Stress-induced-phosphoprotein 1

Overview
NameStress-induced-phosphoprotein 1
Smed IDSMED30025738
Length (bp)1777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Stress-induced-phosphoprotein 1 (SMED30025738) t-SNE clustered cells

Violin plots show distribution of expression levels for Stress-induced-phosphoprotein 1 (SMED30025738) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Stress-induced-phosphoprotein 1 (SMED30025738) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Stress-induced-phosphoprotein 1 (SMED30025738) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025738

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30025738SMESG000011539.1 SmedASXL_005595SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30025738SMESG000011539.1 dd_Smed_v4_1986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025738SMESG000011539.1 dd_Smed_v4_1986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025738SMESG000011539.1 dd_Smed_v4_1986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025738SMESG000011539.1 dd_Smed_v4_1986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025738SMESG000011539.1 dd_Smed_v4_1986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025738SMESG000011539.1 dd_Smed_v4_1986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025738SMESG000011539.1 dd_Smed_v6_1986_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Human
Match: STIP1 (stress induced phosphoprotein 1 [Source:HGNC Symbol;Acc:HGNC:11387])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 274/545 (50.28%), Postives = 377/545 (69.17%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL  G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DP+++  +E ++  P  L   LQD +I+  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GN+AYK K+F  A+  Y KA ELD TN T+ TN AAVYFE+ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:   52 NELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAER------KFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 590          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Human
Match: STIP1 (stress induced phosphoprotein 1 [Source:HGNC Symbol;Acc:HGNC:11387])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 274/545 (50.28%), Postives = 377/545 (69.17%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL  G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DP+++  +E ++  P  L   LQD +I+  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GN+AYK K+F  A+  Y KA ELD TN T+ TN AAVYFE+ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAER------KFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Human
Match: STIP1 (stress induced phosphoprotein 1 [Source:HGNC Symbol;Acc:HGNC:11387])

HSP 1 Score: 494.967 bits (1273), Expect = 3.957e-170
Identity = 258/545 (47.34%), Postives = 357/545 (65.50%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL  G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KG                        L  E +N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DP+++  +E ++  P  L   LQD +I+  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GN+AYK K+F  A+  Y KA ELD TN T+ TN AAVYFE+ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKG------------------------LKHEANNPQLKEGLQNMEARLAER------KFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 519          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Human
Match: STIP1 (stress induced phosphoprotein 1 [Source:HGNC Symbol;Acc:HGNC:11387])

HSP 1 Score: 155.992 bits (393), Expect = 3.345e-43
Identity = 81/188 (43.09%), Postives = 118/188 (62.77%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAV--GMD 672
            +ELK +GN AL  G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DP+++  +E ++  P  L   LQD +I+  ++V  G+D
Sbjct:    5 NELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAER------KFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVD 186          

HSP 2 Score: 92.8189 bits (229), Expect = 1.209e-20
Identity = 56/176 (31.82%), Postives = 93/176 (52.84%), Query Frame = 1
Query: 1210 KQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLR--------QSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLM 1713
            K+ GN     G   +A++ YSEAIK +P +  LYSNR+A Y K  ++  A +D  K + L P + KGY RKAA L  +    +A  TY + L+ E N  + +EGL+        + +M   +   + ++   DP  + +LSDP  + ++ Q++  P+     LQ+P++   L  L+
Sbjct:    8 KEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLL 183          

HSP 3 Score: 56.6102 bits (135), Expect = 2.430e-8
Identity = 39/130 (30.00%), Postives = 70/130 (53.85%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL-SEHRIPEIVKKCNEVDRKIKEQEKLAYVNP 1191
            KEKGN+A    N   A+  Y++AI+LD  N   Y+N +A Y ++ +Y+K  +   K+V++    + D+    K YSR   A   LN    AK+ +E+ L  E   P++ +    ++ ++ E++   ++NP
Sbjct:    8 KEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDL----KPDW---GKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERK---FMNP 127          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Human
Match: STIP1 (stress induced phosphoprotein 1 [Source:HGNC Symbol;Acc:HGNC:11387])

HSP 1 Score: 147.517 bits (371), Expect = 2.457e-41
Identity = 68/123 (55.28%), Postives = 97/123 (78.86%), Query Frame = 1
Query: 1324 ACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQN 1680
            ACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  E++++
Sbjct:    1 ACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEYVES 123          

HSP 2 Score: 65.855 bits (159), Expect = 2.591e-12
Identity = 41/129 (31.78%), Postives = 73/129 (56.59%), Query Frame = 1
Query:  238 AAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLE-NHPKTREYLKDPSFKMKMEMMKRDPKLLN 621
            A + K   ++ AL D EECI+L+P + KGY+RKAAALE M  Y +A++ Y+K L    D +S  +   +   R +       M+  +  + P  +K+     P+ ++ + DP+ ++ +E M++DP+ L+
Sbjct:    1 ACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL----DLDSSCKEAADGYQRCM-------MAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALS 118          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Celegans
Match: sti-1 (Stress-induced-phosphoprotein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16259])

HSP 1 Score: 379.022 bits (972), Expect = 4.098e-128
Identity = 184/317 (58.04%), Postives = 243/317 (76.66%), Query Frame = 1
Query:  790 AALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS-EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            AA+ +K+ GN AYK K+F  A   Y KAIELD +N TFY N AAVYFE++++ +C+  C K+VE+GRE RADYKLIAKA SRAGNAF K NDL  A ++F +SLSE R PE+VKK  E+++++K  E+LAY+NP+LA++EK  GN  F+KG YP AM+HY+EA+KR+P++  LYSNRAAC TKLMEF  AL DCD CI+LD KF+KGY+RKAACLVAM++ SKA   Y  AL+V+P+ EEAREG+R    ++ EDPE+ ++R++ DPE+QEIL DP M++IL QM  DP A +EHL+NP++  KL KL + G I +R
Sbjct:    4 AAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRETRADYKLIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKELEKQLKAAERLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLRSNDEDPEKAKERSLADPEVQEILRDPGMRMILEQMSNDPGAVREHLKNPEIFQKLMKLRDAGVIQMR 320          

HSP 2 Score: 95.1301 bits (235), Expect = 3.392e-21
Identity = 62/181 (34.25%), Postives = 93/181 (51.38%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLE-NHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQIL 648
            ++ E KN+GN   + G    A++ YNEA+  D  N +LYSNR+A   K   ++ AL D + CI+L   + KGY RKAA L  M  + +A  AYE  L  +P NE        +RN  ++S D+          DP   K+     P+ +E L+DP  +M +E M  DP  +   L++ +I 
Sbjct:  139 LAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREG---VRN-CLRSNDE----------DPEKAKERSLADPEVQEILRDPGMRMILEQMSNDPGAVREHLKNPEIF 305          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 78.1814 bits (191), Expect = 9.101e-15
Identity = 62/270 (22.96%), Postives = 121/270 (44.81%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQE 1599
            GN   + + F  A+  Y +A+ L   +   + NLA VY+EQ   +  ID   K++++             AY    NA  +   ++ A++ + K+L        S++ +  I ++  +++   +   K   + P+ A     L ++  Q+GK  +A+ HY EAI+  P     YSN      ++ + S A+   ++ IQ++P F   +   A+      + ++A  +Y  AL+++P+  +A   L   +    D     KR  +  +I E
Sbjct:  158 GNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPH-------FPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICDWNDYDKRVRKLVQIVE 420          

HSP 2 Score: 53.5286 bits (127), Expect = 3.763e-7
Identity = 35/118 (29.66%), Postives = 51/118 (43.22%), Query Frame = 1
Query: 1162 EQEKLAY-----VNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            EQ   AY     +NPDL      LGNL    G+  EA   Y +AI+  P     +SN    +    E  +A+   +K + LDP F+  Y+     L   +   +A   Y +AL +  N
Sbjct:   66 EQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGN 183          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Celegans
Match: sgt-1 (Small Glutamine-rich Tetratrico repeat protein [Source:UniProtKB/TrEMBL;Acc:Q21746])

HSP 1 Score: 75.8702 bits (185), Expect = 1.088e-14
Identity = 40/109 (36.70%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNL 438
            +++LK  GN  +++ Q + A++ YN AI ++  + V + NR+AA+C+   Y  A+ D    + L P++SK + R   A    NRY+ A EAY+K L  EP+ ES   NL
Sbjct:  105 ANKLKEEGNDLMKASQFEAAVQKYNAAIKLNR-DPVYFCNRAAAYCRLEQYDLAIQDCRTALALDPSYSKAWGRMGLAYSCQNRYEHAAEAYKKALELEPNQESYKNNL 212          

HSP 2 Score: 69.707 bits (169), Expect = 1.276e-12
Identity = 49/175 (28.00%), Postives = 81/175 (46.29%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPE----------------------IQEILSDPAMQIILGQMQKDPA 1656
            A K K+ GN   +  ++  A++ Y+ AIK N  DP  + NRAA Y +L ++ +A++DC   + LDP + K + R             AA+ Y+KALE+EPN E  +  L+ +    ++ E  R     +P                       +Q ++++P +     QM  DPA
Sbjct:  105 ANKLKEEGNDLMKASQFEAAVQKYNAAIKLN-RDPVYFCNRAAAYCRLEQYDLAIQDCRTALALDPSYSKAWGRMGLAYSCQNRYEHAAEAYKKALELEPNQESYKNNLKIAEDKLKELESSRPAPGANPLAGLLGAMGGGPGGMPAMPGMPNMQNLMNEPGLMQAASQMMSDPA 278          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 77.411 bits (189), Expect = 1.476e-14
Identity = 62/270 (22.96%), Postives = 121/270 (44.81%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQE 1599
            GN   + + F  A+  Y +A+ L   +   + NLA VY+EQ   +  ID   K++++             AY    NA  +   ++ A++ + K+L        S++ +  I ++  +++   +   K   + P+ A     L ++  Q+GK  +A+ HY EAI+  P     YSN      ++ + S A+   ++ IQ++P F   +   A+      + ++A  +Y  AL+++P+  +A   L   +    D     KR  +  +I E
Sbjct:  336 GNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPH-------FPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICDWNDYDKRVRKLVQIVE 598          

HSP 2 Score: 55.4546 bits (132), Expect = 1.212e-7
Identity = 50/225 (22.22%), Postives = 87/225 (38.67%), Query Frame = 1
Query:  826 YKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            ++TKN   ++ +   AI++++     Y+NL   Y E+ + +  ++    +V++  E          AY     A +   DL  A   +  +L                           +NPDL      LGNL    G+  EA   Y +AI+  P     +SN    +    E  +A+   +K + LDP F+  Y+     L   +   +A   Y +AL +  N
Sbjct:  170 FQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPE-------FIDAYINLAAALVSGGDLEQAVTAYFNALQ--------------------------INPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGN 361          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 77.411 bits (189), Expect = 1.476e-14
Identity = 62/270 (22.96%), Postives = 121/270 (44.81%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQE 1599
            GN   + + F  A+  Y +A+ L   +   + NLA VY+EQ   +  ID   K++++             AY    NA  +   ++ A++ + K+L        S++ +  I ++  +++   +   K   + P+ A     L ++  Q+GK  +A+ HY EAI+  P     YSN      ++ + S A+   ++ IQ++P F   +   A+      + ++A  +Y  AL+++P+  +A   L   +    D     KR  +  +I E
Sbjct:  336 GNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPH-------FPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQIICDWNDYDKRVRKLVQIVE 598          

HSP 2 Score: 55.4546 bits (132), Expect = 1.212e-7
Identity = 50/225 (22.22%), Postives = 87/225 (38.67%), Query Frame = 1
Query:  826 YKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            ++TKN   ++ +   AI++++     Y+NL   Y E+ + +  ++    +V++  E          AY     A +   DL  A   +  +L                           +NPDL      LGNL    G+  EA   Y +AI+  P     +SN    +    E  +A+   +K + LDP F+  Y+     L   +   +A   Y +AL +  N
Sbjct:  170 FQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPE-------FIDAYINLAAALVSGGDLEQAVTAYFNALQ--------------------------INPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGN 361          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Fly
Match: Stip1 (gene:FBgn0024352 transcript:FBtr0078131)

HSP 1 Score: 410.994 bits (1055), Expect = 6.255e-138
Identity = 237/546 (43.41%), Postives = 320/546 (58.61%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKME-MMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKA---ALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT-SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL + +  EA+  Y EAI +D  NHVLYSNRS                                  AA     ++ EA+E  EK +   P                   G  R  +  +  ND  F+K  E + +  +Y  DP+  + ++  M+     L+ M     I       MD +P     +          +   +    ++E D+++ +K    A  +KE GN AYK K+F  A+  Y  AIE D T+ TFY N+AAV+FE++EYE+CI QC K +E+GRE+RAD+KLIAK+++R GN + KL +   AK Y+EK++SEHR PEI    +EV+ KIKE+E++AY+NP+ AE+EK+ GNL F+KG Y  A+KHY+EAIKRNPDDPKLYSNRAACYTKL  F + LKDCD CI+LD KF+KGY+RK   L  M+  SKA   Y+KALE++PN  EA EG RQ  M    +P+++ K AM DPEIQ+IL DPAM++IL QMQ DP A KEHLQNP +A K+ KL+E G I I 
Sbjct:    5 NELKEKGNQALSAEKFDEAVAAYTEAIALDDQNHVLYSNRS----------------------------------AAFAKAGKFQEALEDAEKTIQLNP---------------TWPKGYSRKGAAAAGLND--FMKAFEAYNEGLKY--DPTNAILLQGRMETTASALSFMQSQGDI------PMDVDPQQARSRRAPSPPPAKPAEPPKPAEPRVE-DMTEEQKNKYFARKEKELGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEVGRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEHRTPEIKTSLSEVEAKIKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQCSMNFQRNPQEVLKNAMSDPEIQQILKDPAMRMILEQMQSDPNAVKEHLQNPAIADKIMKLLESGIIQIH 490          

HSP 2 Score: 91.2781 bits (225), Expect = 3.459e-19
Identity = 58/182 (31.87%), Postives = 89/182 (48.90%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVI 657
            ++E K +GNL  + G    A+K Y EAI  +  +  LYSNR+A + K   +   L D + CIKL   + KGY RK   L+ M +  +A  AY+K L  +P+N   +                R  S+    N    +K   + P+ ++ LKDP+ +M +E M+ DP  +   LQ+  I D I
Sbjct:  310 AEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGY-------------RQCSMNFQRNPQEVLKNAMSDPEIQQILKDPAMRMILEQMQSDPNAVKEHLQNPAIADKI 478          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Fly
Match: CG43163 (gene:FBgn0262719 transcript:FBtr0305700)

HSP 1 Score: 88.9669 bits (219), Expect = 7.135e-18
Identity = 44/105 (41.90%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  130 RGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHE 444
            + N A QSG    A+  Y +A+ +D GNH+LYSNRSAA  K   +  AL DA +   L P W K Y R+  AL+ + RY EA+ A+   L+ EP N+ ++  L E
Sbjct:   71 QSNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVE 175          

HSP 2 Score: 60.8474 bits (146), Expect = 3.234e-9
Identity = 44/157 (28.03%), Postives = 75/157 (47.77%), Query Frame = 1
Query: 1201 EKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSE-----DPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPA 1656
            EK +Q  N   Q G +  A+  Y++A++ +P +  LYSNR+A   K  +F+ AL+D  +   L P++ K Y R+   L  +    +A   +   L  EP+ ++   GL ++ + S      +P   + R MQ  E   ++S    Q +L   Q   A
Sbjct:   67 EKVRQ-SNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVEASLKSPLRAALEPTLQQLRTMQLQESPFVVSSVVGQELLQATQYSAA 222          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Fly
Match: CG43163 (gene:FBgn0262719 transcript:FBtr0308608)

HSP 1 Score: 88.9669 bits (219), Expect = 7.135e-18
Identity = 44/105 (41.90%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  130 RGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHE 444
            + N A QSG    A+  Y +A+ +D GNH+LYSNRSAA  K   +  AL DA +   L P W K Y R+  AL+ + RY EA+ A+   L+ EP N+ ++  L E
Sbjct:   71 QSNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVE 175          

HSP 2 Score: 60.8474 bits (146), Expect = 3.234e-9
Identity = 44/157 (28.03%), Postives = 75/157 (47.77%), Query Frame = 1
Query: 1201 EKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSE-----DPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPA 1656
            EK +Q  N   Q G +  A+  Y++A++ +P +  LYSNR+A   K  +F+ AL+D  +   L P++ K Y R+   L  +    +A   +   L  EP+ ++   GL ++ + S      +P   + R MQ  E   ++S    Q +L   Q   A
Sbjct:   67 EKVRQ-SNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVEASLKSPLRAALEPTLQQLRTMQLQESPFVVSSVVGQELLQATQYSAA 222          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333486)

HSP 1 Score: 80.1073 bits (196), Expect = 1.425e-15
Identity = 37/87 (42.53%), Postives = 55/87 (63.22%), Query Frame = 1
Query: 1189 PDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKD 1449
            P +AE++K+LGN +++   Y  A+K Y++AI   PD    Y NRAACY  L+ ++ AL D    I++DP F K Y+R A C +A+ D
Sbjct:   16 PRIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGD 102          

HSP 2 Score: 54.6842 bits (130), Expect = 1.746e-7
Identity = 44/152 (28.95%), Postives = 78/152 (51.32%), Query Frame = 1
Query: 1144 VDRKIKEQEKLAYVNPD------LAEKEKQL------GNLEFQKGKYPEAMKHYSEAIK---RNPD-DPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCE------EAREGLRQS 1533
            +D+ I   E+   ++PD      +  K KQL      GN+ F+ G+Y EA   Y++A+K    N D + KL  NRA   T++     A+ DC++ ++L+ +++K  L +A C   ++   ++   Y  AL++E   E      EA+  L++S
Sbjct:  217 LDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKS 368          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Fly
Match: sxc (gene:FBgn0261403 transcript:FBtr0086085)

HSP 1 Score: 79.337 bits (194), Expect = 5.273e-15
Identity = 64/241 (26.56%), Postives = 110/241 (45.64%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            GN   + + F  A+  Y +A+ L   N   + NLA VY+EQ   +  ID   +++E+ + N  D      AY    NA  +   +  A+  +  +L        S + +  I ++   ++   +   K   V PD A     L ++  Q+GK  EA+ HY EAI+  P     YSN      +L + S AL+   + IQ++P F   +   A+      +  +A  +YR AL+++P+  +A
Sbjct:  261 GNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIEL-QPNFPD------AYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDA 494          

HSP 2 Score: 60.8474 bits (146), Expect = 2.946e-9
Identity = 66/277 (23.83%), Postives = 116/277 (41.88%), Query Frame = 1
Query:  703 QNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRI-PEIVK-----KCNEVDRKIKEQEKLAYV-----NPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            QN N+   +   K+N       D+  L    L+  E  +  Y+  ++ +A     +    DSTN      L++++F+ +  +K       ++   ++N     ++A+AYS  GN F +   L  A   + +++   R+ P+ +          V  +  E    AY+     NPDL      LGNL    G+  EA   Y +AI+  P     +SN    +    E  +A+   +K + LDP F+  Y+     L   +   +A   Y +AL + PN
Sbjct:   29 QNPNSTGSNLVVKQN-------DIQSLSSVGLL--ELAHREYQAVDYESAEKHCMQLWRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAI---KQN----PVLAEAYSNLGNVFKERGQLQEALDNYRRAV---RLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPN 286          

HSP 3 Score: 53.9138 bits (128), Expect = 3.708e-7
Identity = 31/103 (30.10%), Postives = 52/103 (50.49%), Query Frame = 1
Query: 1216 LGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGL 1524
            L ++ FQ  +  ++ +  + AIK+NP   + YSN    + +  +   AL +  + ++L P F+ GY+  AA LVA +D   A   Y  AL+  P+    R  L
Sbjct:   90 LSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDL 192          

HSP 4 Score: 50.8322 bits (120), Expect = 3.872e-6
Identity = 32/102 (31.37%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  133 GNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNL 438
            GNL    G+++EA  CY +AI    G  V +SN    F        A+   E+ + L PN+   Y      L+    +D A+ AY + L+  P+N  V  NL
Sbjct:  193 GNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNL 294          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Zebrafish
Match: stip1 (stress-induced phosphoprotein 1 [Source:ZFIN;Acc:ZDB-GENE-041121-17])

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 265/544 (48.71%), Postives = 373/544 (68.57%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSY----MTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +LK++GN AL +G ++EAI+CY EA+T+D  NHVL+SNRSAA+ K   Y  AL DA + IK+KP+W KGYSRKAAALEF+ R ++A   Y++ L  EP N+ +   L  +  R+ +        + + F+ PN  +KLE   +TR  L DPS++  +E ++  P  L   LQD +++  ++V +  +    + + +          K+       E DL + ++ AL +KE GN AYK K+F  A+  Y +AI+ D TN T+ +N AAVYFE+ +++KC + C K++++GRENR DY+ IAKAY+R GN++ K      A ++F KSL+EHR P+++KKC E ++ +KEQEK+AY+NPDLA +EK  GN  FQKG YP AMKHYSEAIKRNP D KL+SNRAACYTKL+EF +ALKDC++CI LD  F+KGY RK A L AMKD SKA D Y+KALE++ N +EA EGL++      M ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  +HL+NP +A K+QKL++ G IAIR
Sbjct:    6 QLKDQGNKALSAGNLEEAIRCYTEALTLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIKIKPDWGKGYSRKAAALEFLGRLEDAKATYQEGLRQEPSNQQLKEGLQNMEARLAEK------KMMNPFSIPNLYEKLEGDSRTRALLSDPSYRELLEQLRNKPSELGTKLQDPRVMTTLSVLLGLDLSGMDEEEEPTPPP-PPKPKETAPPPPKEEDLPENKRMALKEKELGNAAYKKKDFATALKHYEEAIKHDPTNMTYLSNQAAVYFEKGDFDKCRELCEKAIDVGRENREDYRQIAKAYARIGNSYFKQEKYKEAVQFFNKSLTEHRTPDVLKKCQEAEKILKEQEKVAYINPDLALEEKNKGNDAFQKGDYPLAMKHYSEAIKRNPYDAKLFSNRAACYTKLLEFQLALKDCEECINLDSTFIKGYTRKGAALEAMKDFSKAMDVYQKALELDSNSKEATEGLQRCMVSQAMRNDSPEDVKRRAMADPEVQQIMSDPAMRMILEQMQKDPQALSDHLKNPVIAQKIQKLIDVGLIAIR 542          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Zebrafish
Match: stip1 (stress-induced phosphoprotein 1 [Source:ZFIN;Acc:ZDB-GENE-041121-17])

HSP 1 Score: 145.976 bits (367), Expect = 1.240e-40
Identity = 72/164 (43.90%), Postives = 106/164 (64.63%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMK 600
            M  +LK++GN AL +G ++EAI+CY EA+T+D  NHVL+SNRSAA+ K   Y  AL DA + IK+KP+W KGYSRKAAALEF+ R ++A   Y++ L  EP N+ +   L  +  R+ +        + + F+ PN  +KLE   +TR  L DPS++  +E ++
Sbjct:    1 MVSQLKDQGNKALSAGNLEEAIRCYTEALTLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIKIKPDWGKGYSRKAAALEFLGRLEDAKATYQEGLRQEPSNQQLKEGLQNMEARLAEK------KMMNPFSIPNLYEKLEGDSRTRALLSDPSYRELLEQLR 158          

HSP 2 Score: 76.6406 bits (187), Expect = 5.654e-16
Identity = 48/153 (31.37%), Postives = 81/153 (52.94%), Query Frame = 1
Query: 1210 KQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLR--------QSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQ 1644
            K  GN     G   EA++ Y+EA+  +P +  L+SNR+A Y K  ++  ALKD  + I++ P + KGY RKAA L  +     A  TY++ L  EP+ ++ +EGL+        +  M       + ++   D   + +LSDP+ + +L Q++
Sbjct:    6 KDQGNKALSAGNLEEAIRCYTEALTLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIKIKPDWGKGYSRKAAALEFLGRLEDAKATYQEGLRQEPSNQQLKEGLQNMEARLAEKKMMNPFSIPNLYEKLEGDSRTRALLSDPSYRELLEQLR 158          

HSP 3 Score: 48.521 bits (114), Expect = 3.100e-6
Identity = 29/101 (28.71%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSE 1107
            K++GN+A    N   AI  YT+A+ LD +N   ++N +A Y ++ +Y+  +    ++++I    + D+    K YSR   A   L  L  AK  +++ L +
Sbjct:    6 KDQGNKALSAGNLEEAIRCYTEALTLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIKI----KPDW---GKGYSRKAAALEFLGRLEDAKATYQEGLRQ 99          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Zebrafish
Match: sgtb (small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Source:ZFIN;Acc:ZDB-GENE-040704-72])

HSP 1 Score: 90.1225 bits (222), Expect = 2.929e-19
Identity = 49/141 (34.75%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQR----GMSLTSIFNDPNFI 522
            +++LKN GN  ++      A+ CY +AI +D  N V Y NR+AA  K   Y EA+ D E  I + P++SK Y R   AL  M++Y EAI  + K L  +P+N++   NL  +  +  ++        G  + S+ N+P FI
Sbjct:  101 AEQLKNEGNNHMKEENYSSAVDCYTKAIELDQRNAVYYCNRAAAHSKLENYTEAMGDCERAIAIDPSYSKAYGRMGLALTSMSKYPEAISYFNKALVLDPENDTYKSNLKIVEQKQKEASSPTATGLGFDMASLINNPAFI 241          

HSP 2 Score: 63.5438 bits (153), Expect = 1.721e-10
Identity = 37/108 (34.26%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  778 DLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            D+E+A  ++ E GN   K +N+ +A+D YTKAIELD  N  +Y N AA + + + Y + +  C +++ I           +KAY R G A   ++    A  YF K+L
Sbjct:   97 DIERAEQLKNE-GNNHMKEENYSSAVDCYTKAIELDQRNAVYYCNRAAAHSKLENYTEAMGDCERAIAIDPS-------YSKAYGRMGLALTSMSKYPEAISYFNKAL 196          

HSP 3 Score: 63.5438 bits (153), Expect = 1.919e-10
Identity = 35/120 (29.17%), Postives = 65/120 (54.17%), Query Frame = 1
Query: 1177 AYVNPDLAEKEKQL---GNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLR 1527
             + +P+  E+ +QL   GN   ++  Y  A+  Y++AI+ +  +   Y NRAA ++KL  ++ A+ DC++ I +DP + K Y R    L +M    +A   + KAL ++P  +  +  L+
Sbjct:   91 TFPSPEDIERAEQLKNEGNNHMKEENYSSAVDCYTKAIELDQRNAVYYCNRAAAHSKLENYTEAMGDCERAIAIDPSYSKAYGRMGLALTSMSKYPEAISYFNKALVLDPENDTYKSNLK 210          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Zebrafish
Match: sgta (small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-8811])

HSP 1 Score: 86.2705 bits (212), Expect = 5.298e-18
Identity = 48/159 (30.19%), Postives = 84/159 (52.83%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQS-----GDQRGMSLTSIFNDPNFI---KKLENHPKTREYLK 564
            ++ LK  GN  ++      A++ Y++AI ++  N V + NR+AA+ K   Y  A+ D E  I +  N+SK Y R   AL  +N+Y EA+  Y+K L  +PDN++   NL     +V ++     G   G+ L  + ++P F+     L N+P+ ++ + 
Sbjct:   91 AERLKTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIGIDANYSKAYGRMGLALASLNKYSEAVSYYKKALELDPDNDTYKVNLQVAEQKVKETQPSTAGGLGGVDLAGLLSNPGFMNMASNLMNNPQVQQLVS 249          

HSP 2 Score: 78.5666 bits (192), Expect = 1.840e-15
Identity = 45/176 (25.57%), Postives = 89/176 (50.57%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGF 1725
            AE+ K  GN + +   +  A++ YS+AI+ NP +   + NRAA Y+KL  ++ A++DC++ I +D  + K Y R    L ++   S+A   Y+KALE++P+ +  +  L+ +    ++ +      +   ++  +LS+P    +   +          + NPQV   +  +M   +
Sbjct:   91 AERLKTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIGIDANYSKAYGRMGLALASLNKYSEAVSYYKKALELDPDNDTYKVNLQVAEQKVKETQPSTAGGLGGVDLAGLLSNPGFMNMASNL----------MNNPQVQQLVSGMMSGSY 256          

HSP 3 Score: 65.855 bits (159), Expect = 3.273e-11
Identity = 36/99 (36.36%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            K  GN+  K +NF AA++FY+KAI+L+  N  ++ N AA Y +   Y   +  C +++ I     A+Y   +KAY R G A   LN    A  Y++K+L
Sbjct:   95 KTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIGI----DANY---SKAYGRMGLALASLNKYSEAVSYYKKAL 186          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Zebrafish
Match: sgta (small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-8811])

HSP 1 Score: 86.2705 bits (212), Expect = 5.298e-18
Identity = 48/159 (30.19%), Postives = 84/159 (52.83%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQS-----GDQRGMSLTSIFNDPNFI---KKLENHPKTREYLK 564
            ++ LK  GN  ++      A++ Y++AI ++  N V + NR+AA+ K   Y  A+ D E  I +  N+SK Y R   AL  +N+Y EA+  Y+K L  +PDN++   NL     +V ++     G   G+ L  + ++P F+     L N+P+ ++ + 
Sbjct:   91 AERLKTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIGIDANYSKAYGRMGLALASLNKYSEAVSYYKKALELDPDNDTYKVNLQVAEQKVKETQPSTAGGLGGVDLAGLLSNPGFMNMASNLMNNPQVQQLVS 249          

HSP 2 Score: 78.5666 bits (192), Expect = 1.840e-15
Identity = 45/176 (25.57%), Postives = 89/176 (50.57%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGF 1725
            AE+ K  GN + +   +  A++ YS+AI+ NP +   + NRAA Y+KL  ++ A++DC++ I +D  + K Y R    L ++   S+A   Y+KALE++P+ +  +  L+ +    ++ +      +   ++  +LS+P    +   +          + NPQV   +  +M   +
Sbjct:   91 AERLKTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIGIDANYSKAYGRMGLALASLNKYSEAVSYYKKALELDPDNDTYKVNLQVAEQKVKETQPSTAGGLGGVDLAGLLSNPGFMNMASNL----------MNNPQVQQLVSGMMSGSY 256          

HSP 3 Score: 65.855 bits (159), Expect = 3.273e-11
Identity = 36/99 (36.36%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            K  GN+  K +NF AA++FY+KAI+L+  N  ++ N AA Y +   Y   +  C +++ I     A+Y   +KAY R G A   LN    A  Y++K+L
Sbjct:   95 KTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIGI----DANY---SKAYGRMGLALASLNKYSEAVSYYKKAL 186          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Xenopus
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:394990])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 284/546 (52.01%), Postives = 382/546 (69.96%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            ++ LK +GN AL +G + EA+KCY EAI +D  NHVLYSNRSAAF K   + +AL D  + ++LKP+W KGYSRKAAALEF+NR++EA + YE+ L  EP N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DPS+K  +E +K  P  L   LQD +++  ++V +  E  N E + ++         KKE     ME DL + +K A  +KE GNEAYK K+F  A+  Y +A ELD TN T+ TN AAVYFEQ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  +F KSL+EHR PE++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP+D KLYSNRAACYTKL+EF +ALKDC++CI+L+PKF+KGY RKAA L AMKD SKA D Y+KA+E++  C+EA +G ++  M+    ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:   12 ANALKEKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVELKPDWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPANAQLKEGLQNMEARLAER------KFMNPFNSPNLYQKLESDPRTRALLSDPSYKELIEQLKNKPSDLGTKLQDPRVMTTLSVLLGVELGNVEEEEEDTPPPPPPQPKKETKPEPMEEDLPENKKQAQKEKELGNEAYKKKDFETALKHYGQAQELDPTNMTYITNQAAVYFEQGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKNKEAIHFFNKSLAEHRTPEVLKKCQQAEKILKEQERLAYINPDLALEEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRLEPKFIKGYTRKAAALEAMKDYSKAMDVYQKAMELDSTCKEATDGYQRCMMSQYHRNDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 551          

HSP 2 Score: 61.6178 bits (148), Expect = 2.358e-9
Identity = 39/107 (36.45%), Postives = 59/107 (55.14%), Query Frame = 1
Query:  781 LEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            LEK A   KEKGN+A    +   A+  YT+AI+LD  N   Y+N +A + +++E+ K ++   K+VE+    + D+    K YSR   A   LN    AKK +E+ L
Sbjct:    8 LEKKANALKEKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVEL----KPDW---GKGYSRKAAALEFLNRFEEAKKTYEEGL 107          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Xenopus
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:394990])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 284/546 (52.01%), Postives = 382/546 (69.96%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            ++ LK +GN AL +G + EA+KCY EAI +D  NHVLYSNRSAAF K   + +AL D  + ++LKP+W KGYSRKAAALEF+NR++EA + YE+ L  EP N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DPS+K  +E +K  P  L   LQD +++  ++V +  E  N E + ++         KKE     ME DL + +K A  +KE GNEAYK K+F  A+  Y +A ELD TN T+ TN AAVYFEQ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  +F KSL+EHR PE++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP+D KLYSNRAACYTKL+EF +ALKDC++CI+L+PKF+KGY RKAA L AMKD SKA D Y+KA+E++  C+EA +G ++  M+    ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    4 ANALKEKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVELKPDWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPANAQLKEGLQNMEARLAER------KFMNPFNSPNLYQKLESDPRTRALLSDPSYKELIEQLKNKPSDLGTKLQDPRVMTTLSVLLGVELGNVEEEEEDTPPPPPPQPKKETKPEPMEEDLPENKKQAQKEKELGNEAYKKKDFETALKHYGQAQELDPTNMTYITNQAAVYFEQGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKNKEAIHFFNKSLAEHRTPEVLKKCQQAEKILKEQERLAYINPDLALEEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRLEPKFIKGYTRKAAALEAMKDYSKAMDVYQKAMELDSTCKEATDGYQRCMMSQYHRNDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          

HSP 2 Score: 58.9214 bits (141), Expect = 1.646e-8
Identity = 37/104 (35.58%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  790 AALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            AA   KEKGN+A    +   A+  YT+AI+LD  N   Y+N +A + +++E+ K ++   K+VE+    + D+    K YSR   A   LN    AKK +E+ L
Sbjct:    3 AANALKEKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVEL----KPDW---GKGYSRKAAALEFLNRFEEAKKTYEEGL 99          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Xenopus
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:394990])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 284/546 (52.01%), Postives = 382/546 (69.96%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            ++ LK +GN AL +G + EA+KCY EAI +D  NHVLYSNRSAAF K   + +AL D  + ++LKP+W KGYSRKAAALEF+NR++EA + YE+ L  EP N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DPS+K  +E +K  P  L   LQD +++  ++V +  E  N E + ++         KKE     ME DL + +K A  +KE GNEAYK K+F  A+  Y +A ELD TN T+ TN AAVYFEQ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  +F KSL+EHR PE++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP+D KLYSNRAACYTKL+EF +ALKDC++CI+L+PKF+KGY RKAA L AMKD SKA D Y+KA+E++  C+EA +G ++  M+    ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    8 ANALKEKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVELKPDWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPANAQLKEGLQNMEARLAER------KFMNPFNSPNLYQKLESDPRTRALLSDPSYKELIEQLKNKPSDLGTKLQDPRVMTTLSVLLGVELGNVEEEEEDTPPPPPPQPKKETKPEPMEEDLPENKKQAQKEKELGNEAYKKKDFETALKHYGQAQELDPTNMTYITNQAAVYFEQGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKNKEAIHFFNKSLAEHRTPEVLKKCQQAEKILKEQERLAYINPDLALEEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRLEPKFIKGYTRKAAALEAMKDYSKAMDVYQKAMELDSTCKEATDGYQRCMMSQYHRNDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 547          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Xenopus
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:394990])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 282/540 (52.22%), Postives = 378/540 (70.00%), Query Frame = 1
Query:  130 RGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +GN AL +G + EA+KCY EAI +D  NHVLYSNRSAAF K   + +AL D  + ++LKP+W KGYSRKAAALEF+NR++EA + YE+ L  EP N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DPS+K  +E +K  P  L   LQD +++  ++V +  E  N E + ++         KKE     ME DL + +K A  +KE GNEAYK K+F  A+  Y +A ELD TN T+ TN AAVYFEQ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  +F KSL+EHR PE++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP+D KLYSNRAACYTKL+EF +ALKDC++CI+L+PKF+KGY RKAA L AMKD SKA D Y+KA+E++  C+EA +G ++  M+    ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    8 KGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVELKPDWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPANAQLKEGLQNMEARLAER------KFMNPFNSPNLYQKLESDPRTRALLSDPSYKELIEQLKNKPSDLGTKLQDPRVMTTLSVLLGVELGNVEEEEEDTPPPPPPQPKKETKPEPMEEDLPENKKQAQKEKELGNEAYKKKDFETALKHYGQAQELDPTNMTYITNQAAVYFEQGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKNKEAIHFFNKSLAEHRTPEVLKKCQQAEKILKEQERLAYINPDLALEEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRLEPKFIKGYTRKAAALEAMKDYSKAMDVYQKAMELDSTCKEATDGYQRCMMSQYHRNDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 541          

HSP 2 Score: 99.3673 bits (246), Expect = 2.630e-21
Identity = 65/192 (33.85%), Postives = 107/192 (55.73%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFND-PNFIKKLE-NHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQD----QQILDVIAVGMDA 675
            E K++GN + Q G   +A+K Y EAI  +  +  LYSNR+A + K   ++ AL D EECI+L+P + KGY+RKAAALE M  Y +A++ Y+K +  +   +                G QR M      ND P  +K+     P+ ++ + DP+ ++ +E M++DP+ L+  L++    Q+I  ++ VG+ A
Sbjct:  360 EEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRLEPKFIKGYTRKAAALEAMKDYSKAMDVYQKAMELDSTCKEAT------------DGYQRCMMSQYHRNDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIA 539          

HSP 3 Score: 56.9954 bits (136), Expect = 7.301e-8
Identity = 33/101 (32.67%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  799 IQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            + ++KGN+A    +   A+  YT+AI+LD  N   Y+N +A + +++E+ K ++   K+VE+    + D+    K YSR   A   LN    AKK +E+ L
Sbjct:    4 VSQKKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVEL----KPDW---GKGYSRKAAALEFLNRFEEAKKTYEEGL 97          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Xenopus
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:394990])

HSP 1 Score: 529.25 bits (1362), Expect = 0.000e+0
Identity = 276/546 (50.55%), Postives = 370/546 (67.77%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            ++ LK +GN AL +G + EA+KCY EAI +D  NHVLYSNRSAAF K   + +AL D  + ++LKP+W KGYSRKAAALEF+NR++EA + YE+ L  EP N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DPS+K  +E +K  P  L   LQD +++  ++V +  E  N E + ++         KKE     ME DL + +K A  +KE GNEAYK K+F  A+  Y +A ELD TN T+ TN AAVYFEQ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  +F KSL+EHR PE++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP+D KLYSNRAACYTKL+EF +ALK            +KGY RKAA L AMKD SKA D Y+KA+E++  C+EA +G ++  M+    ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    8 ANALKEKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTVELKPDWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPANAQLKEGLQNMEARLAER------KFMNPFNSPNLYQKLESDPRTRALLSDPSYKELIEQLKNKPSDLGTKLQDPRVMTTLSVLLGVELGNVEEEEEDTPPPPPPQPKKETKPEPMEEDLPENKKQAQKEKELGNEAYKKKDFETALKHYGQAQELDPTNMTYITNQAAVYFEQGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKNKEAIHFFNKSLAEHRTPEVLKKCQQAEKILKEQERLAYINPDLALEEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALK----------VRIKGYTRKAAALEAMKDYSKAMDVYQKAMELDSTCKEATDGYQRCMMSQYHRNDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 537          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Mouse
Match: Stip1 (stress-induced phosphoprotein 1 [Source:MGI Symbol;Acc:MGI:109130])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 272/545 (49.91%), Postives = 378/545 (69.36%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL +G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLEN P+TR  L DP+++  +E ++  P  L   LQD +++  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GN+AYK K+F  A+  Y +A ELD TN T+ TN AAV+FE+ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNLQLKEGLQNMEARLAER------KFMNPFNLPNLYQKLENDPRTRSLLSDPTYRELIEQLQNKPSDLGTKLQDPRVMTTLSVLLGVDLGSMDEEEEAATPPPPPPPKKEPKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Mouse
Match: Sgtb (small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Source:MGI Symbol;Acc:MGI:2444615])

HSP 1 Score: 94.3597 bits (233), Expect = 2.725e-21
Identity = 54/157 (34.39%), Postives = 89/157 (56.69%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLH--ELRNRVIQSGDQRGMS--LTSIFNDPNFIK---KLENHPKTREYL 561
            +D+LK+ GN  ++      A+ CY +AI +D  N V Y NR+AA  K + Y +A+ D E+ I +   +SK Y R   AL  MN+++EA+ +Y+K L  +P+N+S   NL   E + R + S    G+S  + S+ N+P FI     L  +P+ ++ +
Sbjct:   42 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFITMAASLMQNPQVQQLM 198          

HSP 2 Score: 76.6406 bits (187), Expect = 3.393e-15
Identity = 50/167 (29.94%), Postives = 85/167 (50.90%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEP-------NCEEAREGLRQ--------------SYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILG 1635
            A++ K  GN   ++  Y  A+  Y++AI+ +P++   Y NRAA  +KL  ++ A+KDC+K I +D K+ K Y R    L AM    +A  +Y+KAL+++P       N + A + LR+              S + +     M    MQ+P++Q+++S      I G
Sbjct:   42 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFITMAASLMQNPQVQQLMSGMMTNAIGG 208          

HSP 3 Score: 60.8474 bits (146), Expect = 6.434e-10
Identity = 35/99 (35.35%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            K++GN   K +N+ AA+D YT+AIELD  N  +Y N AA   +   Y   I  C K++ I  +        +KAY R G A   +N    A   ++K+L
Sbjct:   46 KDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSK-------YSKAYGRMGLALTAMNKFEEAVTSYQKAL 137          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Mouse
Match: Sgtb (small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Source:MGI Symbol;Acc:MGI:2444615])

HSP 1 Score: 95.5153 bits (236), Expect = 3.321e-21
Identity = 54/157 (34.39%), Postives = 89/157 (56.69%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLH--ELRNRVIQSGDQRGMS--LTSIFNDPNFIK---KLENHPKTREYL 561
            +D+LK+ GN  ++      A+ CY +AI +D  N V Y NR+AA  K + Y +A+ D E+ I +   +SK Y R   AL  MN+++EA+ +Y+K L  +P+N+S   NL   E + R + S    G+S  + S+ N+P FI     L  +P+ ++ +
Sbjct:   85 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFITMAASLMQNPQVQQLM 241          

HSP 2 Score: 76.2554 bits (186), Expect = 1.178e-14
Identity = 53/175 (30.29%), Postives = 88/175 (50.29%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEP-------NCEEAREGLRQ--------------SYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAA 1659
            A++ K  GN   ++  Y  A+  Y++AI+ +P++   Y NRAA  +KL  ++ A+KDC+K I +D K+ K Y R    L AM    +A  +Y+KAL+++P       N + A + LR+              S + +     M    MQ+P++Q+++S      I G     PAA
Sbjct:   85 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFITMAASLMQNPQVQQLMSGMMTNAIGG-----PAA 254          

HSP 3 Score: 61.2326 bits (147), Expect = 1.103e-9
Identity = 35/99 (35.35%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            K++GN   K +N+ AA+D YT+AIELD  N  +Y N AA   +   Y   I  C K++ I  +        +KAY R G A   +N    A   ++K+L
Sbjct:   89 KDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSK-------YSKAYGRMGLALTAMNKFEEAVTSYQKAL 180          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Mouse
Match: Rpap3 (RNA polymerase II associated protein 3 [Source:MGI Symbol;Acc:MGI:1277218])

HSP 1 Score: 95.5153 bits (236), Expect = 4.405e-20
Identity = 74/265 (27.92%), Postives = 121/265 (45.66%), Query Frame = 1
Query:  793 ALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKE------------------QEKLAYVNPDLAEK-------EKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            AL+ KEKGN+ +K   +  AI+ YTK ++ D  N    TN A+ YF  +++      CN ++ + R          KAY+R G A   L  L  A+K +EK L     P+  +  NE+ RKI +                  +       P   ++       EK LGN  F++GKY +A++ Y+  I  +  +  L +NRA  Y K+  +  A +DC + I LD  + K + R+      +   ++A   +   L +EP  ++A
Sbjct:  134 ALVLKEKGNKYFKQGKYDEAIECYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAIALSR-------TYTKAYARRGAARFALQKLEDARKDYEKVLELE--PDNFEATNEL-RKINQALTSKENSGPGAAAAAESKPAAGESKPTGGQQGRQKAIAEKDLGNGFFKEGKYEQAIECYTRGIAADRTNALLPANRAMAYLKIQRYEEAERDCTQAIVLDGSYSKAFARRGTARTFLGKINEAKQDFETVLLLEPGNKQA 388          

HSP 2 Score: 79.337 bits (194), Expect = 5.901e-15
Identity = 43/141 (30.50%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  124 KNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPK 546
            K+ GN   + G+ ++AI+CY   I  D  N +L +NR+ A+ K   Y+EA  D  + I L  ++SK ++R+  A  F+ + +EA + +E VL  EP N+     L  ++  +I+ G    + L S     + +K ++N P+
Sbjct:  288 KDLGNGFFKEGKYEQAIECYTRGIAADRTNALLPANRAMAYLKIQRYEEAERDCTQAIVLDGSYSKAFARRGTARTFLGKINEAKQDFETVLLLEPGNKQAATELSRIKKELIEKGHWDDVFLDST-QRHHVVKAVDNPPR 427          

HSP 3 Score: 75.485 bits (184), Expect = 8.546e-14
Identity = 40/107 (37.38%), Postives = 64/107 (59.81%), Query Frame = 1
Query: 1210 KQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQ 1530
            K+ GN  F++GKY EA++ Y++ +  +P +P L +NRA+ Y +L +F++A  DC+  I L   + K Y R+ A   A++    A   Y K LE+EP+  EA   LR+
Sbjct:  138 KEKGNKYFKQGKYDEAIECYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAIALSRTYTKAYARRGAARFALQKLEDARKDYEKVLELEPDNFEATNELRK 244          

HSP 4 Score: 68.9366 bits (167), Expect = 9.218e-12
Identity = 40/121 (33.06%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  121 LKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRG 483
            LK +GN   + G+  EAI+CY + +  D  N VL +NR++A+ +   +  A  D    I L   ++K Y+R+ AA   + + ++A + YEKVL  EPDN      L ++ N+ + S +  G
Sbjct:  137 LKEKGNKYFKQGKYDEAIECYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAIALSRTYTKAYARRGAARFALQKLEDARKDYEKVLELEPDNFEATNELRKI-NQALTSKENSG 256          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Mouse
Match: Sgta (small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:MGI Symbol;Acc:MGI:1098703])

HSP 1 Score: 87.8113 bits (216), Expect = 1.876e-18
Identity = 48/157 (30.57%), Postives = 82/157 (52.23%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLH----ELRNRVIQSGDQRGMSLTSIFNDPNFI---KKLENHPKTREYL 561
            ++ LK  GN  ++    + A+  Y +AI ++  N V + NR+AA+ K   Y  A+ D E  I + P +SK Y R   AL  +N++ EA+  Y+K L  +PDN++   NL     +LR     +G    + +  + N+P+FI     L N P+ ++ +
Sbjct:   91 AERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVAYYKKALELDPDNDTYKSNLKIAELKLREAPSPTGGVGSLDIAGLLNNPHFITMASSLMNSPQLQQLM 247          

HSP 2 Score: 70.8626 bits (172), Expect = 6.623e-13
Identity = 36/110 (32.73%), Postives = 64/110 (58.18%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLR 1527
            AE+ K  GN + +   +  A+  Y +AI+ NP +   + NRAA Y+KL  +  A++DC++ I +DP + K Y R    L ++   ++A   Y+KALE++P+ +  +  L+
Sbjct:   91 AERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVAYYKKALELDPDNDTYKSNLK 200          

HSP 3 Score: 62.3882 bits (150), Expect = 4.722e-10
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            K +GNE  K +NF AA+  Y KAIEL+  N  ++ N AA Y +   Y   +  C +++ I       Y   +KAY R G A   LN    A  Y++K+L
Sbjct:   95 KTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGI----DPGY---SKAYGRMGLALSSLNKHAEAVAYYKKAL 186          
BLAST of Stress-induced-phosphoprotein 1 vs. UniProt/SwissProt
Match: sp|O54981|STIP1_CRIGR (Stress-induced-phosphoprotein 1 OS=Cricetulus griseus OX=10029 GN=STIP1 PE=2 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 274/545 (50.28%), Postives = 379/545 (69.54%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL +G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLEN P+TR  L DP+++  +E ++  P  L   +QD +I+  ++V +  +  + + + +         +KKE     ME DL + +K AL +KE GNEAYK K+F  A+  Y +A ELD TN T+ TN AAV+FE+ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KALE++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNLQLKEGLQNMEARLAER------KFMNPFNLPNLYQKLENDPRTRTLLSDPTYRELIEQLRNKPSDLGTKIQDPRIMTTLSVLLGVDLGSMDEEEEAATPPPPPPSKKEAKPEPMEEDLPENKKQALKEKEMGNEAYKKKDFDMALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEERYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALELDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. UniProt/SwissProt
Match: sp|P31948|STIP1_HUMAN (Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 274/545 (50.28%), Postives = 377/545 (69.17%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL  G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DP+++  +E ++  P  L   LQD +I+  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GN+AYK K+F  A+  Y KA ELD TN T+ TN AAVYFE+ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAER------KFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. UniProt/SwissProt
Match: sp|Q3ZBZ8|STIP1_BOVIN (Stress-induced-phosphoprotein 1 OS=Bos taurus OX=9913 GN=STIP1 PE=2 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 273/545 (50.09%), Postives = 379/545 (69.54%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL +G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA + YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLE+ P+T+  L DP+++  +E ++  P  L   LQD +I+  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GNEAYK K+F  A+  Y KA +LD TN T+ TN AAVYFE+ +Y +C + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ NC+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKQTYEEGLKHEANNPQLKEGLQNMEARLAER------KFMNPFNMPNLYQKLESDPRTKTLLADPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEVATPPPPPPPKKETKPEPMEEDLPENKKQALREKELGNEAYKKKDFDTALKHYDKAKDLDPTNMTYITNQAAVYFEKGDYGQCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSNCKEAADGYQRCVMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. UniProt/SwissProt
Match: sp|O35814|STIP1_RAT (Stress-induced-phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Stip1 PE=1 SV=1)

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 273/545 (50.09%), Postives = 378/545 (69.36%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL +G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + + LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLEN P+TR  L DP+++  +E ++  P  L   LQD +++  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GN+AYK K+F  A+  Y KA ELD TN T+ TN AAV+FE+ +Y KC + C K++E+GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ +C+EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNLQLKEGLQNMEARLAER------KFMNPFNLPNLYQKLENDPRTRTLLSDPTYRELIEQLQNKPSDLGTKLQDPRVMTTLSVLLGVDLGSMDEEEEAATPPPPPPPKKEAKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDKALKHYDKAKELDPTNMTYITNQAAVHFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEERYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. UniProt/SwissProt
Match: sp|Q4R8N7|STIP1_MACFA (Stress-induced-phosphoprotein 1 OS=Macaca fascicularis OX=9541 GN=STIP1 PE=2 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 272/545 (49.91%), Postives = 378/545 (69.36%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTS----EDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL +G I +A++CY+EAI +D  NHVLYSNRSAA+ K   Y++A  D  + ++LKP+W KGYSRKAAALEF+NR++EA   YE+ L  E +N  +   L  +  R+ +          + FN PN  +KLE+ P+TR  L DP+++  +E ++  P  L   LQD +I+  ++V +  +  + + + +          KKE     ME DL + +K AL +KE GN+AYK K+F  A+  Y KA ELD TN T+ TN AAVYFE+ +Y KC + C K++++GRENR DY+ IAKAY+R GN++ K      A  ++ KSL+EHR P+++KKC + ++ +KEQE+LAY+NPDLA +EK  GN  FQKG YP+AMKHY+EAIKRNP D KLYSNRAACYTKL+EF +ALKDC++CIQL+P F+KGY RKAA L AMKD +KA D Y+KAL+++ + +EA +G ++  M      + PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  EHL+NP +A K+QKLM+ G IAIR
Sbjct:    5 NELKEKGNKALSAGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVELKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAER------KFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEVATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIDVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSRKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. TrEMBL
Match: A0A1I8J5G9 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 293/550 (53.27%), Postives = 399/550 (72.55%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQIL----DVIAVGMDAEPDNFEIKPQNENNECDSS-------NKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGF 1725
            M+DELKN+GN AL +G I EAI CY EAI +D  NHVL+SNRSAA+CKA  Y EAL DA+EC+KL PNW+KGY+RK AALEF+ R+DEA+  YE  L  EP+N  +      + N   Q+G++   +  + F DP  + +++  PK R YL DP F++K++MM++DP  L   +QD +++    +++ V +D   +      Q++  E D++        ++   ++  +  L++ EK A   KE+GN AYK K F  AI+ Y +A+EL  TN + YTN AAV FEQQ YE CI +C K +EIGREN AD+KLIAKA +R  NA++KL +L  AK+YF+KSLSEHR P+++K+  E++R++K+ E+ AY+NP+LAE+EK  GN +F  GK+P+A++HYSEAI+RNPDDP+LYSNRAACYTKLMEF+MALKDCD CI+ DPKF+KGYLRK ACL+AMK++ KAA+ YRKALE++ NC+EA+EG  Q+ + + D EQ R+ A+ DPE+Q+ILSDPAMQ+ILGQMQKDP A  EHLQNPQV  KLQKL++ G 
Sbjct:    1 MADELKNKGNSALSAGNIDEAISCYTEAIKLDPSNHVLFSNRSAAYCKAERYTEALADADECVKLAPNWTKGYTRKGAALEFLGRFDEAVGVYEDALQKEPNNAQLK---AAMENAYSQAGNK---AFFNPFADPKLMDRIQKSPKLRSYLSDPDFRLKLQMMQQDPSKLGQFIQDPRVMACVSELLGVNLDDAMNGAGGDAQDDKMETDAAASPPPPPKEEPKPSASADQSLTEEEKKANALKEQGNSAYKAKQFDQAIELYKQAMELAPTNVSLYTNTAAVRFEQQRYEDCIAECQKGIEIGRENNADFKLIAKALARIANAYVKLGNLREAKRYFDKSLSEHRAPDVIKRAQEIERQLKQLEEQAYINPELAEEEKAKGNEQFSNGKFPDAIRHYSEAIRRNPDDPRLYSNRAACYTKLMEFNMALKDCDTCIKKDPKFIKGYLRKGACLMAMKENVKAAEAYRKALEIDENCQEAKEGYMQAELGTND-EQRRQAALNDPEVQDILSDPAMQMILGQMQKDPKAVAEHLQNPQVRTKLQKLIDAGI 543          
BLAST of Stress-induced-phosphoprotein 1 vs. TrEMBL
Match: A0A1I8GAJ9 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 293/550 (53.27%), Postives = 398/550 (72.36%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQIL----DVIAVGMDAEPDNFEIKPQNENNECDSS-------NKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGF 1725
            M+DELKN+GN AL +G I EAI CY EAI +D  NHVL+SNRSAA+CKA  Y EAL DA+EC+KL PNW+KGY+RK AALEF+ R+DEA+  YE  L  EP+N  +      + N   Q+G++   +  + F DP  + +++  PK R YL DP F++K++MM++DP  L   +QD +++    +++ V +D   +      Q++  E D++        ++   ++  +  L++ EK A   KE+GN AYK K F  AI+ Y +A+EL  TN + YTN AAV FEQQ YE CI +C K +EIGREN AD+KLIAKA +R  NA +KL +L  AK+YF+KSLSEHR P+++K+  E++R++K+ E+ AY+NP+LAE+EK  GN +F  GK+P+A++HYSEAI+RNPDDP+LYSNRAACYTKLMEF+MALKDCD CI+ DPKF+KGYLRK ACL+AMK++ KAA+ YRKALE++ NC+EA+EG  Q+ + + D EQ R+ A+ DPE+Q+ILSDPAMQ+ILGQMQKDP A  EHLQNPQV  KLQKL++ G 
Sbjct:    1 MADELKNKGNSALSAGNIDEAISCYTEAIKLDPSNHVLFSNRSAAYCKAERYTEALADADECVKLAPNWTKGYTRKGAALEFLGRFDEAVGVYEDALQKEPNNAQLK---AAMENAYSQAGNK---AFFNPFADPKLMDRIQKSPKLRSYLSDPDFRLKLQMMQQDPSKLGQFIQDPRVMACVSELLGVNLDDAMNGAGGDAQDDKMETDAAASPPPPPKEEPKPSASADQSLTEEEKKANALKEQGNSAYKAKQFDQAIELYKQAMELAPTNVSLYTNTAAVRFEQQRYEDCIAECQKGIEIGRENNADFKLIAKALARIANANVKLGNLREAKRYFDKSLSEHRAPDVIKRAQEIERQLKQLEEQAYINPELAEEEKAKGNEQFSNGKFPDAIRHYSEAIRRNPDDPRLYSNRAACYTKLMEFNMALKDCDTCIKKDPKFIKGYLRKGACLMAMKENVKAAEAYRKALEIDENCQEAKEGYMQAELGTND-EQRRQAALNDPEVQDILSDPAMQMILGQMQKDPKAVAEHLQNPQVRTKLQKLIDAGI 543          
BLAST of Stress-induced-phosphoprotein 1 vs. TrEMBL
Match: A0A1S3KJ01 (stress-induced-phosphoprotein 1-like OS=Lingula unguis OX=7574 GN=LOC106182093 PE=4 SV=1)

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 292/558 (52.33%), Postives = 392/558 (70.25%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAV--GMDAE-PDNFEIKPQ------NENNECDSSNKKE---------NMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            ELK+ GN ALQ+G+ ++AI+ Y++AI +D  N  LYSNRS A  KA  +++AL DAE+ ++LKP+WSKGYSR  +AL  M+R+ EA  A+E+ L  +PDN+  L+   E   R + +G      + + F DPN  +KL   P+TRE +KD  F   M+ ++++P  L     D +I+  + V  GMD +     E+  Q      NE  E     +KE         N  SK  V+L+D +K AL +KEKGN AYK K+F  AI  Y +AI LD TN TF TN AAVYFEQ + + CI+ C K++E+GRENRAD+KL+AKAY+R GNA+ K  DL +A  Y+ K+LSEHR PE+  K  E+++K+KE+EKLAY+NP+L+ +EK  GN  FQ+G YP A+KHY+EAIKRNP+D K+YSNRAACYTKLMEFS+AL DC++CI+LDPKF+KGYLRK ACL+AMKD+ KAA+ Y+KA+E++  C+EA +G R+  M  +DPE +RKRAM DPEIQ IL DPAMQ+IL QMQKDP A +EHL+NP+VA+K+QKL+E G IAIR
Sbjct:   25 ELKDAGNAALQAGKFKDAIELYSQAIEMDKENPALYSNRSVAHIKAKEFEKALTDAEKVVELKPDWSKGYSRVGSALSSMSRHQEAKMAFEQALKLDPDNKQ-LKQAVEDEGRFL-TGPAGSEPVMNPFADPNLFQKLIAEPRTRELMKDTDFVNAMKDLQQNPGALGKYHNDPRIMTALGVLLGMDLDFQGEEELHKQDVKDTVNEMREKRKEAEKEAAFQQKNAANAKSKETVELTDDQKKALEEKEKGNAAYKKKDFETAIKHYDEAIRLDPTNITFLTNKAAVYFEQSDLKSCIETCEKAIEVGRENRADFKLLAKAYARMGNAYNKQEDLENALTYYNKALSEHRTPEVTSKAKEIEKKLKEREKLAYINPELSLEEKTKGNKAFQEGDYPTALKHYAEAIKRNPEDAKIYSNRAACYTKLMEFSLALSDCEQCIKLDPKFIKGYLRKGACLLAMKDTRKAAEVYQKAMELDHTCQEAIDGYRRCVMCDDDPESVRKRAMADPEIQAILGDPAMQLILQQMQKDPKALQEHLKNPEVASKIQKLLESGLIAIR 580          

HSP 2 Score: 83.1889 bits (204), Expect = 5.891e-13
Identity = 57/184 (30.98%), Postives = 90/184 (48.91%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLE-NHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVI 657
            +S E K +GN A Q G    A+K Y EAI  +  +  +YSNR+A + K   +  AL D E+CIKL P + KGY RK A L  M    +A E Y+K +  +   +  +        R +   D           DP  ++K     P+ +  L DP+ ++ ++ M++DPK L   L++ ++   I
Sbjct:  400 LSLEEKTKGNKAFQEGDYPTALKHYAEAIKRNPEDAKIYSNRAACYTKLMEFSLALSDCEQCIKLDPKFIKGYLRKGACLLAMKDTRKAAEVYQKAMELDHTCQEAIDGYR----RCVMCDD-----------DPESVRKRAMADPEIQAILGDPAMQLILQQMQKDPKALQEHLKNPEVASKI 568          
BLAST of Stress-induced-phosphoprotein 1 vs. TrEMBL
Match: A0A1I8GH11 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 273/519 (52.60%), Postives = 374/519 (72.06%), Query Frame = 1
Query:  202 DAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQIL----DVIAVGMDAEPDNFEIKPQNENNECDSS-------NKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGF 1725
            D  NHVL+SNRSAA+CKA  Y EAL DA+EC+KL PNW+KGY+RK AALEF+ R+DEA+  YE  L  EP+N  +      + N   Q+G++   +  + F DP  + +++  PK R YL DP F++K++MM++DP  L   +QD +++    +++ V +D   +      Q++  E D++        ++   ++  +  L++ EK A   KE+GN AYK K F  AI+ Y +A+EL  TN + YTN AAV FEQQ YE CI +C K +EIGREN AD+KLIAKA +R  NA +KL +L  AK+YF+KSLSEHR P+++K+  E++R++K+ E+ AY+NP+LAE+EK  GN +F  GK+P+A++HYSEAI+RNPDDP+LYSNRAACYTKLMEF+MALKDCD CI+ DPKF+KGYLRK ACL+AMK++ KAA+ YRKALE++ NC+EA+EG  Q+ + + D EQ R+ A+ DPE+Q+ILSDPAMQ+ILGQMQKDP A  EHLQNPQV  KLQKL++ G 
Sbjct:  344 DPSNHVLFSNRSAAYCKAERYTEALADADECVKLAPNWTKGYTRKGAALEFLGRFDEAVGVYEDALQKEPNNAQLKA---AMENAYSQAGNK---AFFNPFADPKLMDRIQKSPKLRSYLSDPDFRLKLQMMQQDPSKLGQFIQDPRVMACVSELLGVNLDDAMNGAGGDAQDDKMETDAAASPPPPPKEEPKPSASADQSLTEEEKKANALKEQGNSAYKAKQFDQAIELYKQAMELAPTNVSLYTNTAAVRFEQQRYEDCIAECQKGIEIGRENNADFKLIAKALARIANANVKLGNLREAKRYFDKSLSEHRAPDVIKRAQEIERQLKQLEEQAYINPELAEEEKAKGNEQFSNGKFPDAIRHYSEAIRRNPDDPRLYSNRAACYTKLMEFNMALKDCDTCIKKDPKFIKGYLRKGACLMAMKENVKAAEAYRKALEIDENCQEAKEGYMQAELGTND-EQRRQAALNDPEVQDILSDPAMQMILGQMQKDPKAVAEHLQNPQVRTKLQKLIDAGI 855          

HSP 2 Score: 81.2629 bits (199), Expect = 4.205e-12
Identity = 58/179 (32.40%), Postives = 92/179 (51.40%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQI 645
            +++E K +GN    +G+  +AI+ Y+EAI  +  +  LYSNR+A + K   +  AL D + CIK  P + KGY RK A L  M    +A EAY K L  +        N  E +   +Q+  + G       ND    +   N P+ ++ L DP+ +M +  M++DPK +   LQ+ Q+
Sbjct:  680 LAEEEKAKGNEQFSNGKFPDAIRHYSEAIRRNPDDPRLYSNRAACYTKLMEFNMALKDCDTCIKKDPKFIKGYLRKGACLMAMKENVKAAEAYRKALEID-------ENCQEAKEGYMQA--ELGT------NDEQRRQAALNDPEVQDILSDPAMQMILGQMQKDPKAVAEHLQNPQV 843          
BLAST of Stress-induced-phosphoprotein 1 vs. TrEMBL
Match: A0A210Q504 (Stress-induced-phosphoprotein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10190 PE=4 SV=1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 288/558 (51.61%), Postives = 385/558 (69.00%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGM---------------DAEPD-NFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT-SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK +GN AL+ G  +EAI+ Y +AI +D  NHVLYSNRSAA  KA  Y EAL DAE+ +++KP+W KGYSRK AAL ++NRY EA E YE+ L   PDN+ +  +L E ++ +  +G        + F+ P+ + KLE +PKTREYLK P +KM +E+MK++P  L    QD +I+  + V M               DAE D   +  PQ E N+ +SSNK +       V        AL +KE GN AYK+K F  A+  Y  AIELD +N +  TN AAVYFEQ++Y++CI  C ++VE+GRENRA+Y +IAKA +R G A+LK  D  +A +YF+K+L+EHR P++ K   E+++++KE+E+L++++P+ + + K LGN  FQ+G YP A KHY EAIKRNP+D KLYSNRAACYTKLMEFS+A+KD D CI+LDP FVKGYLRK   L AMK+ SKAA  Y+KALEV+P CEEA  G R++ M    DPE +RKRAM DPE+Q+IL DPAMQ+IL QMQK+P A +EHL+NP+VA K++KL+E G IAIR
Sbjct:    9 NELKVQGNKALEVGDFEEAIQKYTDAIALDPSNHVLYSNRSAALTKAARYLEALGDAEKTLEIKPDWFKGYSRKGAALRYLNRYQEAAEVYEEGLQVVPDNQQLKDDLREAKSHL--TGPAGSQPFGNPFSAPDVMAKLEANPKTREYLKQPDYKMMIELMKQNPNSLQN-FQDPRIITTLGVLMGFDLEAKMGDMETSDDAENDPQPQSPPQMETNDSESSNKSQTSEQNSAV------TQALAEKEAGNAAYKSKKFEEALQHYGAAIELDPSNMSLRTNTAAVYFEQKDYDRCIGVCEEAVELGRENRAEYTMIAKALARMGKAYLKKEDDANALRYFQKALAEHRTPDVAKSIQEIEKRMKEKERLSFIDPEKSLEAKALGNQFFQQGDYPTAKKHYDEAIKRNPEDAKLYSNRAACYTKLMEFSLAVKDADMCIKLDPTFVKGYLRKGGVLQAMKEYSKAASAYQKALEVDPKCEEASRGYREALMAEGGDPEAVRKRAMADPEVQQILQDPAMQLILQQMQKEPEAVREHLKNPEVAKKIEKLLESGIIAIR 557          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Cavefish
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:103039937])

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 269/551 (48.82%), Postives = 379/551 (68.78%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAV-------GMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +LK++GN AL +G I EA++CY EA+ +D  NHVL+SNRSAA+ K   Y  AL DA + IK+KP+W KGYSRKAAALEF+ ++++A   Y++ +  EP N+ +   L  +  R+    D++ M+  +I   PN  +KLE  P+TR  L DPS++  +E ++  P  L   LQD +++  ++V       GMD E        +          K+       E DL + ++ AL +KE GN AYK K+F  A+  Y +A + D TN T+ +N AAV+FE+ E++KC + C K++E+GRENR DY+ IAKAY+R GN++ K +    A ++F KSL+EHR PE++KKC + ++ +KEQEKLAY+NPDLA +EK  GN  FQKG YP AMKHY+EAIKRNP+D KL+SNRAACYTKL+EF +ALKDC++CI LDP F+KGY RKAA L AMKD SKA D Y+KALE++ N +EA EG+++  ++    ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  +HL+NP +A K+QKL++ G IAIR
Sbjct:    6 QLKDQGNKALSAGNIDEAVRCYTEALVLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIKIKPDWGKGYSRKAAALEFLGKFEDAKATYQEGIRHEPSNQQLKEGLQNIEARL---SDKKMMNPFAI---PNLYEKLEGDPRTRALLTDPSYRELLEQLRTKPSELGTRLQDPRVMTTLSVLLGLDLVGMDEE--------EESTPPPPPKPKETAPPPPKEEDLPENKRLALKEKELGNAAYKKKDFATALKHYEEAFKHDPTNMTYLSNQAAVFFEKGEFDKCREFCEKAIEVGRENREDYRQIAKAYARIGNSYFKQDQYKEAIQFFNKSLTEHRTPEVLKKCQQAEKIVKEQEKLAYINPDLALEEKNKGNEAFQKGDYPVAMKHYTEAIKRNPNDAKLFSNRAACYTKLLEFQLALKDCEECINLDPAFIKGYTRKAAALEAMKDFSKAMDAYQKALELDSNSKEATEGMQRCMVSQAVRNDSPEDVKRRAMADPEVQQIMSDPAMRMILEQMQKDPQALSDHLKNPVIAQKIQKLIDVGLIAIR 542          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Cavefish
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:103039937])

HSP 1 Score: 499.59 bits (1285), Expect = 3.662e-172
Identity = 256/527 (48.58%), Postives = 359/527 (68.12%), Query Frame = 1
Query:  121 LKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAV-------GMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMT----SEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKE 1668
            LK++GN AL +G I EA++CY EA+ +D  NHVL+SNRSAA+ K   Y  AL DA + IK+KP+W KGYSRKAAALEF+ ++++A   Y++ +  EP N+ +   L  +  R+    D++ M+  +I   PN  +KLE  P+TR  L DPS++  +E ++  P  L   LQD +++  ++V       GMD E        +          K+       E DL + ++ AL +KE GN AYK K+F  A+  Y +A + D TN T+ +N AAV+FE+ E++KC + C K++E+GRENR DY+ IAKAY+R GN++ K +    A ++F KSL+EHR PE++KKC + ++ +KEQEKLAY+NPDLA +EK  GN  FQKG YP AMKHY+EAIKRNP+D KL+SNRAACYTKL+EF +ALKDC++CI LDP F+KGY RKAA L AMKD SKA D Y+KALE++ N +EA EG+++  ++    ++ PE +++RAM DPE+Q+I+SDPAM++IL QMQKDP A  E
Sbjct:    7 LKDQGNKALSAGNIDEAVRCYTEALVLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIKIKPDWGKGYSRKAAALEFLGKFEDAKATYQEGIRHEPSNQQLKEGLQNIEARL---SDKKMMNPFAI---PNLYEKLEGDPRTRALLTDPSYRELLEQLRTKPSELGTRLQDPRVMTTLSVLLGLDLVGMDEE--------EESTPPPPPKPKETAPPPPKEEDLPENKRLALKEKELGNAAYKKKDFATALKHYEEAFKHDPTNMTYLSNQAAVFFEKGEFDKCREFCEKAIEVGRENREDYRQIAKAYARIGNSYFKQDQYKEAIQFFNKSLTEHRTPEVLKKCQQAEKIVKEQEKLAYINPDLALEEKNKGNEAFQKGDYPVAMKHYTEAIKRNPNDAKLFSNRAACYTKLLEFQLALKDCEECINLDPAFIKGYTRKAAALEAMKDFSKAMDAYQKALELDSNSKEATEGMQRCMVSQAVRNDSPEDVKRRAMADPEVQQIMSDPAMRMILEQMQKDPQALSE 519          

HSP 2 Score: 100.908 bits (250), Expect = 4.083e-22
Identity = 62/170 (36.47%), Postives = 97/170 (57.06%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFND-PNFIKKLE-NHPKTREYLKDPSFKMKMEMMKRDPKLLN 621
            E KN+GN A Q G    A+K Y EAI  +  +  L+SNR+A + K   ++ AL D EECI L P + KGY+RKAAALE M  + +A++AY+K L  + +++                G QR M   ++ ND P  +K+     P+ ++ + DP+ +M +E M++DP+ L+
Sbjct:  361 EEKNKGNEAFQKGDYPVAMKHYTEAIKRNPNDAKLFSNRAACYTKLLEFQLALKDCEECINLDPAFIKGYTRKAAALEAMKDFSKAMDAYQKALELDSNSKEA------------TEGMQRCMVSQAVRNDSPEDVKRRAMADPEVQQIMSDPAMRMILEQMQKDPQALS 518          

HSP 3 Score: 92.8189 bits (229), Expect = 1.526e-19
Identity = 56/183 (30.60%), Postives = 95/183 (51.91%), Query Frame = 1
Query: 1210 KQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAM--------QDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAI 1734
            K  GN     G   EA++ Y+EA+  +P +  L+SNR+A Y K  ++  ALKD  + I++ P + KGY RKAA L  +     A  TY++ +  EP+ ++ +EGL+       D + M   A+         DP  + +L+DP+ + +L Q++  P+     LQ+P+V   L  L+    + +
Sbjct:    8 KDQGNKALSAGNIDEAVRCYTEALVLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIKIKPDWGKGYSRKAAALEFLGKFEDAKATYQEGIRHEPSNQQLKEGLQNIEARLSDKKMMNPFAIPNLYEKLEGDPRTRALLTDPSYRELLEQLRTKPSELGTRLQDPRVMTTLSVLLGLDLVGM 190          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Cavefish
Match: rpap3 (RNA polymerase II associated protein 3 [Source:ZFIN;Acc:ZDB-GENE-040426-928])

HSP 1 Score: 93.9745 bits (232), Expect = 6.970e-20
Identity = 77/276 (27.90%), Postives = 130/276 (47.10%), Query Frame = 1
Query:  793 ALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEV-----------DRKIKEQEKLAYVNPDLAEKEKQL----------------GNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYM 1539
            A+ +KEKGN+ +K   +  AI+ YT+ +  D  N    TN AA +F  ++Y      CN ++ +      D K I KAY+R G A    N+   A + +E  L     PE +   NE+            R+ K ++ L  V P    K K +                GN  F++GKY  A++ Y++ ++ +  +  L +NRA  Y KL  ++ A +DC K I LD  ++K + R+     A+   ++A + + + L +EP  ++A   L++  M
Sbjct:  130 AMKEKEKGNQFFKDGKYDEAIECYTRGMSADPYNPVLPTNRAASFFRLKKYAVAESDCNLAIAL------DSKYI-KAYARRGAARFAHNNHQGALEDYEMVLKLD--PENLDAQNEIKKLSQALASQKQREDKVEKTLVEVLPAEEAKPKHIEEEQQRRQEAVVQKDRGNAYFKEGKYEAAVESYTKGMEADATNALLAANRAMAYLKLERYAEAEEDCSKAIALDSTYLKAFARRGTARAALGHLTEAKEDFEQVLRLEPGNKQAMNELKKLNM 396          

HSP 2 Score: 78.5666 bits (192), Expect = 6.958e-15
Identity = 40/105 (38.10%), Postives = 65/105 (61.90%), Query Frame = 1
Query: 1183 VNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEP 1497
            V+ DLA KEK+ GN  F+ GKY EA++ Y+  +  +P +P L +NRAA + +L ++++A  DC+  I LD K++K Y R+ A   A  +   A + Y   L+++P
Sbjct:  125 VDRDLAMKEKEKGNQFFKDGKYDEAIECYTRGMSADPYNPVLPTNRAASFFRLKKYAVAESDCNLAIALDSKYIKAYARRGAARFAHNNHQGALEDYEMVLKLDP 229          

HSP 3 Score: 70.4774 bits (171), Expect = 2.125e-12
Identity = 38/118 (32.20%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  124 KNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQ 477
            K+RGN   + G+ + A++ Y + +  DA N +L +NR+ A+ K   Y EA  D  + I L   + K ++R+  A   +    EA E +E+VL  EP N+  +  L +L   +  SG Q
Sbjct:  287 KDRGNAYFKEGKYEAAVESYTKGMEADATNALLAANRAMAYLKLERYAEAEEDCSKAIALDSTYLKAFARRGTARAALGHLTEAKEDFEQVLRLEPGNKQAMNELKKLNMEMTSSGLQ 404          

HSP 4 Score: 66.2402 bits (160), Expect = 4.611e-11
Identity = 36/98 (36.73%), Postives = 53/98 (54.08%), Query Frame = 1
Query:  124 KNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDN 417
            K +GN   + G+  EAI+CY   ++ D  N VL +NR+A+F +   Y  A  D    I L   + K Y+R+ AA    N +  A+E YE VL  +P+N
Sbjct:  134 KEKGNQFFKDGKYDEAIECYTRGMSADPYNPVLPTNRAASFFRLKKYAVAESDCNLAIALDSKYIKAYARRGAARFAHNNHQGALEDYEMVLKLDPEN 231          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Cavefish
Match: sgtb (small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Source:ZFIN;Acc:ZDB-GENE-040704-72])

HSP 1 Score: 87.8113 bits (216), Expect = 1.156e-18
Identity = 51/141 (36.17%), Postives = 77/141 (54.61%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLH--ELRNRVIQSGDQRGMS--LTSIFNDPNFI 522
            +++LKN GN  ++      A++CY +AI +D  N V Y NR+AA  K   Y EA  D E  I + P +SK Y R   AL  M++Y EAI  ++K L  +P+N++   NL   E + +   S    G+   + S+ N+P FI
Sbjct:   85 AEQLKNEGNNHMKEENYSCAVECYTKAIHLDQRNAVYYCNRAAAHSKLGNYTEATGDCERAIAIDPTYSKAYGRMGLALTSMSKYPEAISYFKKALVLDPENDTYKSNLKVAEQKKKEASSPTAAGLGFDMASLINNPAFI 225          

HSP 2 Score: 62.003 bits (149), Expect = 3.983e-10
Identity = 33/100 (33.00%), Postives = 56/100 (56.00%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEP 1497
            AE+ K  GN   ++  Y  A++ Y++AI  +  +   Y NRAA ++KL  ++ A  DC++ I +DP + K Y R    L +M    +A   ++KAL ++P
Sbjct:   85 AEQLKNEGNNHMKEENYSCAVECYTKAIHLDQRNAVYYCNRAAAHSKLGNYTEATGDCERAIAIDPTYSKAYGRMGLALTSMSKYPEAISYFKKALVLDP 184          

HSP 3 Score: 57.7658 bits (138), Expect = 9.746e-9
Identity = 35/108 (32.41%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  778 DLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            D+E+A  ++ E GN   K +N+  A++ YTKAI LD  N  +Y N AA + +   Y +    C +++ I           +KAY R G A   ++    A  YF+K+L
Sbjct:   81 DIERAEQLKNE-GNNHMKEENYSCAVECYTKAIHLDQRNAVYYCNRAAAHSKLGNYTEATGDCERAIAID-------PTYSKAYGRMGLALTSMSKYPEAISYFKKAL 180          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Cavefish
Match: sgta (small glutamine rich tetratricopeptide repeat containing alpha [Source:NCBI gene;Acc:103038633])

HSP 1 Score: 87.8113 bits (216), Expect = 1.164e-18
Identity = 47/146 (32.19%), Postives = 79/146 (54.11%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNL----HELRNRVIQSGDQRGMSLTSIFNDPNFIKKLEN 537
            ++ LK+ GN  ++      A++ Y++AI I+  N V Y NR+AA+ K   Y  A+ D E  I + PN+SK Y R   AL  +N++ EA+  Y+K L  +P+NE+   NL     +++     +G   G+ L  + ++P F+    N
Sbjct:   92 AERLKSDGNDQMKVENFSAAVEFYSKAIQINPENAVYYCNRAAAYSKLGNYAGAVQDCELAIGIDPNYSKAYGRMGLALASLNKHTEAVSYYKKALELDPENETYKSNLKIAEQKMKETPSPTGGMGGVDLAGLLSNPGFMSMASN 237          

HSP 2 Score: 80.4925 bits (197), Expect = 3.166e-16
Identity = 46/155 (29.68%), Postives = 81/155 (52.26%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLR---QSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDP 1653
            AE+ K  GN + +   +  A++ YS+AI+ NP++   Y NRAA Y+KL  ++ A++DC+  I +DP + K Y R    L ++   ++A   Y+KALE++P  E  +  L+   Q    +  P       M   ++  +LS+P    +   +  +P
Sbjct:   92 AERLKSDGNDQMKVENFSAAVEFYSKAIQINPENAVYYCNRAAAYSKLGNYAGAVQDCELAIGIDPNYSKAYGRMGLALASLNKHTEAVSYYKKALELDPENETYKSNLKIAEQKMKETPSP----TGGMGGVDLAGLLSNPGFMSMASNLMSNP 242          

HSP 3 Score: 62.7734 bits (151), Expect = 2.232e-10
Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            K  GN+  K +NF AA++FY+KAI+++  N  +Y N AA Y +   Y   +  C  ++ I      +Y   +KAY R G A   LN    A  Y++K+L
Sbjct:   96 KSDGNDQMKVENFSAAVEFYSKAIQINPENAVYYCNRAAAYSKLGNYAGAVQDCELAIGI----DPNY---SKAYGRMGLALASLNKHTEAVSYYKKAL 187          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Sea Lamprey
Match: stip1 (stress-induced phosphoprotein 1 [Source:ZFIN;Acc:ZDB-GENE-041121-17])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 268/547 (48.99%), Postives = 383/547 (70.02%), Query Frame = 1
Query:  115 DELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAV--GMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQ----SYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            +ELK++GN AL +G +++A++ Y +AI +D+ NHVLYSNRSAA+ K   YK+AL D  + ++LKP+W KGYSRKAAALEF+ + +EA + Y + L  E  N  +   L  +  R+ ++      SL++ F+ P+ IKKLE+  +TR +L DP+++  +  ++ +P L+   LQD +++  ++V  G+D +  + +           S+ K E     ME D+ + ++ AL +KE GN AYK KNF  A++ Y KA +LD TN T+ +N AAVYFEQ EYEKC  +C+K++E+GRENR DYK++AKAY+R GN++ K      A + F K+L+EHR P+++KKC   ++ + EQE+L Y+NP+LA +EK  GN  F  G YP AMKHYSEA++RNP+D KLYSNRAACYTKL EF +ALKDC+ CI+LDP F+KGY RKAA L AMKD +KA D Y+KA+E++PNC+EA EG ++     Y   +DPE +++RA  DPE+Q+I+SDPAM+IIL QMQKDP A +EHL+NP +A K+QKL++ G IAIR
Sbjct:    8 NELKDKGNKALSAGNVEDAVRFYTDAIALDSQNHVLYSNRSAAYAKKGDYKQALQDGCKTVELKPDWGKGYSRKAAALEFLGQLEEAKKTYTEGLQHESGNTQLKDGLKNVERRISETRP----SLSNPFSSPDLIKKLESDSRTRPWLGDPTYQQLITELQGNPNLIASKLQDPRVMVTLSVLLGVDLQMHDDDEDDSPATPPTKSTPKPEPKPEPMEEDIPENKRQALKEKELGNSAYKQKNFDVALEHYDKAFQLDPTNMTYLSNKAAVYFEQAEYEKCRQECDKAIEVGRENREDYKVMAKAYARIGNSYFKEEKYKEAVQSFNKALTEHRTPDVLKKCQLAEKIVAEQERLRYINPELALEEKSKGNASFTNGDYPMAMKHYSEALRRNPNDAKLYSNRAACYTKLAEFQLALKDCEDCIRLDPTFIKGYTRKAAALEAMKDFAKAMDVYQKAIELDPNCKEATEGYQRCTISQYTREDDPEAVKRRAASDPEVQQIMSDPAMRIILEQMQKDPRALQEHLKNPVIAQKIQKLIDIGLIAIR 550          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Sea Lamprey
Match: sgta (small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-8811])

HSP 1 Score: 89.3521 bits (220), Expect = 7.209e-20
Identity = 51/148 (34.46%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLH--ELRNRVIQSGDQ----RGMSLTSIFNDPNFIKKLEN 537
            S++ K  GN  ++  +  EA++CY  AI +   N V + NR+AA+ K + Y  A+ D E  I + PN+SK Y R   AL  + +++EA+E Y + +  +PDNE    NL   E R R   S        G  L  I N+P F+    N
Sbjct:   93 SEQFKVHGNQYMREERYSEAVECYTHAIELHQQNAVYFCNRAAAYSKLSNYVGAVQDCERAIVIDPNYSKAYGRMGLALTSLGKHEEAVEFYRRAVELDPDNEGYRGNLELAESRGREATSPQNATPPGGFDLAGILNNPGFMAMAAN 240          

HSP 2 Score: 74.7146 bits (182), Expect = 7.065e-15
Identity = 45/161 (27.95%), Postives = 83/161 (51.55%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPE---------IQEILSDPAMQIILGQMQKDP 1653
            +E+ K  GN   ++ +Y EA++ Y+ AI+ +  +   + NRAA Y+KL  +  A++DC++ I +DP + K Y R    L ++    +A + YR+A+E++P+     EG R +   +E     R R    P+         +  IL++P    +   M ++P
Sbjct:   93 SEQFKVHGNQYMREERYSEAVECYTHAIELHQQNAVYFCNRAAAYSKLSNYVGAVQDCERAIVIDPNYSKAYGRMGLALTSLGKHEEAVEFYRRAVELDPD----NEGYRGNLELAES----RGREATSPQNATPPGGFDLAGILNNPGFMAMAANMMQNP 245          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Sea Lamprey
Match: zgc:123010 (zgc:123010 [Source:ZFIN;Acc:ZDB-GENE-051120-15])

HSP 1 Score: 77.411 bits (189), Expect = 4.649e-16
Identity = 36/97 (37.11%), Postives = 61/97 (62.89%), Query Frame = 1
Query: 1234 QKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGL 1524
            Q G+Y EA+K +S+AI  +P D + + NR+ CY  L +F  ALKD D  + L P + KG+ R+   L+ ++   +A + +++ L+++ +CEEA E L
Sbjct:    1 QNGQYSEAVKCFSKAISIDPYDYRPFGNRSYCYDMLRQFPKALKDADVALDLFPGWAKGHFRRGRALLGLEKYKQAEEAFKRVLDLDKDCEEAVEAL 97          

HSP 2 Score: 71.2478 bits (173), Expect = 6.099e-14
Identity = 37/107 (34.58%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  148 QSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELR-NRVIQ 465
            Q+GQ  EA+KC+++AI+ID  ++  + NRS  +     + +AL DA+  + L P W+KG+ R+  AL  + +Y +A EA+++VL  + D E  +  L  ++  R++Q
Sbjct:    1 QNGQYSEAVKCFSKAISIDPYDYRPFGNRSYCYDMLRQFPKALKDADVALDLFPGWAKGHFRRGRALLGLEKYKQAEEAFKRVLDLDKDCEEAVEALFSIKVERLMQ 107          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Sea Lamprey
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 78.1814 bits (191), Expect = 2.365e-15
Identity = 59/241 (24.48%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            GN   + + F  A+  Y +A+ L+  +   + NLA VY+EQ   +  ID   +++E+ + N  D      AY    NA  +  ++  A++ +  +L        S + +  I ++   ++  ++   K   V P+ A     L ++  Q+GK  +A+ HY EAI+ +P     YSN      ++ +   AL+   + IQ++P F   +   A+      +  +A  +YR AL+++P+  +A
Sbjct:  233 GNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL-QPNFPD------AYCNLANALKEKGNIAEAEECYNTALHLCPNHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDA 466          

HSP 2 Score: 71.633 bits (174), Expect = 2.769e-13
Identity = 91/432 (21.06%), Postives = 164/432 (37.96%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLEN-----HPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLS-DLEKAALIQKEKGNEAY--------KTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAG---NAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFS 1353
            +++   N GN+  + GQ+ EA++ Y  A                                  ++LKP++  GY   AAAL      + A++AY   L + PD   V  +L  L   + +  + +   L +I   PNF     N     + +   +L    F+  + +   DP  L+  +    +L    +   A          N N+     N       +  +DL+ D  + A+  +    +AY        +  N   A + Y  A+ L   +     NLA +  EQ   E+ +    K++E+  E  A +  +A    + G   +A L   + I     F  + S   +   +K+  +V   ++   +   +NP  A+    L ++    G  PEA+  Y  A+K  PD P  Y N A C   + +++
Sbjct:   89 LAEAYSNLGNVFKERGQLAEALEHYRHA----------------------------------VRLKPDFIDGYINLAAALVAAGDLEGAVQAYVTALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFSVAWSNLGCVFNSQGEIWLAIHHFEKAVSL---DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAEAEECYNTALHLCPNHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSN--MGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDAYCNLAHCLQIICDWT 481          

HSP 3 Score: 56.9954 bits (136), Expect = 1.154e-8
Identity = 46/174 (26.44%), Postives = 76/174 (43.68%), Query Frame = 1
Query: 1012 LIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRI-PEIVKKCNEVDRKIKEQEKL-----AYV-----NPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            ++A+AYS  GN F +   L  A +++  ++   R+ P+ +     +   +     L     AYV     NPDL      LGNL    G+  EA   Y +AI+  P+    +SN    +    E  +A+   +K + LDP F+  Y+     L   +   +A   Y +AL +  N
Sbjct:   88 MLAEAYSNLGNVFKERGQLAEALEHYRHAV---RLKPDFIDGYINLAAALVAAGDLEGAVQAYVTALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFSVAWSNLGCVFNSQGEIWLAIHHFEKAVSLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLNHN 258          

HSP 4 Score: 52.7582 bits (125), Expect = 2.163e-7
Identity = 37/131 (28.24%), Postives = 56/131 (42.75%), Query Frame = 1
Query: 1132 KCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGL 1524
            +C  +DR           NP LAE    LGN+  ++G+  EA++HY  A++  PD    Y N AA      +   A++     +Q +P            L A+    +A   Y KA+E +PN   A   L
Sbjct:   68 QCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLAEALEHYRHAVRLKPDFIDGYINLAAALVAAGDLEGAVQAYVTALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFSVAWSNL 198          

HSP 5 Score: 51.2174 bits (121), Expect = 5.452e-7
Identity = 33/112 (29.46%), Postives = 51/112 (45.54%), Query Frame = 1
Query: 1189 PDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGL 1524
            PD       L ++ FQ  +   +    + AIK+NP   + YSN    + +  + + AL+     ++L P F+ GY+  AA LVA  D   A   Y  AL+  P+    R  L
Sbjct:   53 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLAEALEHYRHAVRLKPDFIDGYINLAAALVAAGDLEGAVQAYVTALQYNPDLYCVRSDL 164          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005772.1 (pep scaffold:Pmarinus_7.0:GL478792:23408:39519:-1 gene:ENSPMAG00000005227.1 transcript:ENSPMAT00000005772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 2.774e-14
Identity = 50/168 (29.76%), Postives = 86/168 (51.19%), Query Frame = 1
Query:  124 KNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDP-NFIKKLENHPKTREYLKDPSFKMKMEMMKRD--PKLL 618
            K++GN   ++G    A  CY   +  D  N +L +NR+ AF K   Y+ A  D    I+L P++ K ++R+ AA   +N+  EA E +E VL+F+P N+  +  L +++   IQ+     + +  I  +P N ++     P  R   K P  +M +E +  D  PK++
Sbjct:   18 KDKGNEYFKTGDYDAANDCYTRGMEADPHNALLPANRAMAFLKLKKYELAESDCNLAIQLDPSYPKAFARRGAARLALNKLKEAREDFEAVLTFDPVNKQAIAELKKIKEIYIQT-KHCHLIVEHINTEPSNVVQPFTRQPHLRS--KKPLRRMTIEEVGSDMQPKMV 182          

HSP 2 Score: 62.003 bits (149), Expect = 1.586e-10
Identity = 37/104 (35.58%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  793 ALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLS 1104
            ALI+K+KGNE +KT ++ AA D YT+ +E D  N     N A  + + ++YE     CN ++++            KA++R G A L LN L  A++ FE  L+
Sbjct:   14 ALIEKDKGNEYFKTGDYDAANDCYTRGMEADPHNALLPANRAMAFLKLKKYELAESDCNLAIQLDPS-------YPKAFARRGAARLALNKLKEAREDFEAVLT 110          

HSP 3 Score: 60.077 bits (144), Expect = 5.330e-10
Identity = 37/118 (31.36%), Postives = 63/118 (53.39%), Query Frame = 1
Query: 1159 KEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            K+ E+L      L EK+K  GN  F+ G Y  A   Y+  ++ +P +  L +NRA  + KL ++ +A  DC+  IQLDP + K + R+ A  +A+    +A + +   L  +P  ++A
Sbjct:    3 KQYEELRAKQQALIEKDK--GNEYFKTGDYDAANDCYTRGMEADPHNALLPANRAMAFLKLKKYELAESDCNLAIQLDPSYPKAFARRGAARLALNKLKEAREDFEAVLTFDPVNKQA 118          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Yeast
Match: STI1 (Hsp90 cochaperone; regulates spatial organization of amyloid-like proteins in the cytosol, thereby buffering the proteotoxicity caused by amyloid-like proteins; interacts with the Ssa group of the cytosolic Hsp70 chaperones and activates Ssa1p ATPase activity; interacts with Hsp90 chaperones and inhibits their ATPase activity; homolog of mammalian Hop [Source:SGD;Acc:S000005553])

HSP 1 Score: 370.933 bits (951), Expect = 7.217e-122
Identity = 222/584 (38.01%), Postives = 330/584 (56.51%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITI-DAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNM-MLQDQQILDVIAV---------------GMDAEPDNFEIKPQNENNE--CDSSNKKENMNSK-----------MEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKA----LEVEPNCEEAREGLRQSY-----------MTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFI 1728
            +DE K +GN A  +    +AI+ + +AI + +  NHVLYSNRSA +     + +AL DA EC+K+ P+WSKGY+R  AA   +   DEA   Y+K L  +  N++    L ++         Q  + LT +F DPN I+ L+ +PKT E +KDP    K+   K++P+ +   +  D +++ ++A                 M  EP+  +   Q ++ E   DS+  KEN +             MEVD  D +  A  +K +GN+ YK + F  AI+ Y KA EL   + T+  N AA  +E+ EYE  I   N +VE GRE RADYK+I+K+++R GNA+ KL DL    +Y++KSL+EHR  +I+ K    ++++K+ E  AYVNP+ AE+ +  G   F K  +P A+K Y+E IKR P+D + YSNRAA   KLM F  A+ DC+K I+ DP FV+ Y+RKA   +A+K+ + A +T   A     EV  N   ARE + Q Y            ++E PE+  +RAM+DPE+  I+ DP MQ IL Q Q++PAA +EH++NP+V  K+Q L+  G I
Sbjct:    5 ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQVHRTQQARQAQPDLGLTQLFADPNLIENLKKNPKTSEMMKDPQLVAKLIGYKQNPQAIGQDLFTDPRLMTIMATLMGVDLNMDDINQSNSMPKEPETSKSTEQKKDAEPQSDSTTSKENSSKAPQKEESKESEPMEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWELHK-DITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVN-NGSSARE-IDQLYYKASQQRFQPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGII 585          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Yeast
Match: SGT2 (Glutamine-rich cytoplasmic cochaperone; serves as a scaffold bringing together Get4, Get5p, and other TRC complex members that are required to mediate posttranslational insertion of tail-anchored proteins into the ER membrane; interacts with the prion domain of Sup35p; amyloid sensor; plays a role in targeting chaperones to prion aggregates; similar to human cochaperone SGT; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000005533])

HSP 1 Score: 75.0998 bits (183), Expect = 3.744e-15
Identity = 45/121 (37.19%), Postives = 71/121 (58.68%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDN--ESVLRNLHELRNRVIQS 468
            +++LK +GN A+ +   + AI  Y EAI +   N + Y+NR+AA      Y +A+ DAE  I + P++ +GYSR   A     + +EA+EAY+KVL  E DN  E++ R+    + +V QS
Sbjct:  102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQS 222          

HSP 2 Score: 68.9366 bits (167), Expect = 3.630e-13
Identity = 47/145 (32.41%), Postives = 72/145 (49.66%), Query Frame = 1
Query: 1102 SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSY 1536
            S  R+PE  KK +  + +I   E  A      AE  K  GN       Y  A+  Y+EAIK  P +   Y+NRAA ++ L E+  A+KD +  I +DP + +GY R      A     +A + Y+K L++E   + A E +++ Y
Sbjct:   71 SASRVPESNKKDDAENVEINIPEDDAETKAK-AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE--GDNATEAMKRDY 212          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Yeast
Match: PPT1 (Protein serine/threonine phosphatase; regulates Hsp90 chaperone by affecting its ATPase and cochaperone binding activities; has similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth [Source:SGD;Acc:S000003355])

HSP 1 Score: 62.3882 bits (150), Expect = 1.051e-10
Identity = 39/117 (33.33%), Postives = 63/117 (53.85%), Query Frame = 1
Query: 1189 PDLAEKEKQL-----GNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGL 1524
            P  A++ K L     GN+  ++  + +A++ Y+EAI  +      +SNRA  + K+  F  AL DCD+ I+LDPK +K Y R+A   +A+ +  KA       L+ +PN   A + L
Sbjct:    4 PTAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPAATKAL 120          

HSP 2 Score: 55.4546 bits (132), Expect = 1.483e-8
Identity = 33/83 (39.76%), Postives = 48/83 (57.83%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKA----AALEF 354
            E KN GN+ ++     +AI+ Y EAI +D+   + +SNR+ A  K + ++ AL D +E IKL P   K Y R+A    A LEF
Sbjct:   14 ERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEF 96          

HSP 3 Score: 51.6026 bits (122), Expect = 2.126e-7
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  793 ALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL-SEHRIPEIVKKCNEVDRKIKEQ 1167
            AL +K +GN   K K+F  AI+ YT+AI+LDST   +++N A  +F+   ++  ++ C++++++  +N        KAY R   + + L +   A+K     L ++   P   K     DR I+E+
Sbjct:   12 ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKN-------IKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPAATKALLTCDRFIREE 130          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Yeast
Match: CNS1 (TPR-containing co-chaperone; binds both Hsp82p (Hsp90) and Ssa1p (Hsp70); stimulates ATPase activity of Ssa1p; ts mutants reduce Hsp82p function, overexpression suppresses phenotypes of HSP82 ts allele and cpr7 deletion; human homolog TTC4 complements yeast cns1 mutant [Source:SGD;Acc:S000000359])

HSP 1 Score: 59.6918 bits (143), Expect = 4.621e-10
Identity = 44/128 (34.38%), Postives = 66/128 (51.56%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELD----STNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRI-PE---IVKKCNEVDRKIKE 1164
            K++GNE YK K F  A + Y+K + ++    S N + Y N AA   E + Y +CI+ C+K++ I  +N        K Y R   AF +LN L  AK     + +  RI PE   I+   + +DRK +E
Sbjct:   87 KKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALTINPKN-------VKCYYRTSKAFFQLNKLEEAKS--AATFANQRIDPENKSILNMLSVIDRKEQE 205          

HSP 2 Score: 48.9062 bits (115), Expect = 1.403e-6
Identity = 38/136 (27.94%), Postives = 69/136 (50.74%), Query Frame = 1
Query: 1108 HRIPEIVKKCNEVDRKIKEQ------EKLAYVNP--DLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPK----LYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMK--DSSKAADTY 1473
            +R+P  + K +E D    E       + LAY     ++AE  K+ GN  ++  ++ +A + YS+ +    +D      LY+NRAAC  +L  +   ++DC K + ++PK VK Y R +     +   + +K+A T+
Sbjct:   45 NRMPFFMTKLDETDGAGGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATF 180          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Yeast
Match: TOM71 (Mitochondrial outer membrane protein; probable minor component of the TOM (translocase of outer membrane) complex responsible for recognition and import of mitochondrially directed proteins; TOM71 has a paralog, TOM70, that arose from the whole genome duplication [Source:SGD;Acc:S000001159])

HSP 1 Score: 52.7582 bits (125), Expect = 1.185e-7
Identity = 25/60 (41.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query:  805 KEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEI 984
            K +GN  +  KNF  AI +Y  AIELD     FY+N++A Y    + EK I+   K++EI
Sbjct:  131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEI 190          

HSP 2 Score: 52.373 bits (124), Expect = 1.602e-7
Identity = 29/87 (33.33%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAI 378
            +LKNRGN    +    EAIK Y  AI +D    V YSN SA +      ++ +    + +++KP+ SK   R+A+A E +  + +A+
Sbjct:  129 QLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAM 215          

HSP 3 Score: 50.447 bits (119), Expect = 5.736e-7
Identity = 24/74 (32.43%), Postives = 40/74 (54.05%), Query Frame = 1
Query: 1210 KQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAAC 1431
            K  GN  F    + EA+K+Y  AI+ +P++P  YSN +ACY    +    ++   K +++ P   K  LR+A+ 
Sbjct:  131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASA 204          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Nematostella
Match: EDO47073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN48])

HSP 1 Score: 73.1738 bits (178), Expect = 1.637e-13
Identity = 57/241 (23.65%), Postives = 113/241 (46.89%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            GN   + + F  A+  Y +A+ L   +   + NLA VY+EQ   +  +D   +++E+ + N  D      AY    NA  +   +  A++ +  +L        S + +  I ++  +++  I+   K   + P+ A     L ++  Q+GK  EA+ HY EAI+ +P     +SN      ++ +   A++   + IQ++P F   +   A+      +  +A  +YR AL+++P+  +A
Sbjct:  228 GNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDLAVDTYRRAIEL-QPNFPD------AYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDA 461          

HSP 2 Score: 69.3218 bits (168), Expect = 2.887e-12
Identity = 94/439 (21.41%), Postives = 173/439 (39.41%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLEN-----HPKTREYLKDPSFKMKMEMMKRDPKLLNM------MLQDQQILD-VIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLS-DLEKAALIQKEKGNEAY--------KTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGN---AFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFS 1353
            +++   N GN+  + GQ+++A+  Y  A                                  +KLKP++  GY   AAAL      + A+ AY   L + PD   V  +L  L   + +  + +   L +I   P+F     N     + +   +L    F+  +++   DP  L+       +L++ +I D  +A  + A      + P   N+     N       +  +DL+ D  + A+  +    +AY        +      A + Y  A++L  T+     NLA +  EQ + E+ I    K++EI  E  A +  +A    + G    A L   + I     F  + S   +  ++K+  ++   I+   +   +NP  A+    L ++    G  PEA++ Y  A+K  P  P  Y N A C   + +++
Sbjct:   84 LAEAYSNLGNVFKERGQLKDALANYRHA----------------------------------VKLKPDFIDGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQL---DPNFLDAYINLGNVLKEARIFDRAVAAYLRA----LNLSP---NHAVVHGNLACVYYEQGLIDLAVDTYRRAIELQPNFPDAYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSN--MGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDAYCNLAHCLQIICDWT 476          

HSP 3 Score: 58.151 bits (139), Expect = 9.081e-9
Identity = 42/171 (24.56%), Postives = 70/171 (40.94%), Query Frame = 1
Query: 1012 LIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            ++A+AYS  GN F +   L  A   +  ++            +   +    +++  +         NPDL      LGNL    G+  EA   Y +AI+  P     +SN    +    E  +A+   +K +QLDP F+  Y+     L   +   +A   Y +AL + PN
Sbjct:   83 MLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPN 253          

HSP 4 Score: 50.447 bits (119), Expect = 1.909e-6
Identity = 33/112 (29.46%), Postives = 50/112 (44.64%), Query Frame = 1
Query: 1189 PDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGL 1524
            PD       L ++ FQ  +   +    + AIK+NP   + YSN    + +  +   AL +    ++L P F+ GY+  AA LVA  D   A   Y  AL+  P+    R  L
Sbjct:   48 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDL 159          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Nematostella
Match: EDO45716 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS01])

HSP 1 Score: 64.3142 bits (155), Expect = 6.713e-13
Identity = 34/96 (35.42%), Postives = 52/96 (54.17%), Query Frame = 1
Query:  133 GNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNE 420
            GN  + S + + AI  YN++I     N+  +  R+ AF   N Y+E+LLD EECIKL P W KGY  +  +   + +Y +A+       S  PD++
Sbjct:    1 GNKKMISKEYRTAIDLYNKSILASPINYFSWCQRATAFISLNKYEESLLDFEECIKLNPKWVKGYLFRGLSQLHLRQYKDALVTLNYAGSMCPDDK 96          

HSP 2 Score: 44.669 bits (104), Expect = 5.529e-6
Identity = 26/94 (27.66%), Postives = 50/94 (53.19%), Query Frame = 1
Query: 1219 GNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            GN +    +Y  A+  Y+++I  +P +   +  RA  +  L ++  +L D ++CI+L+PK+VKGYL +    + ++    A  T   A  + P+
Sbjct:    1 GNKKMISKEYRTAIDLYNKSILASPINYFSWCQRATAFISLNKYEESLLDFEECIKLNPKWVKGYLFRGLSQLHLRQYKDALVTLNYAGSMCPD 94          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Nematostella
Match: EDO31207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYL2])

HSP 1 Score: 69.3218 bits (168), Expect = 2.622e-12
Identity = 43/115 (37.39%), Postives = 67/115 (58.26%), Query Frame = 1
Query: 1195 LAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSK---AADTYRKALEVEPNCEEAREGLRQ 1530
            LA +EK  GN  F+ G Y E++ +Y+ +I+  P     Y+NRA    KL E++ A++DC+  I L+P  +K +LR+A   +A K + K   A     K LE+EPN + A+E L +
Sbjct:  214 LANREKDKGNDAFRSGDYKESLVYYTRSIELKPTAAS-YNNRAMAEIKLSEYAKAIEDCNTVIFLEPDNLKAFLRRA---IAQKQTGKVQAAKKDLNKVLEIEPNNKRAKELLEE 324          

HSP 2 Score: 50.0618 bits (118), Expect = 2.332e-6
Identity = 33/116 (28.45%), Postives = 59/116 (50.86%), Query Frame = 1
Query: 1189 PDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDD--------PKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            P+LA + K  G   ++ G+Y EA++ YS+AI     D          L  NRA+C  ++ + S  +KDC   + L P  +K +L++A     ++   +A   Y+  L ++P  ++A
Sbjct:  474 PNLAVRAKDEGMRLYKIGRYAEAVEKYSQAIDVLWKDKSHFKSALASLLYNRASCLGRIGDASGCVKDCTSSLNLIPDSLKAHLKRAEQFEHLEKYKEAHFDYQAVLRIDPANQQA 589          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Nematostella
Match: EDO30468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0P9])

HSP 1 Score: 62.3882 bits (150), Expect = 8.844e-11
Identity = 30/99 (30.30%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  124 KNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNE 420
            K++GN   + G+ +EAI CY  A+ +D  N +  +NR+ A  K   +  A LD +  + L  +++K Y R+  A   +N+  E++  +++ L  EP N+
Sbjct:  147 KDKGNDFFKIGRYKEAINCYTTAMQLDPNNAIFPANRAMALLKVERHGAAELDCDLALSLDYSYTKAYLRRGKARSHLNKLHESLSDFKEALRLEPGNK 245          

HSP 2 Score: 57.7658 bits (138), Expect = 3.298e-9
Identity = 31/104 (29.81%), Postives = 56/104 (53.85%), Query Frame = 1
Query: 1207 EKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEARE 1518
            EK  GN  F+ G+Y EA+  Y+ A++ +P++    +NRA    K+     A  DCD  + LD  + K YLR+      +    ++   +++AL +EP  ++A++
Sbjct:  146 EKDKGNDFFKIGRYKEAINCYTTAMQLDPNNAIFPANRAMALLKVERHGAAELDCDLALSLDYSYTKAYLRRGKARSHLNKLHESLSDFKEALRLEPGNKQAQQ 249          

HSP 3 Score: 46.9802 bits (110), Expect = 8.742e-6
Identity = 32/103 (31.07%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  793 ALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            AL++K+KGN+ +K   +  AI+ YT A++LD  N  F  N A    + + +      C+ ++ +      DY    KAY R G A   LN L  +   F+++L
Sbjct:  143 ALLEKDKGNDFFKIGRYKEAINCYTTAMQLDPNNAIFPANRAMALLKVERHGAAELDCDLALSL------DYS-YTKAYLRRGKARSHLNKLHESLSDFKEAL 238          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Nematostella
Match: EDO38045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE44])

HSP 1 Score: 60.8474 bits (146), Expect = 2.892e-10
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 1
Query: 1210 KQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEV 1491
            K+ GN  F   ++ +A++ Y++AI +NP  P  ++NRA C+ KL ++   + DC + ++LD   VKG+      L+  +   +A  +  KA ++
Sbjct:    7 KEQGNRLFGAKQFDDAIQCYTKAILKNPTVPTYFTNRALCHLKLKKWGQVVSDCRQALELDANLVKGHFFNGQALIEQECYDEAITSLLKAFDL 100          

HSP 2 Score: 48.1358 bits (113), Expect = 4.863e-6
Identity = 34/115 (29.57%), Postives = 53/115 (46.09%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIE--------AYEKVLSFEPDNESVLR 432
            + ELK +GN    + Q  +AI+CY +AI  +      ++NR+    K   + + + D  + ++L  N  KG+     AL     YDEAI         A E+ L+F  D    LR
Sbjct:    3 ATELKEQGNRLFGAKQFDDAIQCYTKAILKNPTVPTYFTNRALCHLKLKKWGQVVSDCRQALELDANLVKGHFFNGQALIEQECYDEAITSLLKAFDLAKEQKLNFGDDIACALR 117          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Medaka
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:101163839])

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 270/543 (49.72%), Postives = 373/543 (68.69%), Query Frame = 1
Query:  121 LKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQ---SYMTSED-PEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            LK +GN AL +G I EA++CY EA+ +D  NHVLYSNRSAA+ K   Y+ AL DA + IK+KP+W KGYSRKAAALEF+ R ++A   Y++ L  EP+N+ +   L  +  R+ +        + + F  PN  +KLEN P+TRE L DPS++  +E ++  P  L   LQD +++  ++V +       E + +          +      K E    + ++ AL +KE GN AYK K+F +A+  Y +A++ D TN T+ +N AAVYFE+ ++EKC + C K++++GRENR DY+ IAKA +R GN++ K      A +YF KSL+EHR P+++KKC + ++ +KEQEKLAYVNP+LA +EK  GN  FQKG YP AMKHYSEAIKRNP+D KLYSNRAACYTKL+EF +ALKDC+ CI+LDP F+KGY RK A L AMKD SKA D Y+KALE++ + +EA EG+++   S+ T  D PE ++KRAM DPE+Q+I+SDPAM++IL QMQKDP A  +HL+NP +A K+QKL++ G IAIR
Sbjct:    7 LKEQGNKALSAGNIDEAVRCYTEALALDQSNHVLYSNRSAAYAKKGNYENALQDACQTIKIKPDWGKGYSRKAAALEFLGRLEDAKTTYQEGLRHEPNNQQLKEGLQSIEARLAEK------LMMNPFAMPNLYQKLENDPRTRELLSDPSYRELLEQLRNKPSELGTKLQDPRVMTTLSVLLGLNLSEMEEEEERSPPPPPKPKETPPPPPKEEDLPEN-KRMALKEKELGNSAYKNKDFESALKHYEEAMKHDPTNMTYLSNQAAVYFEKGDFEKCRELCEKAIDVGRENREDYRQIAKALARIGNSYYKQEKYKEAIQYFNKSLTEHRTPDVLKKCQQAEKILKEQEKLAYVNPELALEEKNKGNDAFQKGDYPLAMKHYSEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEACIKLDPTFIKGYTRKGAALEAMKDYSKAMDAYQKALELDSSSKEATEGVQRCMVSHATRNDSPEDVKKRAMADPEVQQIMSDPAMRMILEQMQKDPQALSDHLKNPVIAQKIQKLIDVGLIAIR 542          

HSP 2 Score: 106.686 bits (265), Expect = 6.373e-24
Identity = 71/192 (36.98%), Postives = 107/192 (55.73%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFND-PNFIKKLE-NHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQD----QQILDVIAVGMDA 675
            E KN+GN A Q G    A+K Y+EAI  +  +  LYSNR+A + K   ++ AL D E CIKL P + KGY+RK AALE M  Y +A++AY+K L  +  ++                G QR M   +  ND P  +KK     P+ ++ + DP+ +M +E M++DP+ L+  L++    Q+I  +I VG+ A
Sbjct:  361 EEKNKGNDAFQKGDYPLAMKHYSEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEACIKLDPTFIKGYTRKGAALEAMKDYSKAMDAYQKALELDSSSKEA------------TEGVQRCMVSHATRNDSPEDVKKRAMADPEVQQIMSDPAMRMILEQMQKDPQALSDHLKNPVIAQKIQKLIDVGLIA 540          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Medaka
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:101163839])

HSP 1 Score: 472.626 bits (1215), Expect = 1.733e-161
Identity = 254/531 (47.83%), Postives = 355/531 (66.85%), Query Frame = 1
Query:  166 EAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGY---LRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQ---SYMTSED-PEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            EA++CY EA+ +D  NHVLYSNRSAA+ K   Y+ AL DA + IK+KP+W KGYSRKAAALEF+ R ++A   Y++ L  EP+N+ +   L  +  R+ +        + + F  PN  +KLEN P+TRE L DPS++  +E ++  P  L   LQD +++  ++V +       E + +          +      K E    + ++ AL +KE GN AYK K+F +A+  Y +A++ D TN T+ +N AAVYFE+ ++EKC + C K++++GRENR DY+ IAKA +R GN++ K      A +YF KSL+EHR P+++KKC + ++ +KEQEKLAYVNP+LA +EK  GN  FQKG YP AMKHYSEAIKRNP+D KLYSNRAACYTKL+EF +ALK   K +     FV G+   L + A L AMKD SKA D Y+KALE++ + +EA EG+++   S+ T  D PE ++KRAM DPE+Q+I+SDPAM++IL QMQKDP A  +HL+NP +A K+QKL++ G IAIR
Sbjct:    2 EAVRCYTEALALDQSNHVLYSNRSAAYAKKGNYENALQDACQTIKIKPDWGKGYSRKAAALEFLGRLEDAKTTYQEGLRHEPNNQQLKEGLQSIEARLAEK------LMMNPFAMPNLYQKLENDPRTRELLSDPSYRELLEQLRNKPSELGTKLQDPRVMTTLSVLLGLNLSEMEEEEERSPPPPPKPKETPPPPPKEEDLPEN-KRMALKEKELGNSAYKNKDFESALKHYEEAMKHDPTNMTYLSNQAAVYFEKGDFEKCRELCEKAIDVGRENREDYRQIAKALARIGNSYYKQEKYKEAIQYFNKSLTEHRTPDVLKKCQQAEKILKEQEKLAYVNPELALEEKNKGNDAFQKGDYPLAMKHYSEAIKRNPNDAKLYSNRAACYTKLLEFQLALK-VQKHLWKFYTFVTGFRFKLTEHAALEAMKDYSKAMDAYQKALELDSSSKEATEGVQRCMVSHATRNDSPEDVKKRAMADPEVQQIMSDPAMRMILEQMQKDPQALSDHLKNPVIAQKIQKLIDVGLIAIR 524          

HSP 2 Score: 73.559 bits (179), Expect = 2.234e-13
Identity = 62/201 (30.85%), Postives = 102/201 (50.75%), Query Frame = 1
Query:  118 ELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYS---------RKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFND-PNFIKKLE-NHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQD----QQILDVIAVGMDA 675
            E KN+GN A Q G    A+K Y+EAI  +  +  LYSNR+A + K       LL+ +  +K++ +  K Y+          + AALE M  Y +A++AY+K L  +  ++                G QR M   +  ND P  +KK     P+ ++ + DP+ +M +E M++DP+ L+  L++    Q+I  +I VG+ A
Sbjct:  341 EEKNKGNDAFQKGDYPLAMKHYSEAIKRNPNDAKLYSNRAACYTK-------LLEFQLALKVQKHLWKFYTFVTGFRFKLTEHAALEAMKDYSKAMDAYQKALELDSSSKEA------------TEGVQRCMVSHATRNDSPEDVKKRAMADPEVQQIMSDPAMRMILEQMQKDPQALSDHLKNPVIAQKIQKLIDVGLIA 522          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Medaka
Match: spag1a (sperm-associated antigen 1A [Source:NCBI gene;Acc:101158289])

HSP 1 Score: 100.908 bits (250), Expect = 1.168e-22
Identity = 97/335 (28.96%), Postives = 148/335 (44.18%), Query Frame = 1
Query:  700 PQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQ-----KEKGNEAYKTKNFPAAIDFYTKAIE------LDSTN--CTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYS---RAGNAFLKLNDLISAKKYFEKSL-SEHRI---------PEIVKKCNE---VDRKIKEQ--EKLAYVNPDLAEKE-----------------KQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREG-------LRQSYM 1539
            PQ+ N+   +  K+E  +  ++    D    AL       K +GN  +K   F  A+  YT+AIE      +DS +  C  Y+N AA Y +      CI  C K++E+   +       A AY    R   A++    ++      + +  S HRI         PE  +K  E   V   +++Q  EK A +    A                    KQ GN   +KG + EA++ YSE +   PDD  LY+NRA CY KL+ +  A +DCD  I+LDP   K + R+A     ++D   A+   ++ L+++PN  EA +        LRQS M
Sbjct:   43 PQDNNSP--AGRKEEQASPAVDTSYLDAPAGALPPHLARLKNEGNHLFKHGQFGEALGKYTQAIEGCAEAGVDSPDDLCILYSNRAACYLKDGNSADCIQDCTKALELQPYSLKPLLRRAMAYESLERYRKAYVDYKTVLQMDTGIQAAHDSVHRITKMLIEEDGPEWREKLPEIPAVPLSVQQQHREKPASIEQAQARAARAAQVDARKEEARFSLLKQEGNGLVKKGLFQEALQKYSECLALKPDDCALYTNRAICYLKLLNYEEAKQDCDSAIRLDPTNKKAFYRRALAFKGLQDYLSASSDLQEVLQLDPNVGEAEQELEEVTSLLRQSLM 375          

HSP 2 Score: 71.2478 bits (173), Expect = 7.473e-13
Identity = 78/336 (23.21%), Postives = 134/336 (39.88%), Query Frame = 1
Query:  121 LKNRGNLALQSGQIQEAIKCYNEAI------TIDAGNH--VLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKD-PSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            LKN GN   + GQ  EA+  Y +AI       +D+ +   +LYSNR+A + K     + + D  + ++L+P   K   R+A A E + RY +A   Y+ VL  +   ++   ++H +   +I+                      E+ P+ RE L + P+  + ++   R+                       +P + E              +KE      E   S L       K++GN   K   F  A+  Y++ + L   +C  YTN A  Y +   YE+    C+ ++ +   N+       KA+ R   AF  L D +SA    ++ L
Sbjct:   80 LKNEGNHLFKHGQFGEALGKYTQAIEGCAEAGVDSPDDLCILYSNRAACYLKDGNSADCIQDCTKALELQPYSLKPLLRRAMAYESLERYRKAYVDYKTVLQMDTGIQAAHDSVHRITKMLIE----------------------EDGPEWREKLPEIPAVPLSVQQQHRE-----------------------KPASIEQAQARAARAAQVDARKE------EARFSLL-------KQEGNGLVKKGLFQEALQKYSECLALKPDDCALYTNRAICYLKLLNYEEAKQDCDSAIRLDPTNK-------KAFYRRALAFKGLQDYLSASSDLQEVL 350          

HSP 3 Score: 58.5362 bits (140), Expect = 9.930e-9
Identity = 35/116 (30.17%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  121 LKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQS 468
            LK  GN  ++ G  QEA++ Y+E + +   +  LY+NR+  + K   Y+EA  D +  I+L P   K + R+A A + +  Y  A    ++VL  +P+     + L E+ + + QS
Sbjct:  258 LKQEGNGLVKKGLFQEALQKYSECLALKPDDCALYTNRAICYLKLLNYEEAKQDCDSAIRLDPTNKKAFYRRALAFKGLQDYLSASSDLQEVLQLDPNVGEAEQELEEVTSLLRQS 373          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Medaka
Match: sgtb (small glutamine rich tetratricopeptide repeat containing beta [Source:NCBI gene;Acc:101155865])

HSP 1 Score: 92.4337 bits (228), Expect = 2.916e-20
Identity = 54/141 (38.30%), Postives = 77/141 (54.61%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLH--ELRNRVIQSGDQRGMS--LTSIFNDPNFI 522
            +++LKN GN  ++    + A+ CY +AI +D  N V Y NR+AA  K   Y EA  D E  I + P +SK Y R   AL  MN+Y EAI  ++K L  +PDN++   NL   E + R   S    G+   + S+ N+P FI
Sbjct:   87 AEQLKNEGNNHMKEENYRCALDCYTQAIDLDLRNAVYYCNRAAAHSKLGNYTEATSDCERAIGIDPTYSKAYGRMGLALTAMNKYPEAISYFKKALVLDPDNDTYKSNLKIAEQKQREASSPIAAGLGFDMASLINNPAFI 227          

HSP 2 Score: 63.5438 bits (153), Expect = 1.420e-10
Identity = 35/110 (31.82%), Postives = 60/110 (54.55%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLR 1527
            AE+ K  GN   ++  Y  A+  Y++AI  +  +   Y NRAA ++KL  ++ A  DC++ I +DP + K Y R    L AM    +A   ++KAL ++P+ +  +  L+
Sbjct:   87 AEQLKNEGNNHMKEENYRCALDCYTQAIDLDLRNAVYYCNRAAAHSKLGNYTEATSDCERAIGIDPTYSKAYGRMGLALTAMNKYPEAISYFKKALVLDPDNDTYKSNLK 196          

HSP 3 Score: 58.9214 bits (141), Expect = 3.897e-9
Identity = 36/108 (33.33%), Postives = 56/108 (51.85%), Query Frame = 1
Query:  778 DLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            D+E+A  ++ E GN   K +N+  A+D YT+AI+LD  N  +Y N AA + +   Y +    C +++ I           +KAY R G A   +N    A  YF+K+L
Sbjct:   83 DIERAEQLKNE-GNNHMKEENYRCALDCYTQAIDLDLRNAVYYCNRAAAHSKLGNYTEATSDCERAIGID-------PTYSKAYGRMGLALTAMNKYPEAISYFKKAL 182          
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Medaka
Match: sgtb (small glutamine rich tetratricopeptide repeat containing beta [Source:NCBI gene;Acc:101155865])

HSP 1 Score: 92.4337 bits (228), Expect = 3.095e-20
Identity = 54/141 (38.30%), Postives = 77/141 (54.61%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLH--ELRNRVIQSGDQRGMS--LTSIFNDPNFI 522
            +++LKN GN  ++    + A+ CY +AI +D  N V Y NR+AA  K   Y EA  D E  I + P +SK Y R   AL  MN+Y EAI  ++K L  +PDN++   NL   E + R   S    G+   + S+ N+P FI
Sbjct:   88 AEQLKNEGNNHMKEENYRCALDCYTQAIDLDLRNAVYYCNRAAAHSKLGNYTEATSDCERAIGIDPTYSKAYGRMGLALTAMNKYPEAISYFKKALVLDPDNDTYKSNLKIAEQKQREASSPIAAGLGFDMASLINNPAFI 228          

HSP 2 Score: 63.1586 bits (152), Expect = 1.834e-10
Identity = 35/110 (31.82%), Postives = 60/110 (54.55%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLR 1527
            AE+ K  GN   ++  Y  A+  Y++AI  +  +   Y NRAA ++KL  ++ A  DC++ I +DP + K Y R    L AM    +A   ++KAL ++P+ +  +  L+
Sbjct:   88 AEQLKNEGNNHMKEENYRCALDCYTQAIDLDLRNAVYYCNRAAAHSKLGNYTEATSDCERAIGIDPTYSKAYGRMGLALTAMNKYPEAISYFKKALVLDPDNDTYKSNLK 197          

HSP 3 Score: 58.9214 bits (141), Expect = 3.939e-9
Identity = 36/108 (33.33%), Postives = 56/108 (51.85%), Query Frame = 1
Query:  778 DLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            D+E+A  ++ E GN   K +N+  A+D YT+AI+LD  N  +Y N AA + +   Y +    C +++ I           +KAY R G A   +N    A  YF+K+L
Sbjct:   84 DIERAEQLKNE-GNNHMKEENYRCALDCYTQAIDLDLRNAVYYCNRAAAHSKLGNYTEATSDCERAIGID-------PTYSKAYGRMGLALTAMNKYPEAISYFKKAL 183          
BLAST of Stress-induced-phosphoprotein 1 vs. Planmine SMEST
Match: SMESG000011539.1 (SMESG000011539.1)

HSP 1 Score: 1113.21 bits (2878), Expect = 0.000e+0
Identity = 542/543 (99.82%), Postives = 543/543 (100.00%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 1737
            MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFY+KAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR
Sbjct:    1 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREYLKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYSKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILSDPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR 543          
BLAST of Stress-induced-phosphoprotein 1 vs. Planmine SMEST
Match: SMESG000002813.1 (SMESG000002813.1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.536e-17
Identity = 68/243 (27.98%), Postives = 114/243 (46.91%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQ----------EKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            G+   + K F  A+  YTKA+ LDS N   + NLA VY+EQ  Y+  ID   K++E+ + N  D      AY    NA  +  +++ A+K +  +L  +  P      N +    +EQ          +K   + P+ A     L ++   +G    A+ HY EAIK +P+    YSN    + +L +   A++   + IQ+ P F   +   A+      + ++A  +Y  AL+++PN  EA
Sbjct:  222 GHVFKEAKIFDRAVAAYTKALTLDSDNPILHGNLACVYYEQGLYDLAIDSYRKAIEL-QPNFPD------AYCNLANALKEKGNVLEAEKCYNTALRLN--PNHADSLNNLANIKREQGLNEEAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIKISPNFADAYSNMGNTFKELQDLPNAVQCYQRAIQIKPTFADAHSNLASVYKDTGNINEAIGSYTTALKIKPNYPEA 455          

HSP 2 Score: 60.4622 bits (145), Expect = 3.058e-9
Identity = 65/289 (22.49%), Postives = 122/289 (42.21%), Query Frame = 1
Query:  850 AIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEH--------RIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGL---RQSYMTSEDPEQMRKRAMQD-PEIQEILSDPAMQIIL-GQMQKDPAAFKEHLQ 1677
            AI FY +A++L       Y NLA+ +      +  I   +  + +   N   Y +     S  GN F  L  L  AK  + K++  +         +  I     ++   I   EK   ++P+  +    LG++  +   +  A+  Y++A+  + D+P L+ N A  Y +   + +A+    K I+L P F   Y   A  L    +  +A   Y  AL + PN  ++   L   ++    +E+   + K+A++  PE     S+ A  + L G +Q     ++E ++
Sbjct:   98 AISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAI---STYILVLNHNPELYHV----RSELGNLFKALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALTLDSDNPILHGNLACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIK 379          

HSP 3 Score: 56.6102 bits (135), Expect = 4.446e-8
Identity = 90/440 (20.45%), Postives = 171/440 (38.86%), Query Frame = 1
Query:  109 MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNRVIQSGD--------QRGMSLTSIFNDPNFIKKLENHPKTREYLKD--------PSFKMKMEMMKRDPKL---LNMMLQDQQILDVIAVGMDAEPDNFEIKPQNENNECDSSNKKENMNSKMEVD-------------LSDLEKAALIQKEKG-NEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAAC 1329
            M++   N GN+  + GQ+ EAI  Y +A+ +       Y N ++AF  A     A+      +   P      S      + + + +EA   Y K +   P       N+  + N     GD        ++ ++L     DPNF   L+ H       K+         ++   + +   +P L   L  +  +Q + D   + +D+     E++P   +  C+ +N  +   + +E +                L   A I++E+G NE         A++ Y KA+E+       ++NLA++   Q   +  ++   ++++I   N AD      AYS  GN F +L DL +A + +++++                           + P  A+    L ++    G   EA+  Y+ A+K  P+ P+ + N   C
Sbjct:   78 MAEAYSNLGNVFKEKGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIFN---AQGDIWLAIHHFEKAVTL-----DPNF---LDAHVNLGHVFKEAKIFDRAVAAYTKALTLDSDNPILHGNLACVYYEQGLYD---LAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNE--------EAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIKIS-PNFAD------AYSNMGNTFKELQDLPNAVQCYQRAIQ--------------------------IKPTFADAHSNLASVYKDTGNINEAIGSYTTALKIKPNYPEAFCNLTHC 462          
BLAST of Stress-induced-phosphoprotein 1 vs. Planmine SMEST
Match: SMESG000020957.1 (SMESG000020957.1)

HSP 1 Score: 82.4185 bits (202), Expect = 5.630e-17
Identity = 40/115 (34.78%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNR 456
            ++ LK +GN+ +      +A+ CY++AI +D  N V Y NR+AA+ K N  + A+ D    +K+   + K YSR   A   M ++DEAI  Y++ +  EPDN++  +NL     R
Sbjct:   58 AERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYTGMGKFDEAIVCYKRAIEIEPDNQNYTQNLQAAEER 172          

HSP 2 Score: 67.3958 bits (163), Expect = 5.607e-12
Identity = 42/153 (27.45%), Postives = 80/153 (52.29%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQS------------YMTSEDPEQMR--KRAMQDPEIQEILSDP 1614
            AE+ K  GN+   +  + +A+  YS+AI+ +P +   Y NRAA Y+KL +   A++DC   +++D K+ K Y R       M    +A   Y++A+E+EP+ +   + L+ +              T+  P+ +   + A+Q+ ++  IL++P
Sbjct:   58 AERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYTGMGKFDEAIVCYKRAIEIEPDNQNYTQNLQAAEERKSSGIPPPPSSTNAGPQSVPNIQSALQNFDLSSILNNP 210          

HSP 3 Score: 51.6026 bits (122), Expect = 7.626e-7
Identity = 39/114 (34.21%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  760 MEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            +EVD  D +KAA   K +GN       F  A+  Y+KAIELD  N  +Y N AA Y +  + E  I+ C+ +++I     A Y    KAYSR G A+  +     A   +++++
Sbjct:   48 VEVDEDD-KKAAERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKI----DAKY---GKAYSRMGLAYTGMGKFDEAIVCYKRAI 153          
BLAST of Stress-induced-phosphoprotein 1 vs. Planmine SMEST
Match: SMESG000020957.1 (SMESG000020957.1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.151e-17
Identity = 40/115 (34.78%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  112 SDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKANLYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFEPDNESVLRNLHELRNR 456
            ++ LK +GN+ +      +A+ CY++AI +D  N V Y NR+AA+ K N  + A+ D    +K+   + K YSR   A   M ++DEAI  Y++ +  EPDN++  +NL     R
Sbjct:   79 AERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYTGMGKFDEAIVCYKRAIEIEPDNQNYTQNLQAAEER 193          

HSP 2 Score: 67.781 bits (164), Expect = 5.062e-12
Identity = 42/153 (27.45%), Postives = 80/153 (52.29%), Query Frame = 1
Query: 1198 AEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEAREGLRQS------------YMTSEDPEQMR--KRAMQDPEIQEILSDP 1614
            AE+ K  GN+   +  + +A+  YS+AI+ +P +   Y NRAA Y+KL +   A++DC   +++D K+ K Y R       M    +A   Y++A+E+EP+ +   + L+ +              T+  P+ +   + A+Q+ ++  IL++P
Sbjct:   79 AERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYTGMGKFDEAIVCYKRAIEIEPDNQNYTQNLQAAEERKSSGIPPPPSSTNAGPQSVPNIQSALQNFDLSSILNNP 231          

HSP 3 Score: 51.6026 bits (122), Expect = 8.420e-7
Identity = 39/114 (34.21%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  760 MEVDLSDLEKAALIQKEKGNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL 1101
            +EVD  D +KAA   K +GN       F  A+  Y+KAIELD  N  +Y N AA Y +  + E  I+ C+ +++I     A Y    KAYSR G A+  +     A   +++++
Sbjct:   69 VEVDEDD-KKAAERLKTQGNICMGENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKID----AKY---GKAYSRMGLAYTGMGKFDEAIVCYKRAI 174          
BLAST of Stress-induced-phosphoprotein 1 vs. Planmine SMEST
Match: SMESG000004465.1 (SMESG000004465.1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.964e-14
Identity = 59/241 (24.48%), Postives = 112/241 (46.47%), Query Frame = 1
Query:  814 GNEAYKTKNFPAAIDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSL--------SEHRIPEIVKKCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPNCEEA 1512
            GN   + + F  A+  Y KA+ L   N   + NLA VY+EQ   E  ID   +++E+ + N  D      AY    NA  +   +  A++ +  +L        S + +  I ++    +  ++   +   + P+ A     L ++   +GK  EA+ HY EAI+ +P+    YSN      ++ + + A++   + IQ++P F   +   A+      + + A  +Y+ AL+++PN  +A
Sbjct:  224 GNVFKEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIEL-QPNFPD------AYCNLANALKEKGKVSEAEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFADAHSNLASIYKDTGNINDAISSYKTALKIKPNYHDA 457          

HSP 2 Score: 59.6918 bits (143), Expect = 4.423e-9
Identity = 55/227 (24.23%), Postives = 94/227 (41.41%), Query Frame = 1
Query:  853 IDFYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADYKLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRI-PEIVK----------KCNEVDRKIKEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKLYSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSKAADTYRKALEVEPN 1500
            ID +    +++  N      L+++YF+ ++ +K    C  +++   +       +A+AYS  GN   +   L  A + ++ +L   RI PE +               ++  I     +   NPDL      LGNL    G+  EA   Y +AI+  P     +SN    +    E  +A+   +K + LDP F+  YL         +   +A   Y KAL + PN
Sbjct:   37 IDLW----KIEPHNTAILLLLSSIYFQMRKLDKSGFFCQLAIKQNPQ-------MAEAYSNLGNVLKEKGQLAEAIENYKHAL---RIKPEFIDGYLNLAAAFVAAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDPNFLDAYLNLGNVFKEARIFDRAVTAYLKALNLAPN 249          
The following BLAST results are available for this feature:
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STIP10.000e+050.28stress induced phosphoprotein 1 [Source:HGNC Symbo... [more]
STIP10.000e+050.28stress induced phosphoprotein 1 [Source:HGNC Symbo... [more]
STIP13.957e-17047.34stress induced phosphoprotein 1 [Source:HGNC Symbo... [more]
STIP13.345e-4343.09stress induced phosphoprotein 1 [Source:HGNC Symbo... [more]
STIP12.457e-4155.28stress induced phosphoprotein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sti-14.098e-12858.04Stress-induced-phosphoprotein 1 [Source:UniProtKB... [more]
ogt-19.101e-1522.96UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
sgt-11.088e-1436.70Small Glutamine-rich Tetratrico repeat protein [S... [more]
ogt-11.476e-1422.96UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
ogt-11.476e-1422.96UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stip16.255e-13843.41gene:FBgn0024352 transcript:FBtr0078131[more]
CG431637.135e-1841.90gene:FBgn0262719 transcript:FBtr0305700[more]
CG431637.135e-1841.90gene:FBgn0262719 transcript:FBtr0308608[more]
Tpr21.425e-1542.53gene:FBgn0032586 transcript:FBtr0333486[more]
sxc5.273e-1526.56gene:FBgn0261403 transcript:FBtr0086085[more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stip10.000e+048.71stress-induced phosphoprotein 1 [Source:ZFIN;Acc:Z... [more]
stip11.240e-4043.90stress-induced phosphoprotein 1 [Source:ZFIN;Acc:Z... [more]
sgtb2.929e-1934.75small glutamine-rich tetratricopeptide repeat (TPR... [more]
sgta5.298e-1830.19small glutamine-rich tetratricopeptide repeat (TPR... [more]
sgta5.298e-1830.19small glutamine-rich tetratricopeptide repeat (TPR... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stip12.358e-952.01stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
stip11.646e-852.01stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
stip10.000e+052.01stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
stip12.630e-2152.22stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
stip10.000e+050.55stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stip10.000e+049.91stress-induced phosphoprotein 1 [Source:MGI Symbol... [more]
Sgtb2.725e-2134.39small glutamine-rich tetratricopeptide repeat (TPR... [more]
Sgtb3.321e-2134.39small glutamine-rich tetratricopeptide repeat (TPR... [more]
Rpap34.405e-2027.92RNA polymerase II associated protein 3 [Source:MGI... [more]
Sgta1.876e-1830.57small glutamine-rich tetratricopeptide repeat (TPR... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O54981|STIP1_CRIGR0.000e+050.28Stress-induced-phosphoprotein 1 OS=Cricetulus gris... [more]
sp|P31948|STIP1_HUMAN0.000e+050.28Stress-induced-phosphoprotein 1 OS=Homo sapiens OX... [more]
sp|Q3ZBZ8|STIP1_BOVIN0.000e+050.09Stress-induced-phosphoprotein 1 OS=Bos taurus OX=9... [more]
sp|O35814|STIP1_RAT0.000e+050.09Stress-induced-phosphoprotein 1 OS=Rattus norvegic... [more]
sp|Q4R8N7|STIP1_MACFA0.000e+049.91Stress-induced-phosphoprotein 1 OS=Macaca fascicul... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J5G90.000e+053.27TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A1I8GAJ90.000e+053.27TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A1S3KJ015.891e-1352.33stress-induced-phosphoprotein 1-like OS=Lingula un... [more]
A0A1I8GH114.205e-1252.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210Q5040.000e+051.61Stress-induced-phosphoprotein 1 OS=Mizuhopecten ye... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stip10.000e+048.82stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
stip13.662e-17248.58stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
rpap36.970e-2027.90RNA polymerase II associated protein 3 [Source:ZFI... [more]
sgtb1.156e-1836.17small glutamine-rich tetratricopeptide repeat (TPR... [more]
sgta1.164e-1832.19small glutamine rich tetratricopeptide repeat cont... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stip10.000e+048.99stress-induced phosphoprotein 1 [Source:ZFIN;Acc:Z... [more]
sgta7.209e-2034.46small glutamine-rich tetratricopeptide repeat (TPR... [more]
zgc:1230104.649e-1637.11zgc:123010 [Source:ZFIN;Acc:ZDB-GENE-051120-15][more]
ogt.12.365e-1524.48O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
ENSPMAT00000005772.12.774e-1429.76pep scaffold:Pmarinus_7.0:GL478792:23408:39519:-1 ... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STI17.217e-12238.01Hsp90 cochaperone; regulates spatial organization ... [more]
SGT23.744e-1537.19Glutamine-rich cytoplasmic cochaperone; serves as ... [more]
PPT11.051e-1033.33Protein serine/threonine phosphatase; regulates Hs... [more]
CNS14.621e-1034.38TPR-containing co-chaperone; binds both Hsp82p (Hs... [more]
TOM711.185e-741.67Mitochondrial outer membrane protein; probable min... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470731.637e-1323.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457166.713e-1335.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312072.622e-1237.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304688.844e-1130.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380452.892e-1029.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stip16.373e-2449.72stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
stip11.733e-16147.83stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
spag1a1.168e-2228.96sperm-associated antigen 1A [Source:NCBI gene;Acc:... [more]
sgtb2.916e-2038.30small glutamine rich tetratricopeptide repeat cont... [more]
sgtb3.095e-2038.30small glutamine rich tetratricopeptide repeat cont... [more]
back to top
BLAST of Stress-induced-phosphoprotein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011539.10.000e+099.82SMESG000011539.1[more]
SMESG000002813.15.536e-1727.98SMESG000002813.1[more]
SMESG000020957.15.630e-1734.78SMESG000020957.1[more]
SMESG000020957.17.151e-1734.78SMESG000020957.1[more]
SMESG000004465.17.964e-1424.48SMESG000004465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025738 ID=SMED30025738|Name=Stress-induced-phosphoprotein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1777bp
GTAACATAATGTTCTAGAACAAAAACTTTGTTTAATTATTGTCGATTCTA
GAATTTGCATATTTGATTATTTTATCTGCTGTAATTATTAAATTTTTTAT
TTTATTTAATGTCTGACGAATTAAAAAATAGAGGTAATTTAGCCTTGCAA
AGTGGTCAAATTCAGGAGGCAATTAAATGCTATAATGAAGCAATAACAAT
AGATGCAGGTAACCATGTTTTATATAGTAATAGATCCGCGGCTTTTTGTA
AAGCTAACCTTTATAAAGAAGCATTACTTGATGCAGAAGAGTGTATTAAA
TTGAAACCCAATTGGTCTAAAGGGTATTCAAGGAAGGCAGCTGCTCTTGA
ATTTATGAACAGATATGATGAGGCTATCGAAGCATACGAAAAAGTATTAT
CCTTTGAACCTGACAATGAATCAGTTCTCAGGAATCTGCATGAATTACGT
AATAGAGTTATTCAGAGTGGTGACCAGCGCGGAATGTCACTAACTTCTAT
ATTTAATGATCCAAATTTCATTAAAAAGTTGGAAAATCATCCTAAAACTC
GAGAATACTTAAAGGACCCTTCGTTTAAAATGAAGATGGAAATGATGAAA
AGAGATCCAAAACTTTTAAATATGATGTTGCAAGATCAGCAAATATTAGA
TGTTATTGCAGTTGGTATGGATGCAGAACCAGATAATTTTGAGATTAAAC
CACAAAATGAAAATAACGAATGTGACAGCTCAAACAAGAAAGAAAATATG
AATTCTAAAATGGAAGTGGACCTTTCAGATTTGGAGAAAGCTGCGTTGAT
TCAAAAAGAAAAGGGCAATGAAGCTTATAAAACCAAAAACTTTCCAGCTG
CTATTGATTTCTATACCAAAGCTATTGAGTTGGATTCAACTAATTGTACT
TTTTATACTAATTTAGCAGCTGTTTATTTTGAACAACAAGAATATGAAAA
GTGTATTGATCAGTGTAATAAATCTGTTGAGATTGGTAGAGAAAATAGAG
CTGATTACAAACTTATAGCAAAGGCTTATTCACGAGCTGGTAATGCATTT
CTTAAACTAAATGATTTAATATCAGCGAAAAAATATTTTGAAAAATCCTT
ATCAGAACACCGAATTCCAGAAATTGTGAAAAAATGCAATGAAGTAGATC
GAAAAATTAAAGAACAAGAAAAATTGGCTTACGTTAATCCAGACTTGGCG
GAAAAAGAAAAGCAATTAGGTAACTTGGAATTTCAAAAAGGAAAATATCC
AGAAGCTATGAAACATTATAGCGAGGCAATTAAAAGAAATCCAGACGATC
CAAAGTTATATAGTAATCGAGCAGCATGTTATACTAAATTAATGGAGTTT
AGCATGGCTTTAAAAGATTGTGACAAATGTATTCAATTGGATCCAAAGTT
TGTTAAAGGATATCTTCGTAAAGCTGCTTGCTTAGTAGCAATGAAAGACT
CATCTAAAGCTGCAGATACATACAGAAAAGCTTTAGAAGTAGAGCCAAAT
TGTGAGGAAGCGCGTGAAGGTTTAAGGCAATCTTACATGACTTCAGAAGA
TCCAGAGCAGATGCGTAAAAGAGCTATGCAAGATCCTGAAATTCAAGAAA
TATTAAGTGATCCCGCTATGCAGATAATTCTTGGACAAATGCAAAAAGAT
CCAGCGGCTTTTAAAGAACATCTTCAAAATCCTCAAGTAGCTGCAAAATT
ACAAAAATTGATGGAAAAAGGATTTATTGCTATTCGATGATTGGTTGTTG
TTAATAAATTCTAAAATATTAAAAAAA
back to top

protein sequence of SMED30025738-orf-1

>SMED30025738-orf-1 ID=SMED30025738-orf-1|Name=SMED30025738-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=544bp
MSDELKNRGNLALQSGQIQEAIKCYNEAITIDAGNHVLYSNRSAAFCKAN
LYKEALLDAEECIKLKPNWSKGYSRKAAALEFMNRYDEAIEAYEKVLSFE
PDNESVLRNLHELRNRVIQSGDQRGMSLTSIFNDPNFIKKLENHPKTREY
LKDPSFKMKMEMMKRDPKLLNMMLQDQQILDVIAVGMDAEPDNFEIKPQN
ENNECDSSNKKENMNSKMEVDLSDLEKAALIQKEKGNEAYKTKNFPAAID
FYTKAIELDSTNCTFYTNLAAVYFEQQEYEKCIDQCNKSVEIGRENRADY
KLIAKAYSRAGNAFLKLNDLISAKKYFEKSLSEHRIPEIVKKCNEVDRKI
KEQEKLAYVNPDLAEKEKQLGNLEFQKGKYPEAMKHYSEAIKRNPDDPKL
YSNRAACYTKLMEFSMALKDCDKCIQLDPKFVKGYLRKAACLVAMKDSSK
AADTYRKALEVEPNCEEAREGLRQSYMTSEDPEQMRKRAMQDPEIQEILS
DPAMQIILGQMQKDPAAFKEHLQNPQVAAKLQKLMEKGFIAIR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041243STI1
IPR019734TPR_repeat
IPR006636STI1_HS-bd
IPR011990TPR-like_helical_dom_sf
IPR001440TPR_1
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006636Heat shock chaperonin-bindingSMARTSM00727CBMcoord: 134..173
e-value: 1.9E-4
score: 30.7
coord: 492..531
e-value: 2.4E-7
score: 40.4
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 263..296
e-value: 0.0032
score: 26.7
coord: 432..465
e-value: 1.6E-4
score: 31.0
coord: 364..397
e-value: 7.5E-5
score: 32.1
coord: 304..337
e-value: 0.24
score: 20.5
coord: 398..431
e-value: 7.5E-7
score: 38.8
coord: 70..103
e-value: 3.3E-6
score: 36.6
coord: 229..262
e-value: 1.0E-4
score: 31.7
coord: 36..69
e-value: 5.4
score: 16.0
coord: 2..35
e-value: 1.5E-5
score: 34.4
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 433..465
e-value: 0.019
score: 15.2
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 364..397
score: 11.653
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 229..262
score: 8.673
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 263..296
score: 7.7
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 36..69
score: 5.93
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 432..465
score: 9.057
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 2..35
score: 9.411
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 70..103
score: 10.886
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 398..431
score: 8.791
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 304..337
score: 7.729
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 226..352
e-value: 1.1E-40
score: 140.6
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 353..477
e-value: 2.8E-45
score: 155.2
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 1..116
e-value: 5.2E-38
score: 131.6
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 5..468
NoneNo IPR availablePFAMPF13424TPR_12coord: 265..331
e-value: 1.4E-9
score: 38.1
NoneNo IPR availableGENE3DG3DSA:1.10.260.100coord: 478..542
e-value: 6.9E-22
score: 79.1
NoneNo IPR availableGENE3DG3DSA:1.10.260.100coord: 123..190
e-value: 4.3E-16
score: 60.8
NoneNo IPR availablePFAMPF13414TPR_11coord: 371..410
e-value: 9.3E-11
score: 41.2
NoneNo IPR availablePANTHERPTHR22904TPR REPEAT CONTAINING PROTEINcoord: 3..543
NoneNo IPR availablePANTHERPTHR22904:SF517STRESS-INDUCED-PHOSPHOPROTEIN 1coord: 3..543
IPR001440Tetratricopeptide repeat 1PFAMPF00515TPR_1coord: 71..103
e-value: 1.5E-7
score: 30.9
coord: 3..32
e-value: 2.7E-7
score: 30.1
IPR041243STI1 domainPFAMPF17830STI1coord: 134..185
e-value: 2.9E-13
score: 49.5
coord: 483..535
e-value: 1.4E-15
score: 57.0
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 2..103
score: 22.937
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 229..465
score: 31.358