60S ribosome subunit biogenesis protein NIP7 homolog

Overview
Name60S ribosome subunit biogenesis protein NIP7 homolog
Smed IDSMED30025739
Length (bp)591
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosome subunit biogenesis protein NIP7 homolog (SMED30025739) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosome subunit biogenesis protein NIP7 homolog (SMED30025739) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosome subunit biogenesis protein NIP7 homolog (SMED30025739) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosome subunit biogenesis protein NIP7 homolog (SMED30025739) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025739

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025739h1SMcG0005523 SmedASXL_005021SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30025739h1SMcG0005523 dd_Smed_v4_8318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Human
Match: NIP7 (nucleolar pre-rRNA processing protein NIP7 [Source:HGNC Symbol;Acc:HGNC:24328])

HSP 1 Score: 169.474 bits (428), Expect = 2.990e-53
Identity = 81/161 (50.31%), Postives = 109/161 (67.70%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            EN++ L++R D  Y F+ HN ++ Y+ EKI   A      +++  G CFGKFT K HK  F+L +T+LDYL+ Y K+KVW+K GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST  CR  DP A VVF+  DIGEY+R+E+ L
Sbjct:   22 ENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Human
Match: NIP7 (nucleolar pre-rRNA processing protein NIP7 [Source:HGNC Symbol;Acc:HGNC:24328])

HSP 1 Score: 93.9745 bits (232), Expect = 2.853e-24
Identity = 57/161 (35.40%), Postives = 76/161 (47.20%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            EN++ L++R D  Y F+ HN ++ Y+ EKI   A      +++  G CFGKFT K HK  F+L +T+LDYL+ Y K                                               GFG AAKST  CR  DP A VVF+  DIGEY+R+E+ L
Sbjct:   22 ENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAK-----------------------------------------------GFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 132          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Human
Match: NIP7 (nucleolar pre-rRNA processing protein NIP7 [Source:HGNC Symbol;Acc:HGNC:24328])

HSP 1 Score: 80.8777 bits (198), Expect = 8.866e-20
Identity = 37/72 (51.39%), Postives = 50/72 (69.44%), Query Frame = 2
Query:  242 KEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFG 457
            K HK  F+L +T+LDYL+ Y K+KVW+K GAE  F  GNHV K  L ++++   QY GVVVY++ D+PL  G
Sbjct:    2 KTHK--FRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLTLG 71          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Human
Match: NIP7 (nucleolar pre-rRNA processing protein NIP7 [Source:HGNC Symbol;Acc:HGNC:24328])

HSP 1 Score: 78.1814 bits (191), Expect = 8.226e-19
Identity = 33/64 (51.56%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  257 QFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPL 448
            +F+L +T+LDYL+ Y K+KVW+K GAE  F  GNHV K  L ++++   QY GVVVY++ D+PL
Sbjct:    3 KFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPL 66          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Human
Match: NIP7 (nucleolar pre-rRNA processing protein NIP7 [Source:HGNC Symbol;Acc:HGNC:24328])

HSP 1 Score: 67.0106 bits (162), Expect = 3.828e-14
Identity = 33/76 (43.42%), Postives = 48/76 (63.16%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCK 307
            EN++ L++R D  Y F+ HN ++ Y+ EKI   A      +++  G CFGKFT K HK  F+L +T+LDYL+ Y K
Sbjct:   22 ENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAK 94          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Celegans
Match: C43E11.9 (60S ribosome subunit biogenesis protein NIP7 homolog [Source:UniProtKB/TrEMBL;Acc:P91154])

HSP 1 Score: 149.058 bits (375), Expect = 1.392e-45
Identity = 71/161 (44.10%), Postives = 102/161 (63.35%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            +N+  LI+R D  Y F+ H +++ Y  E +  QA    R+ +L  G C GKFT  +   +F L IT+LDYL+ Y K KVW+K  AE  F  GN++ K  +++M+D  P +AG+VVY++ D+PLGFG +AK T   + ADP A VV +  D+GEY+RNE  L
Sbjct:   22 DNVSMLIDRNDGDYCFRNHKERVYYCSENLMRQAACIAREPLLSFGTCLGKFTKSK---KFHLQITALDYLAPYAKFKVWLKPNAEQQFLYGNNILKSGIARMTDGTPTHAGIVVYSMTDVPLGFGVSAKGTSDSKRADPTALVVLHQCDLGEYLRNESHL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Fly
Match: CG7006 (gene:FBgn0039233 transcript:FBtr0084704)

HSP 1 Score: 153.295 bits (386), Expect = 3.934e-47
Identity = 75/161 (46.58%), Postives = 104/161 (64.60%), Query Frame = 2
Query:   83 NIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDALL 565
            N++ LI+R D  Y F+ H  ++ Y+ E+I   +  F  K+++  G CFGKF SK +K++F   IT+L YL+ Y ++KVWVK   E  F  GNH+ K  L ++++   QY GVVVY++ DLPLGFG  A+ST  C+TADP   V F+  DIGEYIR ED L 
Sbjct:   23 NVKHLIDRPDGTYCFREHKDRVYYVSERILKLSECFGYKQLVCVGTCFGKF-SKTNKLKFH--ITALYYLAPYAQYKVWVKPSFEQQFLYGNHIPKTGLGRITENAGQYQGVVVYSMNDLPLGFGVLARSTTDCKTADPMTTVCFHQSDIGEYIRAEDTLF 180          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Zebrafish
Match: nip7 (NIP7 nucleolar pre-rRNA processing protein [Source:NCBI gene;Acc:553616])

HSP 1 Score: 166.392 bits (420), Expect = 3.027e-52
Identity = 78/161 (48.45%), Postives = 109/161 (67.70%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ LI+R D  Y F+ HN ++ Y+ EKI   A    R +++  G CFGKFT  +   +F+L IT+LD+L+ Y K KVWVK G+E  F  GNH+ K  L ++++   +Y GV+VY++ D+PLGFG AA++T +CR  DP A VVF+  DIGEYIR+ED L
Sbjct:   22 ENIKLLIDRPDGTYCFRLHNDRVYYMSEKILKLATNVSRDKLVSVGTCFGKFTKTQ---KFRLHITALDFLAPYAKFKVWVKPGSEQSFLYGNHIMKSGLGRITENTDKYQGVLVYSMADVPLGFGVAARTTQECRKVDPMAIVVFHQADIGEYIRSEDTL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Xenopus
Match: srp54 (signal recognition particle 54kDa [Source:Xenbase;Acc:XB-GENE-960992])

HSP 1 Score: 176.407 bits (446), Expect = 4.394e-56
Identity = 87/173 (50.29%), Postives = 119/173 (68.79%), Query Frame = 2
Query:   44 LLLFMINFRN*EENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
             +LF+++F +  ENI+ L++R D  Y F+ HN ++ Y+ E+I   A    R +++  G CFGKFT K HK  F+L +T+LDYL+ Y K+KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST +CR  DP A VVF+  D+GEYIR+ED L
Sbjct:    6 FILFLVHF-SIGENIKLLVDRPDGTYCFRLHNDRVYYVSERILKLATNIARDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQECRKLDPMAIVVFHQADVGEYIRHEDTL 174          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Xenopus
Match: srp54 (signal recognition particle 54kDa [Source:Xenbase;Acc:XB-GENE-960992])

HSP 1 Score: 174.096 bits (440), Expect = 4.965e-55
Identity = 84/161 (52.17%), Postives = 111/161 (68.94%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ HN ++ Y+ E+I   A    R +++  G CFGKFT K HK  F+L +T+LDYL+ Y K+KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST +CR  DP A VVF+  D+GEYIR+ED L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHNDRVYYVSERILKLATNIARDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQECRKLDPMAIVVFHQADVGEYIRHEDTL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Xenopus
Match: srp54 (signal recognition particle 54kDa [Source:Xenbase;Acc:XB-GENE-960992])

HSP 1 Score: 98.2117 bits (243), Expect = 6.824e-26
Identity = 59/161 (36.65%), Postives = 78/161 (48.45%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ HN ++ Y+ E+I   A    R +++  G CFGKFT K HK  F+L +T+LDYL+ Y K                                               GFG AAKST +CR  DP A VVF+  D+GEYIR+ED L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHNDRVYYVSERILKLATNIARDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAK-----------------------------------------------GFGVAAKSTQECRKLDPMAIVVFHQADVGEYIRHEDTL 132          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Mouse
Match: Nip7 (NIP7, nucleolar pre-rRNA processing protein [Source:MGI Symbol;Acc:MGI:1913414])

HSP 1 Score: 166.777 bits (421), Expect = 2.542e-52
Identity = 80/161 (49.69%), Postives = 108/161 (67.08%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            EN++ L++R D  Y F+ HN ++ Y+ E +   A      +++  G CFGKFT K HK  F+L +T+LDYL+ Y K+KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST  CR  DP A VVF+  DIGEY+R+E+ L
Sbjct:   22 ENLQLLVDRPDGTYCFRLHNDRVYYVSEMMLKLAANISGDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Mouse
Match: Nip7 (NIP7, nucleolar pre-rRNA processing protein [Source:MGI Symbol;Acc:MGI:1913414])

HSP 1 Score: 90.8929 bits (224), Expect = 3.631e-23
Identity = 55/161 (34.16%), Postives = 75/161 (46.58%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            EN++ L++R D  Y F+ HN ++ Y+ E +   A      +++  G CFGKFT K HK  F+L +T+LDYL+ Y K                                               GFG AAKST  CR  DP A VVF+  DIGEY+R+E+ L
Sbjct:   22 ENLQLLVDRPDGTYCFRLHNDRVYYVSEMMLKLAANISGDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAK-----------------------------------------------GFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 132          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. UniProt/SwissProt
Match: sp|A4QND5|NIP7_XENTR (60S ribosome subunit biogenesis protein NIP7 homolog OS=Xenopus tropicalis OX=8364 GN=nip7 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 2.630e-54
Identity = 84/161 (52.17%), Postives = 111/161 (68.94%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ HN ++ Y+ E+I   A    R +++  G CFGKFT K HK  F+L +T+LDYL+ Y K+KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST +CR  DP A VVF+  D+GEYIR+ED L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHNDRVYYVSERILKLATNIARDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQECRKLDPMAIVVFHQADVGEYIRHEDTL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. UniProt/SwissProt
Match: sp|Q6DFH9|NIP7_XENLA (60S ribosome subunit biogenesis protein NIP7 homolog OS=Xenopus laevis OX=8355 GN=nip7 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 8.444e-54
Identity = 82/161 (50.93%), Postives = 110/161 (68.32%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ HN ++ Y+ EKI   A    R +++  G CFGKFT  +   +F+L +T+LDYL+ Y K+KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST +CR  DP A VVF+  D+GEYIR+ED L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHNDRVYYVSEKILKLATNIARDKLVSFGTCFGKFTKTQ---KFRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADVPLGFGVAAKSTQECRKLDPMAIVVFHQADVGEYIRHEDTL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. UniProt/SwissProt
Match: sp|Q4T2X8|NIP7_TETNG (60S ribosome subunit biogenesis protein NIP7 homolog OS=Tetraodon nigroviridis OX=99883 GN=nip7 PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.718e-53
Identity = 80/161 (49.69%), Postives = 110/161 (68.32%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ HN ++ Y+ E+I   A    R++++  G CFGKFT      +F+L IT+LD+L+ Y K KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST +CR  DP + VVF+  D+GE+IRNED+L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHNDRVYYMSERILKLATNIARQKLVSVGTCFGKFTKTS---KFRLHITALDFLAPYAKFKVWVKPGAEQSFLYGNHVLKSGLGRITENTAQYQGVVVYSMADVPLGFGVAAKSTQECRRVDPMSIVVFHQADVGEFIRNEDSL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. UniProt/SwissProt
Match: sp|Q56P27|NIP7_PIG (60S ribosome subunit biogenesis protein NIP7 homolog OS=Sus scrofa OX=9823 GN=NIP7 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.005e-53
Identity = 82/161 (50.93%), Postives = 109/161 (67.70%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            EN++ L++R D  Y F+ HN ++ Y+ EKI   A      +++  G CFGKFT K HK  F+L IT+LDYL+ Y K+KVW+K GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST  CR  DP A VVF+  DIGEY+R+E+ L
Sbjct:   22 ENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISGDKLMSLGTCFGKFT-KTHK--FRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. UniProt/SwissProt
Match: sp|Q5R9J1|NIP7_PONAB (60S ribosome subunit biogenesis protein NIP7 homolog OS=Pongo abelii OX=9601 GN=NIP7 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.436e-52
Identity = 81/161 (50.31%), Postives = 109/161 (67.70%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            EN++ L++R D  Y F+ HN ++ Y+ EKI   A      +++  G CFGKFT K HK  F+L +T+LDYL+ Y K+KVW+K GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST  CR  DP A VVF+  DIGEY+R+E+ L
Sbjct:   22 ENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. TrEMBL
Match: F7EC15 (60S ribosome subunit biogenesis protein NIP7 homolog OS=Xenopus tropicalis OX=8364 GN=ift74 PE=3 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 6.899e-53
Identity = 87/173 (50.29%), Postives = 119/173 (68.79%), Query Frame = 2
Query:   44 LLLFMINFRN*EENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
             +LF+++F +  ENI+ L++R D  Y F+ HN ++ Y+ E+I   A    R +++  G CFGKFT K HK  F+L +T+LDYL+ Y K+KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAKST +CR  DP A VVF+  D+GEYIR+ED L
Sbjct:    6 FILFLVHF-SIGENIKLLVDRPDGTYCFRLHNDRVYYVSERILKLATNIARDKLVSLGTCFGKFT-KTHK--FRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQECRKLDPMAIVVFHQADVGEYIRHEDTL 174          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. TrEMBL
Match: A0A4X2LYK7 (60S ribosome subunit biogenesis protein NIP7 homolog OS=Vombatus ursinus OX=29139 GN=NIP7 PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.084e-52
Identity = 83/162 (51.23%), Postives = 111/162 (68.52%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDALL 565
            ENI+ L++R D  Y F+ H  ++ Y+ EKI   AV   R++++  G CFGKFT  +   +F+L IT+LDYL+ Y KHKVWVK GAE  F  GNHV K  L ++++   QY G+VVY++ D+PLGFG AAKST  CR  DP A VVF+  DIGEY+R+ED L+
Sbjct:   22 ENIQLLVDRPDGTYCFRLHKDRVYYVSEKILKLAVNISREKLVSLGTCFGKFTKTQ---KFRLHITALDYLAPYAKHKVWVKPGAEQSFLYGNHVLKSGLGRITENTNQYQGLVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEDTLI 180          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. TrEMBL
Match: H3ACR5 (60S ribosome subunit biogenesis protein NIP7 homolog OS=Latimeria chalumnae OX=7897 GN=NIP7 PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.553e-52
Identity = 84/161 (52.17%), Postives = 110/161 (68.32%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ HN ++ YI EKI   A    R +++  G CFGKFT  +   +F+L IT+LDYL+ Y K+KVWVK GAE  F  GNHV K  L +++D   QY GVVVY++ D+PLGFG AAKST +CR  DP A VVF+  DIGEY+R+E+ L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHNDRVYYISEKILKLATNISRDKLVSLGTCFGKFTKTQ---KFRLHITALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITDNTTQYQGVVVYSMADVPLGFGVAAKSTQECRRVDPMAIVVFHQADIGEYVRHEETL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. TrEMBL
Match: A0A5N5P773 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00217760 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.062e-52
Identity = 84/161 (52.17%), Postives = 112/161 (69.57%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ H+ ++ YI EKI   A +  R +++  G CFGKFT K HK  F+L IT+LD+L+ Y K+KVWVK GAE  F  GNH+ K  L ++++   QY GVVVY++ D+PLGFG AAK+T +CR  DP A VVF+  D+GEYIRNED L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHHDRVYYISEKILKLATSISRDKLVSVGTCFGKFT-KTHK--FRLHITALDFLAPYAKYKVWVKPGAEQSFLYGNHIMKSGLGRITENTAQYQGVVVYSMADVPLGFGVAAKTTQECRKVDPMAIVVFHQADVGEYIRNEDTL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. TrEMBL
Match: F6YGD8 (60S ribosome subunit biogenesis protein NIP7 homolog OS=Monodelphis domestica OX=13616 GN=NIP7 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.041e-52
Identity = 82/162 (50.62%), Postives = 110/162 (67.90%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDALL 565
            ENI+ L++R D  Y F+ H  ++ Y+ EKI   AV   R+ ++  G CFGKFT  +   +F+L IT+LDYL+ Y KHKVWVK GAE  F  GNHV K  L ++++   QY G+VVY++ D+PLGFG AAKST  CR  DP + VVF+  DIGEY+R+ED L+
Sbjct:   22 ENIQLLVDRPDGTYCFRLHKDRVYYVSEKILKLAVNISRENLVSLGTCFGKFTKTQ---KFRLHITALDYLAPYAKHKVWVKPGAEQSFLYGNHVLKSGLGRITENTNQYQGLVVYSMADVPLGFGVAAKSTQDCRKVDPMSIVVFHQADIGEYVRHEDTLI 180          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Cavefish
Match: nip7 (nucleolar pre-rRNA processing protein NIP7 [Source:NCBI gene;Acc:103043299])

HSP 1 Score: 167.548 bits (423), Expect = 5.519e-52
Identity = 78/161 (48.45%), Postives = 109/161 (67.70%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ LI+R D  Y F+ H+ ++ YI EK+   A    R +++  G CFGKFT  +   +F+L IT+LD+L+ Y K+KVWVK GAE  +  GNH+ K  L ++++   QY GVVVY++ D+PLGFG AAK+T +CR  DP + VVF+  D+GEYIR ED L
Sbjct:   82 ENIKLLIDRPDGTYCFRLHHDRVYYISEKMLKMATNISRDKLVSVGTCFGKFTKTQ---KFRLHITALDFLAPYAKYKVWVKPGAEQSYLYGNHIMKSGLGRITENTAQYQGVVVYSMADVPLGFGVAAKNTQECRKVDPMSIVVFHQADVGEYIRCEDTL 239          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Cavefish
Match: nip7 (nucleolar pre-rRNA processing protein NIP7 [Source:NCBI gene;Acc:103043299])

HSP 1 Score: 142.51 bits (358), Expect = 3.428e-43
Identity = 66/134 (49.25%), Postives = 91/134 (67.91%), Query Frame = 2
Query:  161 EKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            EK+   A    R +++  G CFGKFT  +   +F+L IT+LD+L+ Y K+KVWVK GAE  +  GNH+ K  L ++++   QY GVVVY++ D+PLGFG AAK+T +CR  DP + VVF+  D+GEYIR ED L
Sbjct:   20 EKMLKMATNISRDKLVSVGTCFGKFTKTQ---KFRLHITALDFLAPYAKYKVWVKPGAEQSYLYGNHIMKSGLGRITENTAQYQGVVVYSMADVPLGFGVAAKNTQECRKVDPMSIVVFHQADVGEYIRCEDTL 150          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Cavefish
Match: nip7 (nucleolar pre-rRNA processing protein NIP7 [Source:NCBI gene;Acc:103043299])

HSP 1 Score: 119.013 bits (297), Expect = 9.385e-33
Identity = 55/123 (44.72%), Postives = 81/123 (65.85%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPL 448
            ENI+ LI+R D  Y F+ H+ ++ YI EK+   A    R +++  G CFGKFT  +   +F+L IT+LD+L+ Y K+KVWVK GAE  +  GNH+ K  L ++++   QY GVVVY++ D+PL
Sbjct:   82 ENIKLLIDRPDGTYCFRLHHDRVYYISEKMLKMATNISRDKLVSVGTCFGKFTKTQ---KFRLHITALDFLAPYAKYKVWVKPGAEQSYLYGNHIMKSGLGRITENTAQYQGVVVYSMADVPL 201          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Yeast
Match: NIP7 (Nucleolar protein required for 60S ribosome subunit biogenesis; constituent of 66S pre-ribosomal particles; physically interacts with Nop8p and the exosome subunit Rrp43p [Source:SGD;Acc:S000006132])

HSP 1 Score: 141.354 bits (355), Expect = 2.458e-43
Identity = 65/161 (40.37%), Postives = 100/161 (62.11%), Query Frame = 2
Query:   83 NIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDALL 565
            NI  L++ ++  +VF+    ++ Y+ + +A  A +  R  ++  G+C GKFT      +F+L ITSL  L+ + K+K+W+K   E  F  GNHV K  + KMSD++P++AGV+V+ + D+PLGFG +AKST + R   P   V F   DIGEY+R+ED L 
Sbjct:   23 NISFLVDNKELPHVFRLQKDRVYYVPDHVAKLATSVARPNLMSLGICLGKFTKTG---KFRLHITSLTVLAKHAKYKIWIKPNGEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFAMNDVPLGFGVSAKSTSESRNMQPTGIVAFRQADIGEYLRDEDTLF 180          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Nematostella
Match: EDO37509 (60S ribosome subunit biogenesis protein NIP7 homolog [Source:UniProtKB/TrEMBL;Acc:A7SFI9])

HSP 1 Score: 168.318 bits (425), Expect = 2.199e-53
Identity = 79/161 (49.07%), Postives = 106/161 (65.84%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ LI+R D  Y F+ H  ++ Y+ E I  +A    R  ++  G C GKFT  E   +FKL IT+LD+L+ Y K+KVWVK GAE  F  GNHV K  L ++++  PQY GVV+Y++ D PLGFGA A+ST  CR A+P   VVF+  D+GEY+R+ED L
Sbjct:   22 ENIKLLIDRPDGNYCFRLHKDRVYYVSELIMRRATNVARDNLISLGTCLGKFTKSE---KFKLHITALDFLAPYAKYKVWVKPGAEQTFLYGNHVTKSGLGRITENTPQYQGVVIYSMSDSPLGFGATARSTQDCRKANPTDVVVFHQADVGEYLRSEDTL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Medaka
Match: nip7 (nucleolar pre-rRNA processing protein NIP7 [Source:NCBI gene;Acc:101162353])

HSP 1 Score: 169.474 bits (428), Expect = 2.081e-53
Identity = 80/161 (49.69%), Postives = 109/161 (67.70%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ H+ ++ Y+ EKI   A  F R +++  G CFGKFT  +   +F+L IT+LD+L+ Y K KVWVK GAE  F  GNHV K  L ++++   QY GVVVY++ D+PLGFG AAK+T +CR  DP   VVF+  D+GE+IRNED L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHHDRVYYMSEKILKLATNFSRDKLISVGTCFGKFTKTK---KFRLHITALDFLAPYAKFKVWVKPGAEQSFLYGNHVLKSGLGRITENTMQYQGVVVYSMADVPLGFGVAAKTTQECRRVDPLTIVVFHQADVGEFIRNEDTL 179          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Medaka
Match: nip7 (nucleolar pre-rRNA processing protein NIP7 [Source:NCBI gene;Acc:101162353])

HSP 1 Score: 95.1301 bits (235), Expect = 5.163e-25
Identity = 55/161 (34.16%), Postives = 77/161 (47.83%), Query Frame = 2
Query:   80 ENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDAL 562
            ENI+ L++R D  Y F+ H+ ++ Y+ EKI   A  F R +++  G CFGKFT  +   +F+L IT+LD+L+ Y K                                               GFG AAK+T +CR  DP   VVF+  D+GE+IRNED L
Sbjct:   22 ENIKLLVDRPDGTYCFRLHHDRVYYMSEKILKLATNFSRDKLISVGTCFGKFTKTK---KFRLHITALDFLAPYAK-----------------------------------------------GFGVAAKTTQECRRVDPLTIVVFHQADVGEFIRNEDTL 132          
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Planmine SMEST
Match: SMESG000025064.1 (SMESG000025064.1)

HSP 1 Score: 339.732 bits (870), Expect = 7.824e-121
Identity = 163/163 (100.00%), Postives = 163/163 (100.00%), Query Frame = 2
Query:   77 EENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDALL 565
            EENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDALL
Sbjct:   22 EENIEKLINREDDKYVFKYHNKKLLYIREKIANQAVTFDRKEILFCGVCFGKFTSKEHKMQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVPQYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNEDALL 184          
The following BLAST results are available for this feature:
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NIP72.990e-5350.31nucleolar pre-rRNA processing protein NIP7 [Source... [more]
NIP72.853e-2435.40nucleolar pre-rRNA processing protein NIP7 [Source... [more]
NIP78.866e-2051.39nucleolar pre-rRNA processing protein NIP7 [Source... [more]
NIP78.226e-1951.56nucleolar pre-rRNA processing protein NIP7 [Source... [more]
NIP73.828e-1443.42nucleolar pre-rRNA processing protein NIP7 [Source... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C43E11.91.392e-4544.1060S ribosome subunit biogenesis protein NIP7 homol... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG70063.934e-4746.58gene:FBgn0039233 transcript:FBtr0084704[more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nip73.027e-5248.45NIP7 nucleolar pre-rRNA processing protein [Source... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
srp544.394e-5650.29signal recognition particle 54kDa [Source:Xenbase;... [more]
srp544.965e-5552.17signal recognition particle 54kDa [Source:Xenbase;... [more]
srp546.824e-2636.65signal recognition particle 54kDa [Source:Xenbase;... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nip72.542e-5249.69NIP7, nucleolar pre-rRNA processing protein [Sourc... [more]
Nip73.631e-2334.16NIP7, nucleolar pre-rRNA processing protein [Sourc... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4QND5|NIP7_XENTR2.630e-5452.1760S ribosome subunit biogenesis protein NIP7 homol... [more]
sp|Q6DFH9|NIP7_XENLA8.444e-5450.9360S ribosome subunit biogenesis protein NIP7 homol... [more]
sp|Q4T2X8|NIP7_TETNG3.718e-5349.6960S ribosome subunit biogenesis protein NIP7 homol... [more]
sp|Q56P27|NIP7_PIG6.005e-5350.9360S ribosome subunit biogenesis protein NIP7 homol... [more]
sp|Q5R9J1|NIP7_PONAB1.436e-5250.3160S ribosome subunit biogenesis protein NIP7 homol... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F7EC156.899e-5350.2960S ribosome subunit biogenesis protein NIP7 homol... [more]
A0A4X2LYK71.084e-5251.2360S ribosome subunit biogenesis protein NIP7 homol... [more]
H3ACR51.553e-5252.1760S ribosome subunit biogenesis protein NIP7 homol... [more]
A0A5N5P7732.062e-5252.17Uncharacterized protein OS=Pangasianodon hypophtha... [more]
F6YGD85.041e-5250.6260S ribosome subunit biogenesis protein NIP7 homol... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nip75.519e-5248.45nucleolar pre-rRNA processing protein NIP7 [Source... [more]
nip73.428e-4349.25nucleolar pre-rRNA processing protein NIP7 [Source... [more]
nip79.385e-3344.72nucleolar pre-rRNA processing protein NIP7 [Source... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NIP72.458e-4340.37Nucleolar protein required for 60S ribosome subuni... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO375092.199e-5349.0760S ribosome subunit biogenesis protein NIP7 homol... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nip72.081e-5349.69nucleolar pre-rRNA processing protein NIP7 [Source... [more]
nip75.163e-2534.16nucleolar pre-rRNA processing protein NIP7 [Source... [more]
back to top
BLAST of 60S ribosome subunit biogenesis protein NIP7 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025064.17.824e-121100.00SMESG000025064.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025739 ID=SMED30025739|Name=60S ribosome subunit biogenesis protein NIP7 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=591bp
CGATCTCTAATTTTAATCATGCGTGATTTAACTGAAAATGAGCTTGCTGT
TGTTCATGATAAACTTTCGAAATTGAGAAGAAAACATAGAAAAATTAATA
AATCGAGAAGATGATAAATATGTATTTAAGTATCACAACAAGAAGCTTCT
ATATATTCGGGAAAAGATCGCAAATCAAGCGGTTACATTCGATCGTAAAG
AAATTCTATTTTGTGGCGTGTGCTTTGGTAAATTTACATCAAAAGAACAT
AAAATGCAATTCAAGTTGTCTATTACTTCTTTGGATTATTTGTCGGTATA
TTGTAAGCATAAAGTATGGGTTAAAGACGGTGCGGAAGACTTATTCACCC
GAGGCAATCATGTTCGCAAAATGGATCTTAGTAAAATGTCAGACGAAGTT
CCACAATATGCTGGTGTTGTTGTATATAATTTAAAGGACTTGCCACTGGG
ATTTGGAGCTGCAGCTAAATCAACTTTACAGTGCAGAACCGCTGATCCGG
GAGCAAACGTCGTTTTTAATTACGGTGATATAGGTGAATATATCAGAAAT
GAAGATGCATTGTTATAAATAATTAATATATTTAATTGTGC
back to top

protein sequence of SMED30025739-orf-1

>SMED30025739-orf-1 ID=SMED30025739-orf-1|Name=SMED30025739-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MQFKLSITSLDYLSVYCKHKVWVKDGAEDLFTRGNHVRKMDLSKMSDEVP
QYAGVVVYNLKDLPLGFGAAAKSTLQCRTADPGANVVFNYGDIGEYIRNE
DALL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002478PUA
IPR016686Ribosomal_synth_fac_NIP7
IPR015947PUA-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0042255ribosome assembly
GO:0042254ribosome biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus