JUNLI-1

Overview
NameJUNLI-1 (AFD29623.1)
Smed IDSMED30025757
Length (bp)1951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of JUNLI-1 (SMED30025757) t-SNE clustered cells

Violin plots show distribution of expression levels for JUNLI-1 (SMED30025757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of JUNLI-1 (SMED30025757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for JUNLI-1 (SMED30025757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30025757SMESG000067959.1 AFD29623smed_ncbi_20200123PMID:26062938
Tejada-Romero et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30025757SMESG000067959.1 SmedASXL_010977SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025757SMESG000067959.1 SmedASXL_010977SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025757SMESG000067959.1 Contig54337newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025757SMESG000067959.1 Contig54337uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30025757SMESG000067959.1 dd_Smed_v4_4878_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025757SMESG000067959.1 SMED30025757smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30025757SMESG000067959.1 SMED_29372_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025757SMESG000067959.1 SMED_29372_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025757SMESG000067959.1 SMED_21705_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025757SMESG000067959.1 SMED_21705_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025757SMESG000067959.1 SMED30025757smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of JUNLI-1 vs. TrEMBL
Match: H9CXV2 (JUNLI-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 489/490 (99.80%), Postives = 490/490 (100.00%), Query Frame = 2
Query:  161 MTQFLMQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFXXXXXXXXXXXXANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTEXXXXXXXXXXXXARSNPNGQNAHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI 1630
            MTQFLMQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFLLNQINQNIDDNANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTELLSQLNSLTNSTARSNPNGQN+HPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINKLLDKDLDVDQQRRLERKRARNRDAARKCRDRKNNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI
Sbjct:    1 MTQFLMQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFLLNQINQNIDDNANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTELLSQLNSLTNSTARSNPNGQNSHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINKLLDKDLDVDQQRRLERKRARNRDAARKCRDRKNNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI 490          
BLAST of JUNLI-1 vs. TrEMBL
Match: A0A448XAR0 (BZIP domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS25948 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 8.761e-6
Identity = 37/114 (32.46%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  275 RPDSLEIK-IKPDNIVNIISKSELCSDNVNSWT-----GDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKE-------NYQSGCQPTGPSYLGNI 577
            RP SLE++ I    +   + +S +  ++V+ WT         D  + QL   NN  + +TP SF NP+++T++QE FAD  T  L+K+KE       N  S C    P  +G++
Sbjct:   52 RPASLELRNIAFAQVSGSVMRSLISHESVSPWTLKTTESAEFDKLLGQL--GNNGSTTVTPTSFLNPNNITEDQESFADKFTKRLDKLKEEREGWIPNLASECSKVDPVVVGDL 163          
BLAST of JUNLI-1 vs. Planmine SMEST
Match: SMESG000067959.1 (SMESG000067959.1)

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 490/490 (100.00%), Postives = 490/490 (100.00%), Query Frame = 2
Query:  161 MTQFLMQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFXXXXXXXXXXXXANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTEXXXXXXXXXXXXARSNPNGQNAHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI 1630
            MTQFLMQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFLLNQINQNIDDNANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTELLSQLNSLTNSTARSNPNGQNAHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINKLLDKDLDVDQQRRLERKRARNRDAARKCRDRKNNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI
Sbjct:    1 MTQFLMQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFLLNQINQNIDDNANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTELLSQLNSLTNSTARSNPNGQNAHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINKLLDKDLDVDQQRRLERKRARNRDAARKCRDRKNNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI 490          
BLAST of JUNLI-1 vs. Planmine SMEST
Match: SMESG000067959.1 (SMESG000067959.1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 2
Query:  176 MQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFXXXXXXXXXXXXANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTEXXXXXXXXXXXXARSNPNGQNAHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI 1630
            MQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFLLNQINQNIDDNANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTELLSQLNSLTNSTARSNPNGQNAHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINKLLDKDLDVDQQRRLERKRARNRDAARKCRDRKNNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI
Sbjct:    1 MQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPDNIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPSDVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRPLSIATVSVGNKVFLLNQINQNIDDNANQCLNYGVLDLPGNITIHGDVNNINPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAYSHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIPDSSHTELLSQLNSLTNSTARSNPNGQNAHPPIKAPSMELMNQSINETRCLSASSNGNESSFGANDSSVNNSHKDYSSNGTKINKLLDKDLDVDQQRRLERKRARNRDAARKCRDRKNNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRRLTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI 485          
The following BLAST results are available for this feature:
BLAST of JUNLI-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
H9CXV20.000e+099.80JUNLI-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
A0A448XAR08.761e-632.46BZIP domain-containing protein OS=Protopolystoma x... [more]
back to top
BLAST of JUNLI-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JUNLI-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000067959.10.000e+0100.00SMESG000067959.1[more]
SMESG000067959.10.000e+0100.00SMESG000067959.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025757
GenBankAFD29623.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025757 ID=SMED30025757|Name=JUNLI-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1951bp
GAAAAAATTTTTTGAAAACAATTTTTGTTTGTGTCCATCAATTTTCTTTA
TTAGCCATGATGTTACTATTTTTAGAACCTAAAGCCTTCGCTAAAATTTT
AAACAAAGAGGTCTTTGTGTGATTTTTACATCACCTTTTTAATGTGCAGT
TAGTCATTTTATGACTCAATTTTTAATGCAACACAATATTAAAAAAGAAA
AATCGGAATTCGGTATTTTGGCAGCCAATTTAGGATCAAAAAAATATATT
AGTAATAAAGGTTCAAATGCTCTCAGACCCGATTCGCTGGAAATTAAAAT
AAAGCCTGATAATATCGTTAATATAATTTCCAAATCAGAATTATGTTCAG
ATAACGTCAATTCATGGACTGGTGACCATTTAGATAATTTTATTTCCCAA
TTAAAAAATGCTAATAATACACCATCTCCAATAACACCGAATAGTTTTTT
TAATCCATCGGATGTCACACAGGAACAAGAGCAATTTGCTGATACTCTCA
CATTGCATTTAAATAAAATAAAGGAAAATTATCAATCTGGATGTCAGCCA
ACTGGGCCTTCATATTTAGGTAACATTATACAATTATCTAGTGCAAATGA
TGATAGACCGTTGTCGATTGCAACTGTTAGTGTTGGAAATAAAGTGTTTT
TGTTAAATCAGATAAATCAAAATATTGATGATAATGCTAATCAATGCCTT
AACTATGGAGTACTTGATTTACCTGGTAATATAACCATCCATGGAGATGT
CAACAATATCAATCCCAATACCATAATTTTACAAAAGAATGCACCTAATA
TACAACCTCAAATAAAAGTAGCGAATATCCACAATTTTAGTAATCAGGCA
ACTGTAACTAACAGCCAAAACATTATTTGTTCAACACCAAATGTACAATT
TAATGCTTATTCTCATAGAAATGAAAATAATGAATTAACGCATCTCATGC
CAATTGATACCGACGTAGGGTTACCCCAAACAGACATTAATCAACAAGAT
TTAATCCAATCAATGGGTTTTATCAAAACCTCTGAAGGTATTATATATAC
CAGAATTCCAGACTCTTCTCACACTGAACTATTGAGTCAGTTAAATTCTT
TAACAAATTCTACAGCGCGTTCCAATCCAAATGGCCAAAATGCTCATCCT
CCTATTAAAGCGCCAAGCATGGAATTAATGAATCAATCTATAAATGAAAC
TCGTTGTCTATCAGCTAGTAGTAATGGGAATGAGAGTAGTTTCGGTGCTA
ATGACTCTTCTGTTAATAATAGTCATAAAGATTATTCGAGTAACGGAACT
AAAATTAATAAATTATTGGATAAGGATTTGGATGTTGATCAACAGCGTAG
ATTAGAACGGAAACGAGCTAGAAATCGGGATGCTGCGCGTAAATGTAGAG
ATCGGAAAAATAATCTAATATTGAATTTAGAGCAAAAATATGCAAAACAA
ACTGTGGAAAAAGAACTAATACGCGATAAATTATTGAAAAGTCTTGAAGA
AATCCGTCGATTGACAGATTACATCGCTAAGCACGATCCTCATTCCAAAT
TCGCTTGTTTTTCAAATTTCCTAAACGATATAAAAATCCACGAATTAACC
GATACCGATCTAAAAGACCTTAATTTGATCTAAGCTTATCTCACGTTAAA
TATTATGCATTTATATAATTTCGTTTTTTATAGCATGTTTAAATCAGATC
TTGCTTTTTATTGCGCAAATGTAATTTTAGACTATGAAATATTATTAATT
GTCAATTTATTTTTGTAAGAATTTAGAGGTGAGTATTTATCCTATGGACA
AATGTTCTGATATTCGGCAGCATCGTTCAATGGTTGGTAGGTTGGTTTTA
TATTTTGACACGGGCTCTTTTATTTTAATATTTGTGACATATTTTTGTAA
AGTTTTGATAATGTTCTTTTTTTGTAAATATTATGTGGCTCGAAATATAT
A
back to top

protein sequence of SMED30025757-orf-1

>SMED30025757-orf-1 ID=SMED30025757-orf-1|Name=SMED30025757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=491bp
MTQFLMQHNIKKEKSEFGILAANLGSKKYISNKGSNALRPDSLEIKIKPD
NIVNIISKSELCSDNVNSWTGDHLDNFISQLKNANNTPSPITPNSFFNPS
DVTQEQEQFADTLTLHLNKIKENYQSGCQPTGPSYLGNIIQLSSANDDRP
LSIATVSVGNKVFLLNQINQNIDDNANQCLNYGVLDLPGNITIHGDVNNI
NPNTIILQKNAPNIQPQIKVANIHNFSNQATVTNSQNIICSTPNVQFNAY
SHRNENNELTHLMPIDTDVGLPQTDINQQDLIQSMGFIKTSEGIIYTRIP
DSSHTELLSQLNSLTNSTARSNPNGQNAHPPIKAPSMELMNQSINETRCL
SASSNGNESSFGANDSSVNNSHKDYSSNGTKINKLLDKDLDVDQQRRLER
KRARNRDAARKCRDRKNNLILNLEQKYAKQTVEKELIRDKLLKSLEEIRR
LTDYIAKHDPHSKFACFSNFLNDIKIHELTDTDLKDLNLI*
back to top
Aliases
The feature 'JUNLI-1' has the following synonyms
Synonym
JUNLI-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004827bZIP
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 420..440
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 397..458
e-value: 1.7E-7
score: 33.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 350..380
NoneNo IPR availablePANTHERPTHR11462:SF35TRANSCRIPTION FACTOR AP-1coord: 74..427
NoneNo IPR availablePANTHERPTHR11462JUN TRANSCRIPTION FACTOR-RELATEDcoord: 74..427
NoneNo IPR availableCDDcd14686bZIPcoord: 399..449
e-value: 1.50867E-8
score: 48.6957
NoneNo IPR availableSUPERFAMILYSSF57959Leucine zipper domaincoord: 397..451
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 391..457
e-value: 0.0035
score: 24.7
IPR004827Basic-leucine zipper domainPROSITEPS00036BZIP_BASICcoord: 400..415
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 395..458
score: 9.542