives = 29/42 (69.05%), Query Frame = 1
Query:   64 QIMSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPR 189
            Q  ++ ++ PLPP WE ++D    ++++++H T+ TTW DPR
Sbjct:    8 QYQTAWQSQPLPPGWEARYDNNVGRYYFIHHATRTTTWKDPR 49          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000000724.1 (SMESG000000724.1)

HSP 1 Score: 486.878 bits (1252), Expect = 3.696e-175
Identity = 271/271 (100.00%), Postives = 271/271 (100.00%), Query Frame = 1
Query:   70 MSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKEXXXXXXXXXXXXGVSGSKGKLCKGEQTRFSLSEISKYDAPDSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILNDKSKLIQENIKVLEDMKKSKDNFPSFKNFVSRRNNXXXXXXXXXXXXXXXXXIAAGPDPKNYSGSQ 882
            MSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKETSSIISYSTIDSGVSGSKGKLCKGEQTRFSLSEISKYDAPDSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILNDKSKLIQENIKVLEDMKKSKDNFPSFKNFVSRRNNSSEEKVSDEKSKKTKKSIAAGPDPKNYSGSQ
Sbjct:    1 MSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKETSSIISYSTIDSGVSGSKGKLCKGEQTRFSLSEISKYDAPDSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILNDKSKLIQENIKVLEDMKKSKDNFPSFKNFVSRRNNSSEEKVSDEKSKKTKKSIAAGPDPKNYSGSQ 271          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000000724.1 (SMESG000000724.1)

HSP 1 Score: 404.06 bits (1037), Expect = 1.192e-143
Identity = 212/212 (100.00%), Postives = 212/212 (100.00%), Query Frame = 1
Query:   70 MSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKEXXXXXXXXXXXXGVSGSKGKLCKGEQTRFSLSEISKYDAPDSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILNDKSKLIQ 705
            MSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKETSSIISYSTIDSGVSGSKGKLCKGEQTRFSLSEISKYDAPDSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILNDKSKLIQ
Sbjct:    1 MSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKRKETSSIISYSTIDSGVSGSKGKLCKGEQTRFSLSEISKYDAPDSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEESRKILNDKSKLIQ 212          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000000724.1 (SMESG000000724.1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.897e-21
Identity = 59/62 (95.16%), Postives = 60/62 (96.77%), Query Frame = 1
Query:  697 LIQENIKVLEDMKKSKDNFPSFKNFVSRRNNXXXXXXXXXXXXXXXXXIAAGPDPKNYSGSQ 882
              +ENIKVLEDMKKSKDNFPSFKNFVSRRNNSSEEKVSDEKSKKTKKSIAAGPDPKNYSGSQ
Sbjct:    2 FFRENIKVLEDMKKSKDNFPSFKNFVSRRNNSSEEKVSDEKSKKTKKSIAAGPDPKNYSGSQ 63          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000022755.1 (SMESG000022755.1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.378e-9
Identity = 40/114 (35.09%), Postives = 58/114 (50.88%), Query Frame = 1
Query:   94 LPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIGPKDFVGDDADMERIIKMTEKDDQL-ENDLKMICDKYPGFDINYVKELLIKSKGNASTVEVILRQEKR 432
            LP +WE KFD+ +K++FY++H  KITTW DPR +    K  Q         + D     RI     K   + E + K I   Y  F I+ + E+L K+  N S VE  L +E++
Sbjct:   10 LPSNWEQKFDWESKRYFYIDHANKITTWIDPRIEL-YKKDQQQQSTSQVSTIEDPLLAIRIPSTKTKASNVREKEAKEIHKNYSEFSIDKITEMLEKNCNNVSLVESELSRERQ 122          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000031564.1 (SMESG000031564.1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.889e-6
Identity = 20/47 (42.55%), Postives = 30/47 (63.83%), Query Frame = 1
Query:   94 LPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQDDVIG 234
            LPP WE+ +D  T+++F+V+H T  TTW DPR +S    +   D +G
Sbjct:    7 LPPGWEVMWDPNTRQNFFVDHNTHSTTWRDPRTQSRKPNNCDYDELG 53          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WWTR12.435e-860.53WW domain containing transcription regulator 1 [So... [more]
WWTR16.644e-860.53WW domain containing transcription regulator 1 [So... [more]
WWTR16.644e-860.53WW domain containing transcription regulator 1 [So... [more]
WWTR16.644e-860.53WW domain containing transcription regulator 1 [So... [more]
BAG38.522e-739.06BCL2 associated athanogene 3 [Source:HGNC Symbol;A... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bag36.492e-738.46BCL2 associated athanogene 3 [Source:ZFIN;Acc:ZDB-... [more]
wwtr11.228e-652.27WW domain containing transcription regulator 1 [So... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam214a1.020e-660.00family with sequence similarity 214 member A [Sour... [more]
plpp41.519e-660.61phospholipid phosphatase 4 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Wwtr11.130e-760.53WW domain containing transcription regulator 1 [So... [more]
Wwtr11.141e-760.53WW domain containing transcription regulator 1 [So... [more]
Bag31.797e-636.62BCL2-associated athanogene 3 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9GZV5|WWTR1_HUMAN3.191e-760.53WW domain-containing transcription regulator prote... [more]
sp|Q9EPK5|WWTR1_MOUSE7.982e-760.53WW domain-containing transcription regulator prote... [more]
sp|O95817|BAG3_HUMAN4.093e-639.06BAG family molecular chaperone regulator 3 OS=Homo... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QV421.228e-927.96E3 ubiquitin-protein ligase Itchy-like OS=Mizuhope... [more]
A0A1S3HS305.924e-825.47serine/arginine repetitive matrix protein 1 isofor... [more]
A0A267EQ157.932e-860.00WW domain-containing protein OS=Macrostomum lignan... [more]
A0A267G7U88.270e-860.00WW domain-containing protein OS=Macrostomum lignan... [more]
A0A1S3HUV61.267e-725.47serine/arginine repetitive matrix protein 1 isofor... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wwtr15.201e-848.08WW domain containing transcription regulator 1 [So... [more]
bag36.538e-743.75BCL2 associated athanogene 3 [Source:NCBI gene;Acc... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO450352.431e-738.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000724.13.696e-175100.00SMESG000000724.1[more]
SMESG000000724.11.192e-143100.00SMESG000000724.1[more]
SMESG000000724.13.897e-2195.16SMESG000000724.1[more]
SMESG000022755.11.378e-935.09SMESG000022755.1[more]
SMESG000031564.11.889e-642.55SMESG000031564.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025761 ID=SMED30025761|Name=E3 ubiquitin-protein ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=975bp
TAACATCAACTTTCATTAATAAATACATTTGAATAAGGATTGGATTAGAA
TTCATCACTTTATCAAATAATGTCATCAGTGAAAAATCTTCCCCTACCCC
CAGATTGGGAAATGAAATTTGATTTTGCCACCAAAAAACATTTTTATGTT
AATCATAAAACCAAAATAACAACATGGGATGATCCGAGAAAGAAATCAAA
CTCCACTAAATCACCGCAAGATGATGTTATTGGACCGAAAGATTTTGTCG
GAGATGATGCCGACATGGAAAGAATTATAAAAATGACCGAAAAGGACGAT
CAGTTGGAGAACGACTTGAAAATGATTTGCGATAAATATCCAGGATTTGA
CATAAATTATGTTAAAGAACTTCTCATAAAATCAAAAGGTAATGCATCGA
CTGTTGAAGTTATATTGCGGCAGGAAAAACGGAAGGAAACTAGTTCAATT
ATATCATATTCAACCATCGATTCTGGTGTGAGTGGTTCAAAAGGCAAATT
GTGTAAAGGTGAACAGACAAGATTTAGCTTATCAGAAATAAGCAAATATG
ACGCCCCTGATTCGTCGAAATCTCGAACAAAGTCGCAGTTAAGATCAGAA
TTTGCAGATGTGGACAACAGAATTGTCGATCGAGTGCTGGAGGTAACCGA
TTATTCTCTTGAAGAAAGTAGAAAAATATTAAACGATAAAAGTAAATTAA
TTCAAGAAAATATTAAAGTCTTGGAAGATATGAAAAAATCAAAAGATAAC
TTTCCATCTTTCAAAAATTTTGTAAGCCGGCGAAACAACAGTTCCGAAGA
GAAAGTTTCAGATGAAAAGTCGAAAAAAACTAAAAAAAGTATCGCAGCTG
GTCCTGATCCAAAAAATTATTCTGGATCTCAATTAAGCAAGAATAAACTT
AAACTTAAATCTGAAAAATAAAACTGTTTTGATAATACATTTATAATGTT
TATTTTACAACAAATAAATAACAAC
back to top

protein sequence of SMED30025761-orf-1

>SMED30025761-orf-1 ID=SMED30025761-orf-1|Name=SMED30025761-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=284bp
MSSVKNLPLPPDWEMKFDFATKKHFYVNHKTKITTWDDPRKKSNSTKSPQ
DDVIGPKDFVGDDADMERIIKMTEKDDQLENDLKMICDKYPGFDINYVKE
LLIKSKGNASTVEVILRQEKRKETSSIISYSTIDSGVSGSKGKLCKGEQT
RFSLSEISKYDAPDSSKSRTKSQLRSEFADVDNRIVDRVLEVTDYSLEES
RKILNDKSKLIQENIKVLEDMKKSKDNFPSFKNFVSRRNNSSEEKVSDEK
SKKTKKSIAAGPDPKNYSGSQLSKNKLKLKSEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0016874ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036020WW_dom_sf
IPR001202WW_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001202WW domainSMARTSM00456ww_5coord: 8..41
e-value: 7.0E-9
score: 45.5
IPR001202WW domainPFAMPF00397WWcoord: 9..39
e-value: 3.3E-10
score: 39.9
IPR001202WW domainPROSITEPS01159WW_DOMAIN_1coord: 13..39
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 7..41
score: 15.053
IPR001202WW domainCDDcd00201WWcoord: 10..40
e-value: 6.66442E-10
score: 51.3746
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 2..50
e-value: 2.6E-15
score: 57.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 238..259
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..283
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 36..58
NoneNo IPR availablePANTHERPTHR14791BOMB/KIRA PROTEINScoord: 8..53
NoneNo IPR availablePANTHERPTHR14791:SF23coord: 8..53
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 6..41