Chromosome 1 open reading frame 194

Overview
NameChromosome 1 open reading frame 194
Smed IDSMED30025748
Length (bp)581
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromosome 1 open reading frame 194 (SMED30025748) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromosome 1 open reading frame 194 (SMED30025748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025748

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30025748SMESG000065614.1 Contig709_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Human
Match: C1orf194 (chromosome 1 open reading frame 194 [Source:HGNC Symbol;Acc:HGNC:32331])

HSP 1 Score: 76.6406 bits (187), Expect = 2.162e-17
Identity = 50/139 (35.97%), Postives = 74/139 (53.24%), Query Frame = 2
Query:   74 KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFK---NKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            K PT LAQ ++P++RL  T T+ S RR   Y DP +PKD LD  L   Y+ H   +KN++E  ++  T  +++    +     LT     +  L +      P  +KE++ SI+ +I   H  ATN GYSRK+DG  F 
Sbjct:   20 KNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINP--KKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFS 156          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Human
Match: C1orf194 (chromosome 1 open reading frame 194 [Source:HGNC Symbol;Acc:HGNC:32331])

HSP 1 Score: 77.0258 bits (188), Expect = 2.412e-17
Identity = 50/139 (35.97%), Postives = 74/139 (53.24%), Query Frame = 2
Query:   74 KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNK---LTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            K PT LAQ ++P++RL  T T+ S RR   Y DP +PKD LD  L   Y+ H   +KN++E  ++  T  +++    +     LT     +  L +      P  +KE++ SI+ +I   H  ATN GYSRK+DG  F 
Sbjct:   32 KNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINP--KKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFS 168          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Human
Match: C1orf194 (chromosome 1 open reading frame 194 [Source:HGNC Symbol;Acc:HGNC:32331])

HSP 1 Score: 47.3654 bits (111), Expect = 1.325e-6
Identity = 33/104 (31.73%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  179 VPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNK---LTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            +PKD LD  L   Y+ H   +KN++E  ++  T  +++    +     LT     +  L +      P  +KE++ SI+ +I   H  ATN GYSRK+DG  F 
Sbjct:   28 IPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINP--KKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFS 129          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Zebrafish
Match: si:ch211-163l21.7 (si:ch211-163l21.7 [Source:NCBI gene;Acc:567726])

HSP 1 Score: 80.1073 bits (196), Expect = 8.170e-19
Identity = 50/155 (32.26%), Postives = 77/155 (49.68%), Query Frame = 2
Query:   26 KYKFELTFCYRSSIM---PKQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            +Y+ + T   R  I      +PT LAQN +P+ RL  T T AS+RR   + D   PKD LD+ LK  YD H   ++N+++  +   T+   +G     +L             + +     +K +++SIK +IE  H  +TN GYSRK DG  + 
Sbjct:   12 RYENDFTLTGRKEIQKLSDDKPTHLAQNDEPWRRLHNTTTEASSRRTVFHYDTTTPKDSLDIHLKAAYDHHLGLFQNKSQTVMQMETVGADNGTKKNKELEDSVCDAENKGIKVWVDT---QKASLYSIKGSIESHHTASTNRGYSRKHDGGFYS 163          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Xenopus
Match: naxd (NAD(P)HX dehydratase [Source:Xenbase;Acc:XB-GENE-982726])

HSP 1 Score: 95.5153 bits (236), Expect = 1.450e-24
Identity = 54/131 (41.22%), Postives = 71/131 (54.20%), Query Frame = 2
Query:   89 LAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            L Q  DP+ RL  T TL+S RR   Y DP  P D LD  LK  YD H    K+R E      TL+ESHGRI KN++  +     ++    +  +P  ++ N++SI  AI   H  ATN GYSRK+DG  + 
Sbjct:   35 LPQKEDPWYRLNSTATLSSDRRAVYYYDPEAPSDSLDFTLKSLYDHHNGLLKDRNETLYQPETLTESHGRILKNRVKEIPVSQEEIHSVKQWVSP--QRANMYSINGAIVSHHAAATNRGYSRKQDGGYYS 163          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Mouse
Match: 1700013F07Rik (RIKEN cDNA 1700013F07 gene [Source:MGI Symbol;Acc:MGI:1922754])

HSP 1 Score: 69.707 bits (169), Expect = 7.369e-15
Identity = 47/137 (34.31%), Postives = 67/137 (48.91%), Query Frame = 2
Query:   74 KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRA-PGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            K P  LAQ +DP++RL  T T A++R R  + D  +PKD LD  L   Y+ H   +KN+ E  +   T+ +  G   +            +     IR     +KE++ SI+ +I   H  ATN GYSRK DG  F 
Sbjct:   32 KNPAHLAQQQDPWSRLSSTPT-ATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGECFHAPSAPITSRTTIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFS 167          
BLAST of Chromosome 1 open reading frame 194 vs. UniProt/SwissProt
Match: sp|A8Y5T1|CA194_DANRE (Uncharacterized protein C1orf194 homolog OS=Danio rerio OX=7955 GN=si:ch211-163l21.7 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.168e-18
Identity = 50/155 (32.26%), Postives = 77/155 (49.68%), Query Frame = 2
Query:   26 KYKFELTFCYRSSIM---PKQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            +Y+ + T   R  I      +PT LAQN +P+ RL  T T AS+RR   + D   PKD LD+ LK  YD H   ++N+++  +   T+   +G     +L             + +     +K +++SIK +IE  H  +TN GYSRK DG  + 
Sbjct:   12 RYENDFTLTGRKEIQKLSDDKPTHLAQNDEPWRRLHNTTTEASSRRTVFHYDTTTPKDSLDIHLKAAYDHHLGLFQNKSQTVMQMETVGADNGTKKNKELEDSVCDAENKGIKVWVDT---QKASLYSIKGSIESHHTASTNRGYSRKHDGGFYS 163          
BLAST of Chromosome 1 open reading frame 194 vs. UniProt/SwissProt
Match: sp|Q5T5A4|CA194_HUMAN (Protein C1orf194 OS=Homo sapiens OX=9606 GN=C1orf194 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.158e-16
Identity = 50/139 (35.97%), Postives = 74/139 (53.24%), Query Frame = 2
Query:   74 KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNK---LTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            K PT LAQ ++P++RL  T T+ S RR   Y DP +PKD LD  L   Y+ H   +KN++E  ++  T  +++    +     LT     +  L +      P  +KE++ SI+ +I   H  ATN GYSRK+DG  F 
Sbjct:   32 KNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINP--KKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFS 168          
BLAST of Chromosome 1 open reading frame 194 vs. UniProt/SwissProt
Match: sp|Q9DAD0|CA194_MOUSE (Protein C1orf194 homolog OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.155e-14
Identity = 47/137 (34.31%), Postives = 67/137 (48.91%), Query Frame = 2
Query:   74 KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRA-PGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            K P  LAQ +DP++RL  T T A++R R  + D  +PKD LD  L   Y+ H   +KN+ E  +   T+ +  G   +            +     IR     +KE++ SI+ +I   H  ATN GYSRK DG  F 
Sbjct:   32 KNPAHLAQQQDPWSRLSSTPT-ATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGECFHAPSAPITSRTTIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFS 167          
BLAST of Chromosome 1 open reading frame 194 vs. TrEMBL
Match: A0A1I8GH79 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028779g1 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.260e-29
Identity = 69/137 (50.36%), Postives = 91/137 (66.42%), Query Frame = 2
Query:   77 QPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXX-RAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 484
            +PT LAQ  DP++RL  + TL STR +  Y DP  P D LD +LK EYDQHRD +K +++  +   T  + HGR+ KN++  V++  PKL HPL+  + P  R+E+V SIKNAIEG H QATN GYSRK DG  F +
Sbjct:   33 KPTHLAQQDDPWSRLNLSQTLTSTRHQAFYYDPQAPNDSLDFVLKTEYDQHRDLFKGKSQVLLQTETCYDEHGRVLKNRIRQVQQVPPKLGHPLRQWQQP--RREDVNSIKNAIEGHHTQATNRGYSRKPDGGHFTS 167          
BLAST of Chromosome 1 open reading frame 194 vs. TrEMBL
Match: A0A1I8HAG6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028779g3 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.929e-29
Identity = 69/137 (50.36%), Postives = 91/137 (66.42%), Query Frame = 2
Query:   77 QPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXX-RAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 484
            +PT LAQ  DP++RL  + TL STR +  Y DP  P D LD +LK EYDQHR+ +K + +  +   T S+ HGR+ KN++  V++  PKL HPL+  + P  R+E+V SIKNAIEG H QATN GYSRK DG  F +
Sbjct:   33 KPTHLAQQDDPWSRLNLSQTLTSTRHQAFYYDPQAPNDSLDFVLKTEYDQHRELFKGKNQVLLQTETCSDEHGRVLKNRIRQVQQVPPKLGHPLRQWQQP--RREDVNSIKNAIEGHHTQATNRGYSRKPDGGHFTS 167          
BLAST of Chromosome 1 open reading frame 194 vs. TrEMBL
Match: A0A210R017 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10924 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.071e-26
Identity = 65/136 (47.79%), Postives = 85/136 (62.50%), Query Frame = 2
Query:   74 KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            ++PT LAQN DP+NRL  T TLAS+RR   + DP+ PKD LD ILK +Y+ H+ + K+  E      TL   HGR+ KN+   V   +P L HPL I +   +KE++ SI+NAIE  H   TN GYSRK DG  +C
Sbjct:   36 QKPTHLAQNDDPWNRLNTTCTLASSRREIYHHDPVAPKDSLDFILKSKYNHHQAFLKDHNETLYQPETLGVKHGRVLKNREQEVIVPVPYLNHPLSISS-QKKKESIHSIENAIESPHSAGTNGGYSRKHDGGFYC 170          
BLAST of Chromosome 1 open reading frame 194 vs. TrEMBL
Match: K1Q359 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10028568 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.979e-26
Identity = 67/148 (45.27%), Postives = 88/148 (59.46%), Query Frame = 2
Query:   53 YRSSIMPKQ----PTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 484
            Y SS M +Q    P  LAQ  DP+NRL  T TLAS+RR   ++DP  P+D LD ILK +YD H ++ + + E      T  +SHGR+ KN+   V    P L HPL +     +K+++ SI+NAIEG H Q TN GYSRK DG  F +
Sbjct:   21 YGSSYMEQQAYDKPVHLAQKEDPWNRLNGTCTLASSRREIYHMDPKAPRDSLDFILKSKYDHHDEFLRAKNETLTQPETAGDSHGRVLKNREVEVIVPKPYLNHPLSV-IEQKKKDSIHSIENAIEGHHTQTTNRGYSRKPDGGFFSS 167          
BLAST of Chromosome 1 open reading frame 194 vs. TrEMBL
Match: W4YZ69 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.103e-26
Identity = 59/140 (42.14%), Postives = 81/140 (57.86%), Query Frame = 2
Query:   68 MP-KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLT-GVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            MP  +PT +AQ +DP+ RL  T TLAS+RR   + DP  P+D LD ILK  YD H +  KNR+E  +   TL  +HGRI KN++   V + +        +     +KE++ S+K AIE  H  ATN G+SRK DG  + 
Sbjct:    1 MPYGEPTHIAQTKDPWQRLNSTCTLASSRREVYHHDPKAPRDSLDFILKANYDHHGELLKNRSETLMQPETLGANHGRILKNRVPEKVAEPVSPTGKLTIVSIHTPKKESIHSVKGAIESHHTPATNQGFSRKHDGGFYT 140          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Cavefish
Match: si:ch211-163l21.7 (uncharacterized protein C1orf194 homolog [Source:NCBI gene;Acc:103046376])

HSP 1 Score: 78.9518 bits (193), Expect = 1.892e-18
Identity = 54/160 (33.75%), Postives = 77/160 (48.12%), Query Frame = 2
Query:   26 KYKFELTFC-YRSSIMP--KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAP-----GYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            +Y+ +L F   + S  P  K+PT LAQN +P++RL  T T +S RR   + D   PKD LDL L+  YD H D   N+ +  +   TL +  G+                      + P       +K ++FSI+ +IE  H  ATN GYSRK DG  + 
Sbjct:   12 RYENDLNFTGIKESQKPPFKKPTHLAQNDEPWSRLNDTATFSSMRRSVLHHDEFAPKDSLDLHLRSVYDNHADLLLNKNQTVLQRETLMDRRGK--------------HNESDEPEKEPLRVWVNPQKASIFSIEGSIESPHKAATNRGYSRKHDGGFYS 157          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Cavefish
Match: si:ch211-163l21.7 (uncharacterized protein C1orf194 homolog [Source:NCBI gene;Acc:103046376])

HSP 1 Score: 58.9214 bits (141), Expect = 1.006e-10
Identity = 36/94 (38.30%), Postives = 52/94 (55.32%), Query Frame = 2
Query:   26 KYKFELTFC-YRSSIMP--KQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGR 298
            +Y+ +L F   + S  P  K+PT LAQN +P++RL  T T +S RR   + D   PKD LDL L+  YD H D   N+ +  +   TL +  G+
Sbjct:   12 RYENDLNFTGIKESQKPPFKKPTHLAQNDEPWSRLNDTATFSSMRRSVLHHDEFAPKDSLDLHLRSVYDNHADLLLNKNQTVLQRETLMDRRGK 105          
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Nematostella
Match: EDO45338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT80])

HSP 1 Score: 90.5077 bits (223), Expect = 2.386e-23
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = 2
Query:  110 YNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFC 481
            ++RL+ T TL+S+RR   Y DP  P+D LD ++K  YD H ++ ++ AE  +   T+  + GR+ KN+          +      R+   +KEN+ SI  AIE  H  ATN GYSRK DG  + 
Sbjct:   43 HDRLYQTATLSSSRREVFYFDPQAPQDSLDFVIKSTYDNHNEFLRSAAETLVQPETIGLTQGRVLKNR-PPPPDPEIDMYKLPLTRSTAIKKENINSINGAIESHHSAATNGGYSRKHDGGFYT 165          
BLAST of Chromosome 1 open reading frame 194 vs. Planmine SMEST
Match: SMESG000065614.1 (SMESG000065614.1)

HSP 1 Score: 263.462 bits (672), Expect = 2.921e-91
Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 2
Query:   68 MPKQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 484
            MPKQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVKKKLPKLIHPLKIRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN
Sbjct:    1 MPKQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVKKKLPKLIHPLKIRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 139          
BLAST of Chromosome 1 open reading frame 194 vs. Planmine SMEST
Match: SMESG000069016.1 (SMESG000069016.1)

HSP 1 Score: 151.369 bits (381), Expect = 4.847e-47
Identity = 81/135 (60.00%), Postives = 93/135 (68.89%), Query Frame = 2
Query:   80 PTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 484
            P  L Q +DP+NRL+   TL STR RY Y DPLVPKD LD ILKEEYD HRDWWK RAE+R+   + + SHGRI KN++     K PK  HPL I A    KE++ S+KNAIEGCH Q TNAGYSR  DG IF N
Sbjct:    9 PVILHQEKDPWNRLYNARTLTSTRHRYNYFDPLVPKDSLDFILKEEYDHHRDWWKTRAEERVQIESFTGSHGRIMKNRIRPYNFKSPKTKHPLVI-AESPVKESIHSVKNAIEGCHSQITNAGYSRMPDGGIFTN 142          
BLAST of Chromosome 1 open reading frame 194 vs. Planmine SMEST
Match: SMESG000026490.1 (SMESG000026490.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.233e-21
Identity = 59/137 (43.07%), Postives = 81/137 (59.12%), Query Frame = 2
Query:   77 QPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEEYDQHRDWWKNRAEQRISFNTL-SESHGRIFKNKLTGVXXXXXXXXXXXXXRAPGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN 484
            +PT LAQN DP+NRL +  TL+S R      DPL P D LD  LK  Y+QH + +K++ +      TL  E  GR+ KN+   VK++ P L HPL+I     +KE+ F++K  I   H Q TN G+SRK DG +F +
Sbjct:   33 KPTHLAQNEDPWNRLAYDGTLSSIRHEATQYDPLAPSDNLDFKLKTLYNQHSNLFKDQNQIMWQPETLYPEQCGRVLKNRYKPVKEEKPALNHPLRI-VEASKKESPFNVKCGIPSHHTQETNRGFSRKPDGGVFTS 168          
The following BLAST results are available for this feature:
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C1orf1942.162e-1735.97chromosome 1 open reading frame 194 [Source:HGNC S... [more]
C1orf1942.412e-1735.97chromosome 1 open reading frame 194 [Source:HGNC S... [more]
C1orf1941.325e-631.73chromosome 1 open reading frame 194 [Source:HGNC S... [more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-163l21.78.170e-1932.26si:ch211-163l21.7 [Source:NCBI gene;Acc:567726][more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naxd1.450e-2441.22NAD(P)HX dehydratase [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
1700013F07Rik7.369e-1534.31RIKEN cDNA 1700013F07 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A8Y5T1|CA194_DANRE6.168e-1832.26Uncharacterized protein C1orf194 homolog OS=Danio ... [more]
sp|Q5T5A4|CA194_HUMAN1.158e-1635.97Protein C1orf194 OS=Homo sapiens OX=9606 GN=C1orf1... [more]
sp|Q9DAD0|CA194_MOUSE5.155e-1434.31Protein C1orf194 homolog OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GH792.260e-2950.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HAG62.929e-2950.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210R0171.071e-2647.79Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
K1Q3592.979e-2645.27Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
W4YZ694.103e-2642.14Uncharacterized protein OS=Strongylocentrotus purp... [more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-163l21.71.892e-1833.75uncharacterized protein C1orf194 homolog [Source:N... [more]
si:ch211-163l21.71.006e-1038.30uncharacterized protein C1orf194 homolog [Source:N... [more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453382.386e-2337.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 1 open reading frame 194 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000065614.12.921e-91100.00SMESG000065614.1[more]
SMESG000069016.14.847e-4760.00SMESG000069016.1[more]
SMESG000026490.11.233e-2143.07SMESG000026490.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025748 ID=SMED30025748|Name=Chromosome 1 open reading frame 194|organism=Schmidtea mediterranea sexual|type=transcript|length=581bp
CTCCTGTTTATTATAATTAAATTTGAAATATAAATTTGAATTGACATTTT
GTTATCGCTCATCAATAATGCCAAAACAACCAACAAAATTGGCCCAAAAT
AGAGATCCGTATAATAGACTGTTTTTCACTCATACTCTCGCCTCAACAAG
AAGACGATATGCATATCTTGACCCCCTTGTGCCAAAAGACTGTCTCGATT
TGATACTCAAAGAGGAATATGATCAACATCGGGACTGGTGGAAAAACCGC
GCCGAACAGCGTATTAGCTTTAATACGTTGAGCGAAAGTCACGGAAGAAT
ATTCAAAAATAAATTAACAGGAGTTAAAAAGAAACTCCCGAAACTTATTC
ATCCATTGAAGATAAGAGCACCTGGATACAGAAAAGAAAATGTATTCAGC
ATTAAAAACGCAATAGAAGGATGTCACTTGCAAGCAACAAATGCAGGATA
TTCCAGGAAACGAGACGGCTGCATTTTCTGTAATTAAAATTTATTAACTT
GAACTGTCTTGAAAAAAAGAAATTTGTATTTTAATCGTATAAAAGTAAAG
TGACAGTTTGTTTTACTTGATTAAAAAAAAA
back to top

protein sequence of SMED30025748-orf-1

>SMED30025748-orf-1 ID=SMED30025748-orf-1|Name=SMED30025748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MPKQPTKLAQNRDPYNRLFFTHTLASTRRRYAYLDPLVPKDCLDLILKEE
YDQHRDWWKNRAEQRISFNTLSESHGRIFKNKLTGVKKKLPKLIHPLKIR
APGYRKENVFSIKNAIEGCHLQATNAGYSRKRDGCIFCN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR022179DUF3695
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022179Protein of unknown function DUF3695PFAMPF12494DUF3695coord: 3..97
e-value: 2.1E-22
score: 78.8