Myb/SANT-like DNA-binding domain

Overview
NameMyb/SANT-like DNA-binding domain
Smed IDSMED30025750
Length (bp)1907
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myb/SANT-like DNA-binding domain (SMED30025750) t-SNE clustered cells

Violin plots show distribution of expression levels for Myb/SANT-like DNA-binding domain (SMED30025750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myb/SANT-like DNA-binding domain (SMED30025750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myb/SANT-like DNA-binding domain (SMED30025750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025750SMESG000016880.1 SmedASXL_005044SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025750SMESG000016880.1 SmedASXL_005044SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30025750SMESG000016880.1 dd_Smed_v4_4381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025750SMESG000016880.1 dd_Smed_v4_4381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025750SMESG000016880.1 dd_Smed_v4_4381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025750SMESG000016880.1 dd_Smed_v4_4381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025750SMESG000016880.1 dd_Smed_v4_4381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025750SMESG000016880.1 dd_Smed_v4_4381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025750SMESG000016880.1 dd_Smed_v4_4381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30025750SMESG000016880.1 SmedASXL_005044SmedAsxl_ww_GCZZ01PMID:30282036
Zhu et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30025750SMESG000016880.1 SmedASXL_005044SmedAsxl_ww_GCZZ01PMID:30282036
Zhu et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myb/SANT-like DNA-binding domain vs. TrEMBL
Match: A0A0X3Q4M7 (Myb/SANT-like DNA-binding domain OS=Schistocephalus solidus OX=70667 GN=TR83036 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.851e-20
Identity = 48/91 (52.75%), Postives = 63/91 (69.23%), Query Frame = 1
Query:  346 EKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMV 618
            +KKVHW    V ALLDC+E+ + +F  +  HK+VW AIG EM   G FS EHCYNKWKNLRRD+RL  + N M+  ++RN  I+ RV R++
Sbjct:   92 DKKVHWTTRNVQALLDCVEEHLHEFNVQKKHKAVWQAIGAEMEPLG-FSTEHCYNKWKNLRRDVRLLVN-NPMK--AVRNASILRRVARLI 178          
BLAST of Myb/SANT-like DNA-binding domain vs. TrEMBL
Match: A0A183TBQ8 (Myb/SANT-like DNA-binding domain OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.410e-20
Identity = 48/91 (52.75%), Postives = 63/91 (69.23%), Query Frame = 1
Query:  346 EKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMV 618
            +KKVHW    V ALLDC+E+ + +F  +  HK+VW AIG EM   G FS EHCYNKWKNLRRD+RL  + N M+  ++RN  I+ RV R++
Sbjct:  103 DKKVHWTTRNVQALLDCVEEHLHEFNVQKKHKAVWQAIGAEMEPLG-FSTEHCYNKWKNLRRDVRLLVN-NPMK--AVRNASILRRVARLI 189          
BLAST of Myb/SANT-like DNA-binding domain vs. TrEMBL
Match: A0A3P7ENA6 (Myb-like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13906 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.572e-20
Identity = 48/91 (52.75%), Postives = 63/91 (69.23%), Query Frame = 1
Query:  346 EKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMV 618
            +KKVHW    V ALLDC+E+ + +F  +  HK+VW AIG EM   G FS EHCYNKWKNLRRD+RL  + N M+  ++RN  I+ RV R++
Sbjct:  103 DKKVHWTTRNVQALLDCVEEHLHEFNVQKKHKAVWQAIGAEMEPLG-FSTEHCYNKWKNLRRDVRLLVN-NPMK--AVRNASILRRVARLI 189          
BLAST of Myb/SANT-like DNA-binding domain vs. TrEMBL
Match: A0A3P7LJJ8 (Myb-like domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS7828 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.694e-20
Identity = 48/91 (52.75%), Postives = 63/91 (69.23%), Query Frame = 1
Query:  346 EKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMV 618
            +KKVHW    V ALLDC+E+ + +F  +  HK+VW AIG EM   G FS EHCYNKWKNLRRD+RL  + N M+  ++RN  I+ RV R++
Sbjct:   89 DKKVHWTTRNVQALLDCVEEHLHEFNVQKKHKAVWQAIGAEMEPLG-FSTEHCYNKWKNLRRDVRLLVN-NPMK--AVRNASILRRVARLI 175          
BLAST of Myb/SANT-like DNA-binding domain vs. TrEMBL
Match: A0A183AK02 (Myb-like domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS7287 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.200e-19
Identity = 48/91 (52.75%), Postives = 61/91 (67.03%), Query Frame = 1
Query:  346 EKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMV 618
            EKKVHW+   V  LLDC+EK + +F  +  HK VW  IG EM   G F++EHCYNKWKNLRRD+RL    N  QK ++RN  I+ RV R++
Sbjct:   91 EKKVHWSNQNVQTLLDCVEKHLDEFNIQKKHKQVWQTIGAEMEALG-FTMEHCYNKWKNLRRDVRLL--VNNPQK-AVRNADILRRVARLI 177          
BLAST of Myb/SANT-like DNA-binding domain vs. Planmine SMEST
Match: SMESG000016880.1 (SMESG000016880.1)

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 478/491 (97.35%), Postives = 478/491 (97.35%), Query Frame = 1
Query:  100 MVDEQYSNIENSQRQNIVNSSSCVDNEMDYNDQGIVSNDFNMKLENGMNNYDASTSSPESTSENAFNFNGCKYNSTNDDKNGEKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMVNEIGYEGXXXXXXXXXXPNFDLVANTDNNNKEFWSVYNSLDQDSRLKLENNLCNYQIKPEPNNNTKCEKILQSKPTIQIDQIPNNNNYQKAPTNNENIGNSVIEDSIISLLSDPAVSQAIIMNPKLLEEILPGLDFTALMKKFSEAHPELVHIPXXXXXXXXXXXXRLIDTTNGNCQFPMNANVSIGVSLAXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXKKKLPVTTNLSSVPHLSQHNDMSNSWPHQLYELLHSFRDEESRQMARLDQIVGYVQVMQESTKRRLSTINQLISLAGLLIPQK 1560
            MVDEQYSNIENSQRQNIVNSSSCVDNEMDYNDQGIVSNDFNMKLENGMNNYDASTSSPESTSENAFNFNGCKYNSTNDDKNGEKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMVNEIGYEGSSRKSSSPISPNFDLVANTDNNNKEFWSVYNSLDQDSRLKLENNLCNYQIKPEPNNNTKCEKILQSKPTIQIDQIPNNNNYQKAPTNNENIGNSVIEDSIISLLSDPAVSQAIIMNPKLLEEILPGLDFTALMKKFSEAHPELVHIPNVTSVTATTNSTRLIDTTNGNCQFPMNANVSIGVSLANNSINTNHNNNI            NNNNNNHHHNIINNNSNSNNKKKL VTTNLSSVPHLSQHNDMSNSWPHQLYELLHSFRDEESRQMARLDQIVGYVQVMQESTKRRLSTINQLISLAGLLIPQK
Sbjct:    1 MVDEQYSNIENSQRQNIVNSSSCVDNEMDYNDQGIVSNDFNMKLENGMNNYDASTSSPESTSENAFNFNGCKYNSTNDDKNGEKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMVNEIGYEGSSRKSSSPISPNFDLVANTDNNNKEFWSVYNSLDQDSRLKLENNLCNYQIKPEPNNNTKCEKILQSKPTIQIDQIPNNNNYQKAPTNNENIGNSVIEDSIISLLSDPAVSQAIIMNPKLLEEILPGLDFTALMKKFSEAHPELVHIPNVTSVTATTNSTRLIDTTNGNCQFPMNANVSIGVSLANNSINTNHNNNILNNGTATINNNNNNNNNNHHHNIINNNSNSNNKKKLSVTTNLSSVPHLSQHNDMSNSWPHQLYELLHSFRDEESRQMARLDQIVGYVQVMQESTKRRLSTINQLISLAGLLIPQK 491          
BLAST of Myb/SANT-like DNA-binding domain vs. Planmine SMEST
Match: SMESG000019869.1 (SMESG000019869.1)

HSP 1 Score: 102.834 bits (255), Expect = 1.561e-23
Identity = 58/142 (40.85%), Postives = 81/142 (57.04%), Query Frame = 1
Query:  343 GEKKVHWNPSQVHALLDCIEKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFSSTNAMQKLSIRNTYIMERVQRMVNEIGYEGXXXXXXXXXXPNFDLVA----NTDNNNKEFWSVYNSLDQDSRL 756
             +KKVHWN   V  LLDC+E R+ +F+ KS+HK VW  IGKEM   G FS EHCYNKWKNLRRD+R+++        + +N   + RV+++++ I              PNFD  A    +T + NK      NSL+  ++L
Sbjct:   45 SDKKVHWNCKYVQLLLDCVESRIHEFKNKSIHKKVWDDIGKEMQVYG-FSTEHCYNKWKNLRRDVRMYAIN---PNKATKNQETLNRVKKLISTIC-------------PNFDPTAVYKKSTKSPNKHSEESSNSLEPLTKL 169          

HSP 2 Score: 59.6918 bits (143), Expect = 2.981e-9
Identity = 26/59 (44.07%), Postives = 44/59 (74.58%), Query Frame = 1
Query: 1384 SWPHQLYELLHSFRDEESRQMARLDQIVGYVQVMQESTKRRLSTINQLISLAGLLIPQK 1560
            +WP++LY+LL SFR EE +Q   ++Q++  +  +++S+ RR++TI QL++LA LLI  K
Sbjct:  297 TWPYELYDLLVSFRTEEVKQAHSIEQLIRQINEIRDSSVRRMNTIQQLMNLANLLINSK 355          
The following BLAST results are available for this feature:
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3Q4M73.851e-2052.75Myb/SANT-like DNA-binding domain OS=Schistocephalu... [more]
A0A183TBQ84.410e-2052.75Myb/SANT-like DNA-binding domain OS=Schistocephalu... [more]
A0A3P7ENA64.572e-2052.75Myb-like domain-containing protein OS=Schistocepha... [more]
A0A3P7LJJ85.694e-2052.75Myb-like domain-containing protein OS=Dibothriocep... [more]
A0A183AK024.200e-1952.75Myb-like domain-containing protein OS=Echinostoma ... [more]
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb/SANT-like DNA-binding domain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016880.10.000e+097.35SMESG000016880.1[more]
SMESG000019869.11.561e-2340.85SMESG000019869.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025750 ID=SMED30025750|Name=Myb/SANT-like DNA-binding domain|organism=Schmidtea mediterranea sexual|type=transcript|length=1907bp
CGGCACTATATATTTATCTAAGCATTAATTATAAAACAGTGAAATAAATT
ATATGTGAAAATCGTGTGATTGAGACAAAATATATAGTTTTAATTTAGAA
TGGTGGATGAGCAATATTCAAACATTGAAAATTCACAAAGGCAAAATATT
GTCAATTCTAGTTCTTGCGTCGACAATGAAATGGATTATAATGATCAGGG
AATAGTGTCAAATGATTTTAATATGAAATTGGAAAACGGCATGAATAATT
ATGATGCATCAACTTCTTCCCCAGAATCAACTAGTGAAAATGCTTTTAAT
TTCAATGGCTGCAAATACAACTCTACTAATGATGATAAAAATGGCGAAAA
AAAAGTCCACTGGAATCCATCTCAAGTTCATGCACTTCTCGATTGTATTG
AAAAACGAATGTCAGATTTCCGCAGAAAATCAGTCCATAAATCAGTTTGG
TTAGCAATCGGAAAGGAAATGTCAGAACAGGGTGAATTTTCTGTAGAGCA
TTGCTATAACAAATGGAAAAATCTTCGTCGAGATATTCGACTGTTCAGTA
GTACAAACGCCATGCAAAAACTATCAATTCGTAATACATACATAATGGAG
CGTGTTCAACGAATGGTAAATGAAATTGGTTATGAAGGCTCATCTCGCAA
ATCGAGTTCTCCGATTTCACCGAATTTCGATTTAGTTGCCAACACCGACA
ACAACAACAAAGAGTTCTGGAGTGTTTATAATAGCCTCGATCAGGATTCC
CGTTTGAAATTGGAAAATAATCTGTGCAATTATCAAATCAAACCGGAACC
GAATAATAATACGAAATGCGAAAAAATCCTCCAATCAAAACCGACTATAC
AAATAGATCAAATCCCGAATAATAATAACTATCAGAAAGCCCCGACAAAC
AACGAAAATATCGGAAATTCCGTCATCGAGGACAGCATAATCTCGCTGCT
GTCCGATCCCGCCGTGTCTCAGGCGATTATTATGAATCCGAAATTGCTGG
AGGAAATTCTGCCGGGTTTGGATTTCACGGCGCTGATGAAGAAATTCTCT
GAAGCTCATCCGGAATTGGTTCACATTCCAAATGTCACCTCGGTGACTGC
GACGACAAATTCGACGCGTTTAATCGATACCACAAATGGCAATTGCCAGT
TTCCCATGAATGCGAATGTCTCAATCGGAGTTTCGTTGGCCAATAACTCC
ATAAACACTAATCATAACAATAACATCCTCAACAATGGCACCGCCACAAT
CAATAATAATAACAATAATCACCATCACAATATAATCAACAATAATAGCA
ATAGTAACAATAAAAAAAAACTACCAGTTACCACCAATCTCAGCTCGGTT
CCGCATTTATCTCAACACAACGACATGAGCAATAGCTGGCCTCATCAACT
GTATGAATTGTTGCATAGTTTTCGGGATGAGGAGAGCCGCCAAATGGCGA
GATTGGATCAAATTGTCGGCTATGTCCAGGTGATGCAAGAGTCCACGAAA
CGGCGCTTGAGCACAATCAATCAATTAATTTCACTGGCTGGACTGTTAAT
TCCTCAAAAATAATGCCGATTTCTACGCGGGCGGGTGTTACGTCATCCTT
ACTCGTGGTGTTTCACAAGCTGATTTGATGTCCTATTTTTATATATTATT
CATTTAATAATAGTTATTATTATTAATTTTATTTTTATTCTTGTAAAATA
GTAAAATAATTAATCCTGTGTATTTTGGAATGAGCGTATCCTATTTTGTA
ATGAAATATATATAATATATATATGTACGACAATACCATGATTGCCTTTT
AATGACATGTGCCTGTTTTGACTTTTGTACAGATGGTAATAGTAACGGTA
ATAGTAGTAATGATGTTGTTGTTGTTGTTGTTGTTATTATTATTATTATT
ATTAATA
back to top

protein sequence of SMED30025750-orf-1

>SMED30025750-orf-1 ID=SMED30025750-orf-1|Name=SMED30025750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=488bp
MVDEQYSNIENSQRQNIVNSSSCVDNEMDYNDQGIVSNDFNMKLENGMNN
YDASTSSPESTSENAFNFNGCKYNSTNDDKNGEKKVHWNPSQVHALLDCI
EKRMSDFRRKSVHKSVWLAIGKEMSEQGEFSVEHCYNKWKNLRRDIRLFS
STNAMQKLSIRNTYIMERVQRMVNEIGYEGSSRKSSSPISPNFDLVANTD
NNNKEFWSVYNSLDQDSRLKLENNLCNYQIKPEPNNNTKCEKILQSKPTI
QIDQIPNNNNYQKAPTNNENIGNSVIEDSIISLLSDPAVSQAIIMNPKLL
EEILPGLDFTALMKKFSEAHPELVHIPNVTSVTATTNSTRLIDTTNGNCQ
FPMNANVSIGVSLANNSINTNHNNNILNNGTATINNNNNNHHHNIINNNS
NSNNKKKLPVTTNLSSVPHLSQHNDMSNSWPHQLYELLHSFRDEESRQMA
RLDQIVGYVQVMQESTKRRLSTINQLISLAGLLIPQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012317Poly(ADP-ribose)pol_cat_dom
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13837Myb_DNA-bind_4coord: 86..152
e-value: 1.4E-6
score: 28.6
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 88..148
e-value: 3.1E-5
score: 25.8