SMED30025732

Overview
NameSMED30025732
Smed IDSMED30025732
Length (bp)1816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025732 (SMED30025732) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025732 (SMED30025732) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025732 (SMED30025732) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025732 (SMED30025732) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025732

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025732SMESG000043473.1 SMESG000043461.1 Contig208GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025732SMESG000000425.1 Contig208GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30025732SMESG000000426.1 SMESG000000425.1 dd_Smed_v4_1369_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025732SMESG000000426.1 SMESG000000425.1 dd_Smed_v4_1369_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025732SMESG000062314.1 SMESG000000426.1 OX_Smed_1.0.05065ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30025732 vs. Ensembl Human
Match: ATP6V1E1 (ATPase H+ transporting V1 subunit E1 [Source:HGNC Symbol;Acc:HGNC:857])

HSP 1 Score: 141.354 bits (355), Expect = 4.046e-53
Identity = 67/157 (42.68%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L  +  D  +Y+  +  L++QGL+QLLEP++I+RCR+ D  LV+  +++    Y+  T   +++ ++++  L ++IAGGVE+   + ++KV NTLESRL L++QQ++PE+R  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 4.046e-53
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Human
Match: ATP6V1E1 (ATPase H+ transporting V1 subunit E1 [Source:HGNC Symbol;Acc:HGNC:857])

HSP 1 Score: 111.309 bits (277), Expect = 3.732e-44
Identity = 58/157 (36.94%), Postives = 92/157 (58.60%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + +                              ++ GL+QLLEP++I+RCR+ D  LV+  +++    Y+  T   +++ ++++  L ++IAGGVE+   + ++KV NTLESRL L++QQ++PE+R  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLRARDD------------------------------LITGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 196          

HSP 2 Score: 88.1965 bits (217), Expect = 3.732e-44
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Human
Match: ATP6V1E2 (ATPase H+ transporting V1 subunit E2 [Source:HGNC Symbol;Acc:HGNC:18125])

HSP 1 Score: 110.538 bits (275), Expect = 4.932e-44
Identity = 65/153 (42.48%), Postives = 99/153 (64.71%), Query Frame = -2
Query: 1048 SNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFY 1506
            S M NQARLK+L  + + I D+L E + +L  +  DP  Y+  + +L++QGL +LLEP +I+RCR  D+ LVE  +++   +Y   +   +E+ ++++  L+   AGGVE+   N R+KV NTLESRL L ++Q +PEIR  LFG N NR F+
Sbjct:   73 STMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKFF 225          

HSP 2 Score: 88.5817 bits (218), Expect = 4.932e-44
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Human
Match: ATP6V1E2 (ATPase H+ transporting V1 subunit E2 [Source:HGNC Symbol;Acc:HGNC:18125])

HSP 1 Score: 110.538 bits (275), Expect = 4.932e-44
Identity = 65/153 (42.48%), Postives = 99/153 (64.71%), Query Frame = -2
Query: 1048 SNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFY 1506
            S M NQARLK+L  + + I D+L E + +L  +  DP  Y+  + +L++QGL +LLEP +I+RCR  D+ LVE  +++   +Y   +   +E+ ++++  L+   AGGVE+   N R+KV NTLESRL L ++Q +PEIR  LFG N NR F+
Sbjct:   73 STMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKFF 225          

HSP 2 Score: 88.5817 bits (218), Expect = 4.932e-44
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Human
Match: ATP6V1E1 (ATPase H+ transporting V1 subunit E1 [Source:HGNC Symbol;Acc:HGNC:857])

HSP 1 Score: 141.354 bits (355), Expect = 3.851e-41
Identity = 67/157 (42.68%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L  +  D  +Y+  +  L++QGL+QLLEP++I+RCR+ D  LV+  +++    Y+  T   +++ ++++  L ++IAGGVE+   + ++KV NTLESRL L++QQ++PE+R  LFG N NR F D
Sbjct:   48 IQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 204          

HSP 2 Score: 48.1358 bits (113), Expect = 3.851e-41
Identity = 30/69 (43.48%), Postives = 40/69 (57.97%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQ                      A+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQ----------------------AEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 47          
BLAST of SMED30025732 vs. Ensembl Celegans
Match: vha-8 (Vacuolar H ATPase [Source:UniProtKB/TrEMBL;Acc:Q95X44])

HSP 1 Score: 142.124 bits (357), Expect = 1.284e-38
Identity = 72/176 (40.91%), Postives = 116/176 (65.91%), Query Frame = -2
Query: 1045 QK*MNFSQXXXXXXXXXXKIQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1572
            QK M F +KK++     +KIQ SN +N  RL+ L  +++HI  VL+E +  L  ++ D  +Y   +K L++QGL QLLE +V++RCR+ D++LVE++L EC    +++     ++ +++   L  E AGGVEL    G++KV +TLESRL+L++ Q++P++R  LFG N NR F+D
Sbjct:   51 QKIMEFFEKKEKQVELQRKIQASNSLNAGRLRCLKAREDHIGAVLDEARSNLSRISGDAARYPAILKGLVMQGLLQLLEKEVVLRCREKDLRLVEQLLPECLDGLQKEWGSTTKVVLDKQNFLPSESAGGVELSARAGKIKVSSTLESRLELIANQIVPQVRTALFGPNPNRSFFD 226          

HSP 2 Score: 84.3445 bits (207), Expect = 3.223e-18
Identity = 40/69 (57.97%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            M ++D+DV+KQ+++M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ EFF K+EK++E ++K
Sbjct:    1 MGISDNDVQKQLRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRQKIMEFFEKKEKQVELQRK 69          
BLAST of SMED30025732 vs. Ensembl Celegans
Match: dhhc-4 (Zinc finger DHHC domain-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I0G4])

HSP 1 Score: 113.62 bits (283), Expect = 5.022e-27
Identity = 79/270 (29.26%), Postives = 130/270 (48.15%), Query Frame = -2
Query:   76 FPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI-------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEE-SMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI----PKEIIIHSEFVENFQKVFGKNIFTWFLPI 849
             P+++  L   W  +    ++ +  IDN  P +   L   + +LI +  SY+    +     P+++ +        ES  D E +   F S IA+ +            I++C  C  I+PDR+HHC+ C++CVL  DHHC W++NC+   N K F+LFL YG ++C  ++ TT   F++  + E  M      F LV +  LS +F +      FY+ +L   NR T+E      I     K+   H     N++++FG +   WFLP+
Sbjct:   23 LPVVLVSLATGWGIYAYTYELCILSIDN-WPQRIIYLFIFYALLILFYTSYLRTVYTKAWKPPQKYCIEGASKATYESVKDDERQLQLFLSDIARERDLTLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFLAYGFIFCIWIAATTLPSFIDFWRHEYDMNKKNGRFPLVFLLFLSCMFSLSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKYAKDAFNHG-IRANYREIFGSHPLYWFLPV 290          
BLAST of SMED30025732 vs. Ensembl Celegans
Match: dhhc-4 (Zinc finger DHHC domain-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I0G4])

HSP 1 Score: 108.227 bits (269), Expect = 4.921e-25
Identity = 82/301 (27.24%), Postives = 139/301 (46.18%), Query Frame = -2
Query:   76 VMKFKLLWKCFPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI-------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEE----------------------SMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI----PKEIIIHSEFVENFQKVFGKNIFTWFLPI 879
            ++K+KL+ +  P+++  L   W  +    ++ +  IDN  P +   L   + +LI +  SY+    +     P+++ +        ES  D E +   F S IA+ +            I++C  C  I+PDR+HHC+ C++CVL  DHHC W++NC+   N K F+LFL YG ++C  ++ TT   F++  + E                         L+   F LV +  LS +F +      FY+ +L   NR T+E      I     K+   H     N++++FG +   WFLP+
Sbjct:   16 LLKYKLV-RFLPVVLVSLATGWGIYAYTYELCILSIDN-WPQRIIYLFIFYALLILFYTSYLRTVYTKAWKPPQKYCIEGASKATYESVKDDERQLQLFLSDIARERDLTLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFLAYGFIFCIWIAATTLPSFIDFWRHEYDMNKKQYDSIDSVIQRNLKHLHTVLSNGRFPLVFLLFLSCMFSLSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKYAKDAFNHG-IRANYREIFGSHPLYWFLPV 313          
BLAST of SMED30025732 vs. Ensembl Celegans
Match: dhhc-4 (Zinc finger DHHC domain-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I0G4])

HSP 1 Score: 106.301 bits (264), Expect = 1.241e-24
Identity = 79/291 (27.15%), Postives = 131/291 (45.02%), Query Frame = -2
Query:   76 FPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI-------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEE----------------------SMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI----PKEIIIHSEFVENFQKVFGKNIFTWFLPI 849
             P+++  L   W  +    ++ +  IDN  P +   L   + +LI +  SY+    +     P+++ +        ES  D E +   F S IA+ +            I++C  C  I+PDR+HHC+ C++CVL  DHHC W++NC+   N K F+LFL YG ++C  ++ TT   F++  + E                         L+   F LV +  LS +F +      FY+ +L   NR T+E      I     K+   H     N++++FG +   WFLP+
Sbjct:   23 LPVVLVSLATGWGIYAYTYELCILSIDNW-PQRIIYLFIFYALLILFYTSYLRTVYTKAWKPPQKYCIEGASKATYESVKDDERQLQLFLSDIARERDLTLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFLAYGFIFCIWIAATTLPSFIDFWRHEYDMNKKQYDSIDSVIQRNLKHLHTVLSNGRFPLVFLLFLSCMFSLSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKYAKDAFNHG-IRANYREIFGSHPLYWFLPV 311          
BLAST of SMED30025732 vs. Ensembl Celegans
Match: dhhc-4 (Zinc finger DHHC domain-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I0G4])

HSP 1 Score: 105.531 bits (262), Expect = 3.711e-24
Identity = 79/291 (27.15%), Postives = 131/291 (45.02%), Query Frame = -2
Query:   76 FPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI-------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEE----------------------SMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI----PKEIIIHSEFVENFQKVFGKNIFTWFLPI 849
             P+++  L   W  +    ++ +  IDN  P +   L   + +LI +  SY+    +     P+++ +        ES  D E +   F S IA+ +            I++C  C  I+PDR+HHC+ C++CVL  DHHC W++NC+   N K F+LFL YG ++C  ++ TT   F++  + E                         L+   F LV +  LS +F +      FY+ +L   NR T+E      I     K+   H     N++++FG +   WFLP+
Sbjct:   23 LPVVLVSLATGWGIYAYTYELCILSIDN-WPQRIIYLFIFYALLILFYTSYLRTVYTKAWKPPQKYCIEGASKATYESVKDDERQLQLFLSDIARERDLTLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFLAYGFIFCIWIAATTLPSFIDFWRHEYDMNKKQYDSIDSVIQRNLKHLHTVLSNGRFPLVFLLFLSCMFSLSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKYAKDAFNHG-IRANYREIFGSHPLYWFLPV 311          
BLAST of SMED30025732 vs. Ensembl Fly
Match: Vha26 (gene:FBgn0283535 transcript:FBtr0346137)

HSP 1 Score: 164.466 bits (415), Expect = 2.269e-59
Identity = 78/157 (49.68%), Postives = 113/157 (71.97%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++H+  VL++ +K+L  +T +  +Y+  + +LIVQGLFQ++EPKVI+RCR+ D+ LV  +L     +Y+ + +  +EL ++    LS +  GGVEL+  NGR+KV NTLESRL L+SQQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          

HSP 2 Score: 85.1149 bits (209), Expect = 2.269e-59
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++E +KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. Ensembl Fly
Match: Vha26 (gene:FBgn0283535 transcript:FBtr0078701)

HSP 1 Score: 164.466 bits (415), Expect = 2.269e-59
Identity = 78/157 (49.68%), Postives = 113/157 (71.97%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++H+  VL++ +K+L  +T +  +Y+  + +LIVQGLFQ++EPKVI+RCR+ D+ LV  +L     +Y+ + +  +EL ++    LS +  GGVEL+  NGR+KV NTLESRL L+SQQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          

HSP 2 Score: 85.1149 bits (209), Expect = 2.269e-59
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++E +KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. Ensembl Fly
Match: Vha26 (gene:FBgn0283535 transcript:FBtr0078700)

HSP 1 Score: 164.466 bits (415), Expect = 2.269e-59
Identity = 78/157 (49.68%), Postives = 113/157 (71.97%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++H+  VL++ +K+L  +T +  +Y+  + +LIVQGLFQ++EPKVI+RCR+ D+ LV  +L     +Y+ + +  +EL ++    LS +  GGVEL+  NGR+KV NTLESRL L+SQQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          

HSP 2 Score: 85.1149 bits (209), Expect = 2.269e-59
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++E +KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. Ensembl Fly
Match: CG1407 (gene:FBgn0033474 transcript:FBtr0088435)

HSP 1 Score: 125.176 bits (313), Expect = 2.965e-31
Identity = 80/273 (29.30%), Postives = 148/273 (54.21%), Query Frame = -2
Query:   76 LWKCFPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVL--ESFPDQEAR--STFFKSIIAKGKLPISQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITT---FVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEF----LYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 861
            ++K  P++    +I W+Y+  ++++ + R   +R    F+L+F HL L  ++WSY     ++   +P+Q+ +  E++  L     PD + R  + F + +    +     +++C  C++I+PDRAHHC+ C  CVL MDHHC W++NC+  +N K F+LFL Y  +YC  V+ T+   FV F  +   +     +  F+++ +F ++ +F I  +    Y+ +L++ NR T+E     ++    P +   +     NF +VFG +   WFLP+
Sbjct:   19 VFKWIPVLFITAVIAWSYYAYVVELCI-RNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPV 290          
BLAST of SMED30025732 vs. Ensembl Fly
Match: CG1407 (gene:FBgn0033474 transcript:FBtr0330325)

HSP 1 Score: 125.176 bits (313), Expect = 3.416e-31
Identity = 80/273 (29.30%), Postives = 148/273 (54.21%), Query Frame = -2
Query:   76 LWKCFPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVL--ESFPDQEAR--STFFKSIIAKGKLPISQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITT---FVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEF----LYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 861
            ++K  P++    +I W+Y+  ++++ + R   +R    F+L+F HL L  ++WSY     ++   +P+Q+ +  E++  L     PD + R  + F + +    +     +++C  C++I+PDRAHHC+ C  CVL MDHHC W++NC+  +N K F+LFL Y  +YC  V+ T+   FV F  +   +     +  F+++ +F ++ +F I  +    Y+ +L++ NR T+E     ++    P +   +     NF +VFG +   WFLP+
Sbjct:   19 VFKWIPVLFITAVIAWSYYAYVVELCI-RNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLPV 290          
BLAST of SMED30025732 vs. Ensembl Zebrafish
Match: atp6v1e1b (ATPase H+ transporting V1 subunit E1b [Source:ZFIN;Acc:ZDB-GENE-020419-11])

HSP 1 Score: 162.155 bits (409), Expect = 1.605e-59
Identity = 75/157 (47.77%), Postives = 112/157 (71.34%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L + +++L N+  DP +Y   M  L++QG +QLLEPKV IRCR+ D+ +V+  +++  S Y+      LE+ +++D  LS EI+GG+EL   +G++KV NTLESRL+L++QQ++PEIR  LFG N+NR F D
Sbjct:   70 IQMSNLMNQARLKVLKARDDMIADLLNDARQRLANVARDPSRYAALMDGLVLQGFYQLLEPKVTIRCRKQDVGIVQAAVQKNISIYKAAVKNNLEVRIDQDNFLSPEISGGIELYNADGKIKVANTLESRLELIAQQMMPEIRVALFGANQNRKFMD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 1.605e-59
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Zebrafish
Match: atp6v1e1a (ATPase H+ transporting V1 subunit E1a [Source:ZFIN;Acc:ZDB-GENE-041212-51])

HSP 1 Score: 149.443 bits (376), Expect = 2.159e-54
Identity = 69/157 (43.95%), Postives = 111/157 (70.70%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I+D+L + +++L  +  DP++Y+  ++ L++QG +QLLE +VIIRCR+ D+ +V+  +++    Y+E     +E+ ++ +  LS +I+GGVE+   +GR+K  NTLESRL LL+QQ++P+IR  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLKARDDMIKDLLNDARERLATIAKDPNQYQTLLEGLVLQGFYQLLESRVIIRCRKEDVAMVQTAVQKNIPIYKEAVKSNIEVRIDENTFLSPDISGGVEVYNADGRIKASNTLESRLDLLAQQMMPDIRVSLFGANPNRKFTD 226          

HSP 2 Score: 84.3445 bits (207), Expect = 2.159e-54
Identity = 42/69 (60.87%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D  V+KQIK+M++FI+QEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDAAVQKQIKHMMAFIDQEASEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Zebrafish
Match: zdhhc20a (zinc finger DHHC-type containing 20a [Source:ZFIN;Acc:ZDB-GENE-070424-38])

HSP 1 Score: 132.88 bits (333), Expect = 1.111e-33
Identity = 87/266 (32.71%), Postives = 140/266 (52.63%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI---PKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   L++CW+Y+  ++++ ++ I N    +   L+  H     ++WSY    SS P    ++F L K + E+ E     EA+    K +  +  LPI        I+YC  C++I+PDR HHC+ C +CVL MDHHC W++NC+G  N K F+LFL Y  LYC  ++ T   YF+     + +  T  +F+++ +F ++++FFI  L    Y+ +L+  NR TIE          P +      F +N  +VFG     W LPI
Sbjct:   18 PVIFINLVVCWSYYAYVVELCIYTIPNVN-EQVIYLVVFHAFFFMFMWSYWKTISSKPTNPSKEFCLPKAEKELYEKEERPEAQQDILKRVARE--LPIYTFTGSGAIRYCDRCQLIKPDRCHHCSTCDKCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSMLYCVYIAATVLQYFIKFWTNQ-LPDTHAKFHVLFLFFVAAMFFISILSLFSYHLWLVGKNRTTIEAFRAPVFRNGPDKNGFTLGFRKNITQVFGDQKKYWCLPI 279          
BLAST of SMED30025732 vs. Ensembl Zebrafish
Match: zdhhc2 (zinc finger DHHC-type palmitoyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-050320-58])

HSP 1 Score: 130.183 bits (326), Expect = 9.834e-33
Identity = 87/268 (32.46%), Postives = 139/268 (51.87%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLY-----HSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   L++ W+Y+  ++Q+ +  I+N    K   L+  HL+ + ++WSY     S P    ++FHLS  D E+LE    +E++    + I     LPI        I+YC  C +++PDR HHC+ C  C+L MDHHC W++NC+G  N K F+LFL Y  LYC  V+ T   YF+       +  T  +F+++ +F  +S F +       Y+ +L+  NR T+E        H T      + +   +NF++VFG     W LPI
Sbjct:   19 PVLFISLIVAWSYYAYVVQLCIETIENMG-EKTVYLLIYHLLFLMFVWSYWQTIYSKPMNPLKEFHLSHVDKELLEREDRRESQQEILRRIAKD--LPIYTRTMSGAIRYCDRCLLLKPDRCHHCSACDMCILKMDHHCPWVNNCVGFANYKFFMLFLAYSLLYCLFVTATDMQYFIQFWT-NGLPDTQAKFHIMFLFFAASTFSVSLAFLFAYHCWLVCKNRSTLEAFRAPAFQHGTDKNGFSLGA--YKNFRQVFGDEKKYWLLPI 280          
BLAST of SMED30025732 vs. Ensembl Zebrafish
Match: zdhhc2 (zinc finger DHHC-type palmitoyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-050320-58])

HSP 1 Score: 129.413 bits (324), Expect = 1.743e-32
Identity = 87/268 (32.46%), Postives = 139/268 (51.87%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLY-----HSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   L++ W+Y+  ++Q+ +  I+N    K   L+  HL+ + ++WSY     S P    ++FHLS  D E+LE    +E++    + I     LPI        I+YC  C +++PDR HHC+ C  C+L MDHHC W++NC+G  N K F+LFL Y  LYC  V+ T   YF+       +  T  +F+++ +F  +S F +       Y+ +L+  NR T+E        H T      + +   +NF++VFG     W LPI
Sbjct:   19 PVLFISLIVAWSYYAYVVQLCIETIENMG-EKTVYLLIYHLLFLMFVWSYWQTIYSKPMNPLKEFHLSHVDKELLEREDRRESQQEILRRIAKD--LPIYTRTMSGAIRYCDRCLLLKPDRCHHCSACDMCILKMDHHCPWVNNCVGFANYKFFMLFLAYSLLYCLFVTATDMQYFIQFWT-NGLPDTQAKFHIMFLFFAASTFSVSLAFLFAYHCWLVCKNRSTLEAFRAPAFQHGTDKNGFSLGA--YKNFRQVFGDEKKYWLLPI 280          
BLAST of SMED30025732 vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 152.525 bits (384), Expect = 1.518e-56
Identity = 74/157 (47.13%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + +HI ++L E +++L  +  D  +Y+  +  LI+QGLFQLLEP+V+IRCR+ D  L+   +++    Y+  T   +E+ ++++  L  EIAGGVEL   +G++KV NTLESRL L++QQ++PEIR  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 226          

HSP 2 Score: 88.9669 bits (219), Expect = 1.518e-56
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 152.14 bits (383), Expect = 4.117e-52
Identity = 74/157 (47.13%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + +HI ++L E +++L  +  D  +Y+  +  LI+QGLFQLLEP+V+IRCR+ D  L+   +++    Y+  T   +E+ ++++  L  EIAGGVEL   +G++KV NTLESRL L++QQ++PEIR  LFG N NR F D
Sbjct:   66 IQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 222          

HSP 2 Score: 74.3294 bits (181), Expect = 4.117e-52
Identity = 39/69 (56.52%), Postives = 54/69 (78.26%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            M +TD      IK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MNMTDGG----IKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 65          
BLAST of SMED30025732 vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 151.754 bits (382), Expect = 5.877e-52
Identity = 74/157 (47.13%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + +HI ++L E +++L  +  D  +Y+  +  LI+QGLFQLLEP+V+IRCR+ D  L+   +++    Y+  T   +E+ ++++  L  EIAGGVEL   +G++KV NTLESRL L++QQ++PEIR  LFG N NR F D
Sbjct:   69 IQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 225          

HSP 2 Score: 74.3294 bits (181), Expect = 5.877e-52
Identity = 36/59 (61.02%), Postives = 51/59 (86.44%), Query Frame = -1
Query: 1517 QIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1693
            QI++M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:   10 QIRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 68          
BLAST of SMED30025732 vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 152.14 bits (383), Expect = 9.343e-52
Identity = 74/157 (47.13%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + +HI ++L E +++L  +  D  +Y+  +  LI+QGLFQLLEP+V+IRCR+ D  L+   +++    Y+  T   +E+ ++++  L  EIAGGVEL   +G++KV NTLESRL L++QQ++PEIR  LFG N NR F D
Sbjct:   72 IQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 228          

HSP 2 Score: 73.1738 bits (178), Expect = 9.343e-52
Identity = 36/58 (62.07%), Postives = 50/58 (86.21%), Query Frame = -1
Query: 1517 IKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1690
            IK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:   14 IKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 71          
BLAST of SMED30025732 vs. Ensembl Xenopus
Match: zdhhc2 (zinc finger DHHC-type containing 2 [Source:NCBI gene;Acc:779681])

HSP 1 Score: 135.961 bits (341), Expect = 1.562e-34
Identity = 85/268 (31.72%), Postives = 140/268 (52.24%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIE-----FLYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   +++CW+Y+  +IQ+ +  +DN    K   LI  H  L+ ++WSY     + P    ++FHLS  D E+LE  P  E++    + +     LP+        I+YC  C++++PDR HHC+ C +C+L MDHHC W++NC+G  N K FLLFL Y  LYC  +  T   YF+       +  T  +F+++ +F  +++F +       Y+ +L+  NR T+E        H T      +   F +N ++VFG     W LP+
Sbjct:   21 PVLFISIIVCWSYYAYVIQLCIVTMDNI-AEKILCLIAYHFFLLHFVWSYWKTIFTLPMNPAKEFHLSYSDKELLEREPRGESQQDILRRLAKD--LPVYTRTMSGAIRYCDRCQLVKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIVATDLQYFVKFWT-NGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVCKNRSTLEAFRAPVFRHGTDKNGFSL--GFSKNLRQVFGDEKKYWLLPV 282          
BLAST of SMED30025732 vs. Ensembl Mouse
Match: Atp6v1e1 (ATPase, H+ transporting, lysosomal V1 subunit E1 [Source:MGI Symbol;Acc:MGI:894326])

HSP 1 Score: 142.895 bits (359), Expect = 9.899e-54
Identity = 68/157 (43.31%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L  +  D  +Y+  +  L++QGL+QLLEP++I+RCR+ D  LV+  +++    Y+  T   +++ ++++  L +EIAGGVE+   + ++KV NTLESRL L++QQ++PE+R  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 9.899e-54
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Mouse
Match: Atp6v1e2 (ATPase, H+ transporting, lysosomal V1 subunit E2 [Source:MGI Symbol;Acc:MGI:1922165])

HSP 1 Score: 98.2117 bits (243), Expect = 1.467e-40
Identity = 60/156 (38.46%), Postives = 96/156 (61.54%), Query Frame = -2
Query: 1048 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFY 1515
            IQ S M NQAR+ +L  +   I ++L++ + +L  + +D   Y++ + +L++Q L +LLEP +I+RCR  D+ LVE  +     +Y       LE+ V++ + L    AGGVE+   + ++KV NTLESRL L + Q +PEIR +LFG N +R F+
Sbjct:   70 IQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKFF 225          

HSP 2 Score: 88.9669 bits (219), Expect = 1.467e-40
Identity = 45/69 (65.22%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MALTD DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ ++F K+EK++EQ+KK
Sbjct:    1 MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Mouse
Match: Atp6v1e2 (ATPase, H+ transporting, lysosomal V1 subunit E2 [Source:MGI Symbol;Acc:MGI:1922165])

HSP 1 Score: 98.2117 bits (243), Expect = 1.467e-40
Identity = 60/156 (38.46%), Postives = 96/156 (61.54%), Query Frame = -2
Query: 1048 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFY 1515
            IQ S M NQAR+ +L  +   I ++L++ + +L  + +D   Y++ + +L++Q L +LLEP +I+RCR  D+ LVE  +     +Y       LE+ V++ + L    AGGVE+   + ++KV NTLESRL L + Q +PEIR +LFG N +R F+
Sbjct:   70 IQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKFF 225          

HSP 2 Score: 88.9669 bits (219), Expect = 1.467e-40
Identity = 45/69 (65.22%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MALTD DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ ++F K+EK++EQ+KK
Sbjct:    1 MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Mouse
Match: Atp6v1e2 (ATPase, H+ transporting, lysosomal V1 subunit E2 [Source:MGI Symbol;Acc:MGI:1922165])

HSP 1 Score: 98.2117 bits (243), Expect = 1.467e-40
Identity = 60/156 (38.46%), Postives = 96/156 (61.54%), Query Frame = -2
Query: 1048 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFY 1515
            IQ S M NQAR+ +L  +   I ++L++ + +L  + +D   Y++ + +L++Q L +LLEP +I+RCR  D+ LVE  +     +Y       LE+ V++ + L    AGGVE+   + ++KV NTLESRL L + Q +PEIR +LFG N +R F+
Sbjct:   70 IQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKFF 225          

HSP 2 Score: 88.9669 bits (219), Expect = 1.467e-40
Identity = 45/69 (65.22%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MALTD DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ ++F K+EK++EQ+KK
Sbjct:    1 MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Mouse
Match: Zdhhc2 (zinc finger, DHHC domain containing 2 [Source:MGI Symbol;Acc:MGI:1923452])

HSP 1 Score: 131.339 bits (329), Expect = 4.585e-33
Identity = 85/268 (31.72%), Postives = 138/268 (51.49%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIE-----FLYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   LL+ W+Y+   IQ+ +  ++N    +   L+  HL+   ++WSY     + P    ++FHLS  + E+LE  P  EA     +   A   LPI        I+YC  C++I+PDR HHC+ C +C+L MDHHC W++NC+G  N K FLLFL Y  LYC  ++ T   YF+       +  T  +F+++ +F  +++F +       Y+ +L+  N+ T+E        H T      +   F +N ++VFG     W LP+
Sbjct:   21 PVVFISLLLGWSYYAYAIQLCIVSMENIG-EQVVCLMAYHLLFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRR--AAKDLPIYTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIRFWT-NGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRNPVFRHGTDKNGFSL--GFSKNMRQVFGDEKKYWLLPV 282          
BLAST of SMED30025732 vs. UniProt/SwissProt
Match: sp|P54611|VATE_DROME (V-type proton ATPase subunit E OS=Drosophila melanogaster OX=7227 GN=Vha26 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.734e-58
Identity = 78/157 (49.68%), Postives = 113/157 (71.97%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++H+  VL++ +K+L  +T +  +Y+  + +LIVQGLFQ++EPKVI+RCR+ D+ LV  +L     +Y+ + +  +EL ++    LS +  GGVEL+  NGR+KV NTLESRL L+SQQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          

HSP 2 Score: 85.1149 bits (209), Expect = 1.734e-58
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++E +KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. UniProt/SwissProt
Match: sp|P31402|VATE_MANSE (V-type proton ATPase subunit E OS=Manduca sexta OX=7130 GN=VHA26 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 4.333e-55
Identity = 75/157 (47.77%), Postives = 106/157 (67.52%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++H+R+VL+E +K+L  +  D   Y + +  LIVQ LFQL+EP V +R RQ+D  LVE +L      Y+ K    + L ++ +  L  +  GG+ELI   GR+K+ NTLESRL+L++QQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKVREDHVRNVLDEARKRLAEVPKDIKLYSDLLVTLIVQALFQLVEPTVTLRVRQADKALVESLLGRAQQDYKAKIKKDVVLKIDNENFLPPDTCGGIELIAAKGRIKISNTLESRLELIAQQLLPEIRNALFGRNPNRKFTD 226          

HSP 2 Score: 85.1149 bits (209), Expect = 4.333e-55
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++E +KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. UniProt/SwissProt
Match: sp|P50518|VATE1_MOUSE (V-type proton ATPase subunit E 1 OS=Mus musculus OX=10090 GN=Atp6v1e1 PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 5.996e-53
Identity = 68/157 (43.31%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L  +  D  +Y+  +  L++QGL+QLLEP++I+RCR+ D  LV+  +++    Y+  T   +++ ++++  L +EIAGGVE+   + ++KV NTLESRL L++QQ++PE+R  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 5.996e-53
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. UniProt/SwissProt
Match: sp|P11019|VATE1_BOVIN (V-type proton ATPase subunit E 1 OS=Bos taurus OX=9913 GN=ATP6V1E1 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 6.250e-53
Identity = 68/157 (43.31%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L  +  D  +Y+  +  L++QGL+QLLEP++I+RCR+ D  LV+  +++    Y+  T   +++ ++++  L +EIAGGVE+   + ++KV NTLESRL L++QQ++PE+R  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPVYKVATKRDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 6.250e-53
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. UniProt/SwissProt
Match: sp|Q4R761|VATE1_MACFA (V-type proton ATPase subunit E 1 OS=Macaca fascicularis OX=9541 GN=ATP6V1E1 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.775e-52
Identity = 67/157 (42.68%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L  +  D  +Y+  +  L++QGL+QLLEP++I+RCR+ D  LV+  +++    Y+  T   +++ ++++  L ++IAGGVE+   + ++KV NTLESRL L++QQ++PE+R  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 1.775e-52
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. TrEMBL
Match: A0A482WJ84 (Uncharacterized protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR008199 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.256e-59
Identity = 86/157 (54.78%), Postives = 118/157 (75.16%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK L  +++H+R VLEE++K+L  +T +P KYKE ++ LIVQGL QLLEP VI+R R++D+ LVE IL  CA +Y + T  ++ + V+++  L  E+ GGVE+   +GR+KV NTLESRL+L+SQQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKALKVREDHVRSVLEESRKRLGEVTRNPSKYKEVLQYLIVQGLLQLLEPNVILRVREADVSLVEGILGLCADQYTKLTTKEVSIRVDQETFLPAELCGGVEVFARSGRIKVPNTLESRLELISQQLVPEIRVALFGRNPNRKFSD 226          

HSP 2 Score: 85.8853 bits (211), Expect = 2.256e-59
Identity = 42/69 (60.87%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ ++EK++E +KK
Sbjct:    1 MALSDADVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQHQRLKIMEYYDRKEKQVELQKK 69          
BLAST of SMED30025732 vs. TrEMBL
Match: A0A1I9WLK6 (Seminal fluid protein OS=Nilaparvata lugens OX=108931 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.298e-58
Identity = 83/157 (52.87%), Postives = 115/157 (73.25%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK L  +++H+R VLEE++K+L  +T +P KYKE ++ LIVQGL QLLE  V++R R++D+ L+E I+  CA +Y + T  ++ + ++ D  L+ E  GGVEL   NGR+K+ NTLESRL L+SQQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKALKVREDHVRSVLEESRKRLGEVTRNPAKYKEVLQYLIVQGLLQLLESNVVLRVREADVSLIEGIVGSCAEQYAKMTGKEVVVKLDADNFLAAETCGGVELFARNGRIKIPNTLESRLDLISQQLVPEIRVALFGRNPNRKFSD 226          

HSP 2 Score: 85.8853 bits (211), Expect = 1.298e-58
Identity = 42/69 (60.87%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ ++EK++E +KK
Sbjct:    1 MALSDADVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQHQRLKIMEYYDRKEKQVELQKK 69          
BLAST of SMED30025732 vs. TrEMBL
Match: A0A0A1WG85 (V-type proton ATPase subunit E OS=Zeugodacus cucurbitae OX=28588 GN=Vha26_1 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.082e-58
Identity = 77/157 (49.04%), Postives = 118/157 (75.16%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++H+R+VL+E +++L  +TN+P +YKE +++LI+Q L+Q +EP V +RCRQ+D+ L+ E+L     +Y+++    + + ++ D  LS +  GG+ELI  NGR+KV NTLESRL+L++QQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKVREDHVRNVLDEARRRLGEVTNNPSEYKEVLQKLILQALYQAMEPSVTLRCRQADVGLINEVLPATVEEYKKQIGKDVNVHIDTDNHLSADTCGGIELIALNGRLKVPNTLESRLELIAQQLVPEIRNALFGRNVNRKFTD 226          

HSP 2 Score: 85.8853 bits (211), Expect = 2.082e-58
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++E +KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. TrEMBL
Match: A0A2P6KBS1 (V-type proton ATPase subunit E OS=Nephila clavipes OX=2585209 GN=NCL1_45520 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.312e-58
Identity = 84/157 (53.50%), Postives = 116/157 (73.89%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++HIR VLEE +K+L+  T D  +Y+E +K LI+Q +FQLLEP+V IRCR+ D+ LVE+ L   A +Y+E    + +++V++D  LS E AGG+EL    G++K+ NTLESRL ++SQQL+PEIRE LFG N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKAREDHIRAVLEEAKKKLHTKTKDSAQYQEVLKNLILQAVFQLLEPEVSIRCRKQDMDLVEKALSTVAKEYQEVVGKQCKVNVDKDNYLSPECAGGIELTAQKGKIKINNTLESRLDMISQQLLPEIRETLFGPNPNRKFKD 226          

HSP 2 Score: 83.9593 bits (206), Expect = 3.312e-58
Identity = 44/73 (60.27%), Postives = 63/73 (86.30%), Query Frame = -1
Query: 1508 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLE-QRKKNST 1723
            M+L+D+DV+KQI +M++FIEQEA EKV+EI++K++EEF IEK RLVQ+QR K+ E+F K+EK++E QRK  S+
Sbjct:    1 MSLSDEDVQKQINHMMAFIEQEANEKVEEIDAKSEEEFNIEKGRLVQEQRLKIMEYFDKKEKQVELQRKIQSS 73          
BLAST of SMED30025732 vs. TrEMBL
Match: A0A034VVJ5 (V-type proton ATPase subunit E OS=Bactrocera dorsalis OX=27457 GN=VATE PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 6.756e-58
Identity = 77/157 (49.04%), Postives = 117/157 (74.52%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SNM+NQARLK+L  +++H+R+VL+E +++L  +T +P +YKE +++LI+Q L+Q +EP V +RCRQ+DI L+ E+L     +Y+++    + + ++ D  LS +  GG+ELI  NGR+KV NTLESRL+L++QQL+PEIR  LFG+N NR F D
Sbjct:   70 IQSSNMLNQARLKVLKVREDHVRNVLDEARRRLGEVTKNPSEYKEVLQKLILQALYQAMEPSVTLRCRQADIGLINEVLPATVEEYKQQIGKDVNVHIDTDNHLSADTCGGIELIALNGRLKVPNTLESRLELIAQQLVPEIRNALFGRNVNRKFTD 226          

HSP 2 Score: 85.8853 bits (211), Expect = 6.756e-58
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++E +KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. Ensembl Cavefish
Match: atp6v1e1b (V-type proton ATPase subunit E 1-like [Source:NCBI gene;Acc:103026244])

HSP 1 Score: 154.451 bits (389), Expect = 3.050e-57
Identity = 72/157 (45.86%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L N+  DP +Y   +  L++QG +QLLEPKV IRCR+ D+ L++  +++    Y+      LE+ +++D  L  EI+GG+E+   +G++KV NTLESRL L++QQ++PEIR  LFG N+NR F D
Sbjct:   70 IQMSNLMNQARLKVLKARDDMISDMLNEARQRLANVARDPSRYSALIDGLVLQGFYQLLEPKVTIRCRKQDLALLQASVQKNIPIYKAAAKNNLEVRIDQDNFLPAEISGGIEIYNADGKIKVSNTLESRLDLIAQQMMPEIRVALFGANQNRKFMD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 3.050e-57
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Cavefish
Match: atp6v1e1a (V-type proton ATPase subunit E 1-like [Source:NCBI gene;Acc:103026420])

HSP 1 Score: 160.229 bits (404), Expect = 2.818e-53
Identity = 76/157 (48.41%), Postives = 114/157 (72.61%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            I+ SN+MNQARLK+L  + + + D+L E +K+L ++  DP KY   ++ L++QG +Q LEPKVIIRCR+ D+ LVE  +++    Y+E     +E+S+++D  LS +++GGVE+   NG++KV NTLESRL+LL+QQ++PEIR  LFG N+NR F D
Sbjct:   70 IRMSNLMNQARLKVLKTRDDMVTDLLNEARKRLADIAKDPAKYSMLLEGLVLQGFYQQLEPKVIIRCRKEDVALVEGAVQKNIPIYKETVKRNIEVSIDKDNFLSPDVSGGVEVYNANGKIKVSNTLESRLELLAQQMMPEIRVELFGANQNRKFMD 226          

HSP 2 Score: 69.3218 bits (168), Expect = 2.818e-53
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +E+ +KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEVEAKAEEEFNIEKGRLVQTQRVKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Cavefish
Match: atp6v1e1a (V-type proton ATPase subunit E 1-like [Source:NCBI gene;Acc:103026420])

HSP 1 Score: 123.25 bits (308), Expect = 3.394e-42
Identity = 66/157 (42.04%), Postives = 95/157 (60.51%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            I+ SN+MNQARLK+L  + +                              +V G +Q LEPKVIIRCR+ D+ LVE  +++    Y+E     +E+S+++D  LS +++GGVE+   NG++KV NTLESRL+LL+QQ++PEIR  LFG N+NR F D
Sbjct:   70 IRMSNLMNQARLKVLKTRDD------------------------------MVTGFYQQLEPKVIIRCRKEDVALVEGAVQKNIPIYKETVKRNIEVSIDKDNFLSPDVSGGVEVYNANGKIKVSNTLESRLELLAQQMMPEIRVELFGANQNRKFMD 196          

HSP 2 Score: 69.3218 bits (168), Expect = 3.394e-42
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +E+ +KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEVEAKAEEEFNIEKGRLVQTQRVKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Cavefish
Match: zdhhc20a (zinc finger DHHC-type containing 20a [Source:ZFIN;Acc:ZDB-GENE-070424-38])

HSP 1 Score: 125.561 bits (314), Expect = 2.053e-31
Identity = 83/265 (31.32%), Postives = 136/265 (51.32%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFL--YHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   L++CW+Y+  ++Q+ ++ I N    +   L+  H+  + ++WSY     S P    ++F L K + E  E     EA+    K +     LPI        I+YC  C++I+PDR HHC+ C +CVL MDHHC W++NC+G  N K F+LFL Y  LYC  ++ T   YF+     +    T  +F+++ +F ++++FF+  +    Y+ +LI  N  TI          P +      F +N  +VFG     W LP+
Sbjct:   18 PVIFINLVVCWSYYAYVVQLCIYTIPNPE-EQVIYLVVFHVCFVMFMWSYWKTIISKPSNPSKEFFLPKAEKEQYEKEERPEAQQEILKKVAKN--LPIYTRTGSGAIRYCDCCQLIKPDRCHHCSTCDQCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSMLYCVFIASTVLQYFIKFWTNQID--THAKFHVLFLFFVAAMFFVSIMSLFTYHIWLIAKNMTTIGLRAPVFRNGPDKNGFTVGFYKNLTQVFGDQKRYWCLPV 277          
BLAST of SMED30025732 vs. Ensembl Cavefish
Match: zdhhc2 (zinc finger DHHC-type palmitoyltransferase 2 [Source:NCBI gene;Acc:103043768])

HSP 1 Score: 125.176 bits (313), Expect = 4.863e-31
Identity = 83/268 (30.97%), Postives = 137/268 (51.12%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEF-----LYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   L++ W+Y+  ++Q+ +  ++N    K   L+  H++ I ++WSY     + P    ++FHLS  D E+LE     E++    + I     LPI        I+YC  C +++PDR HHC+ C +C+L MDHHC W++NC+G  N K F LFL Y  LYC  ++ T   YF+       +  T  +F+++ +F  SS+F +       Y+ +L+  NR T+E        H T      +     +N ++VFG     W LP+
Sbjct:   21 PVLFICLIVAWSYYAYVLQLCIETVEN-LGEKIVYLLAYHVLFILFVWSYWQTIFTKPMNPLKEFHLSHSDKELLEREDRGESQQEILRRI--SKDLPIYTRTTSGAIRYCERCHLVKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFTLFLAYSLLYCLFITATDLQYFVQFWT-NGLPDTQAKFHIMFLFFASSMFSVSLASLFAYHCWLVCKNRSTLEVFRAPAFRHGTDKNGFSLG--VSKNLRQVFGDEKKYWLLPV 282          
BLAST of SMED30025732 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009927.1 (pep scaffold:Pmarinus_7.0:GL481399:6453:19951:1 gene:ENSPMAG00000008972.1 transcript:ENSPMAT00000009927.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 1.437e-48
Identity = 69/157 (43.95%), Postives = 114/157 (72.61%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MN ARLK+L  +++ I+D+L + +K+L     DP +Y+  ++ L++QGLFQLLEP+V+IRCRQ D+ LV+E +E+  ++Y+      + + ++ + CL  ++AGG+E+   +GR+KV NTLE RL+L+++QL+P++R +LF  N NR F+D
Sbjct:   70 IQVSNLMNHARLKVLKAREDLIQDLLADAKKRLVTDARDPARYRSLIEGLLMQGLFQLLEPQVVIRCRQQDVTLVKEAMEKGKAEYKACVKRDIHIRIDENDCLPPDVAGGLEMYSGDGRIKVENTLEKRLELIAEQLLPDVRVMLFKVNPNRRFFD 226          

HSP 2 Score: 60.4622 bits (145), Expect = 1.437e-48
Identity = 40/69 (57.97%), Postives = 56/69 (81.16%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK M++FIEQEA EK +E+ +KA+EEF IEK RL+Q QR K+ + F K+EK+++ +KK
Sbjct:    1 MALSDADVQKQIKQMMAFIEQEANEKAEEVEAKAEEEFNIEKGRLLQTQRLKIIDHFEKKEKQIDMQKK 69          
BLAST of SMED30025732 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002075.1 (pep scaffold:Pmarinus_7.0:GL478102:45668:49015:-1 gene:ENSPMAG00000001886.1 transcript:ENSPMAT00000002075.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 6.530e-26
Identity = 51/105 (48.57%), Postives = 70/105 (66.67%), Query Frame = -2
Query: 1045 QGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1359
            QGL QLLEP VI+RCRQSD+ LV+  + +    Y   T  ++ ++V+    L  +I GGVEL   N ++KV NTL+SRL+ +S Q++PEIR  L+GKN NR F D
Sbjct:    1 QGLLQLLEPVVIVRCRQSDLALVKSSVTKNIPTYRAATKKEICITVDEQLFLPLDICGGVELYNANAKIKVSNTLDSRLEFMSHQMMPEIRVYLYGKNSNRKFND 105          
BLAST of SMED30025732 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003615.1 (pep scaffold:Pmarinus_7.0:GL479041:4766:11691:-1 gene:ENSPMAG00000003304.1 transcript:ENSPMAT00000003615.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 2.471e-23
Identity = 42/69 (60.87%), Postives = 57/69 (82.61%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            M LTD DV KQ+K+M++FIEQEA EKV+EI+SKA+EEF +EK RL+Q  RSK+ E + K++K+LE +KK
Sbjct:    1 MPLTDGDVLKQVKHMVAFIEQEATEKVEEIDSKAEEEFNLEKGRLMQSHRSKIMEHYDKKDKQLEMQKK 69          

HSP 2 Score: 40.817 bits (94), Expect = 2.471e-23
Identity = 23/61 (37.70%), Postives = 40/61 (65.57%), Query Frame = -2
Query: 1333 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEP 1515
            IQ SN+MNQ+RLK+L  + + ++++L E + +L  LT +   Y+  M  L++Q + Q L+P
Sbjct:   70 IQISNLMNQSRLKVLETRNDLLKELLNEARGRLVQLTRNATVYRTIMDGLVLQ-VGQSLKP 129          
BLAST of SMED30025732 vs. Ensembl Sea Lamprey
Match: zdhhc3a (zinc finger DHHC-type containing 3a [Source:ZFIN;Acc:ZDB-GENE-040718-484])

HSP 1 Score: 81.2629 bits (199), Expect = 6.082e-18
Identity = 40/96 (41.67%), Postives = 57/96 (59.38%), Query Frame = -2
Query:  334 SFPDQEARSTFFKSIIAKGKLPISQIQY-CAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFL 618
            + P   A   + +S+    +L   Q+ Y C  C  I+PDRAHHC+ C+RC+  MDHHC W++NC+G  NQK F+LF     +Y AL+S+   V  L
Sbjct:    2 AVPKGNATKEYIESL----QLQPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGESNQKYFVLF----TMYIALISVHALVMVL 89          
BLAST of SMED30025732 vs. Ensembl Sea Lamprey
Match: zdhhc16a (zinc finger DHHC-type containing 16a [Source:NCBI gene;Acc:394017])

HSP 1 Score: 79.337 bits (194), Expect = 2.301e-16
Identity = 30/71 (42.25%), Postives = 45/71 (63.38%), Query Frame = -2
Query:  352 GKLPISQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSIT 564
            G++ +  +  C  C   +P R HHC+ C RC+L MDHHC W++NC+G +N + F  F +Y ++ CA  SIT
Sbjct:  115 GQVDLPAVSICKRCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGNYNHRYFFSFCLYMSMGCAFTSIT 185          
BLAST of SMED30025732 vs. Ensembl Yeast
Match: VMA4 (Subunit E of the V1 domain of the vacuolar H+-ATPase (V-ATPase); V-ATPase is an electrogenic proton pump found throughout the endomembrane system; V1 domain has eight subunits; required for the V1 domain to assemble onto the vacuolar membrane; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005859])

HSP 1 Score: 105.531 bits (262), Expect = 5.809e-31
Identity = 54/159 (33.96%), Postives = 99/159 (62.26%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKL--ELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            I  S + N+ RLK+L  +++ +  + EET+++L  + N+  +YK  ++ LIV+ L +LLEPK I++  + D+ L+E + ++   +Y EK       E+ ++ D    D ++GGV +   + ++++ NTLE RLKLLS++ +P IR  L+G ++ R F+D
Sbjct:   75 ITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPILQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLNKDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD 233          

HSP 2 Score: 46.2098 bits (108), Expect = 5.809e-31
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = -1
Query: 1499 ALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKK--LEQRKKNSTFKH 1720
            ALT + V  ++  M +FI +EA+EK  EI  KAD+E+EIEK+ +V+++ + ++  F  + KK  L Q+   ST  +
Sbjct:    7 ALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDGNFKSKLKKAMLSQQITKSTIAN 82          
BLAST of SMED30025732 vs. Ensembl Yeast
Match: PFA3 (Palmitoyltransferase for Vac8p; required for vacuolar membrane fusion; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; autoacylates; required for vacuolar integrity under stress conditions [Source:SGD;Acc:S000005270])

HSP 1 Score: 80.1073 bits (196), Expect = 7.271e-17
Identity = 53/174 (30.46%), Postives = 83/174 (47.70%), Query Frame = -2
Query:   76 SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTIPKEIIIHSE----------------FVENFQKVFGKNIFTWFLPI 549
             + + C  C V +PDR HHC+ C  C+L MDHHC W + C G  NQK F+ FL+Y  LY  LV I T           S    + +F+L+ + +L+   FI  L F+ ++ + +  N+ TIE        +++ I ++                 + N+Q + G +   W LPI
Sbjct:  101 GRFRVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLIYTCYELGTWFNSGSFNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIEVHGMRRYRRDLEILNDSYGTNEHLENIFDLGSSMANWQDIMGTSWLEWILPI 274          
BLAST of SMED30025732 vs. Ensembl Yeast
Match: ERF2 (Subunit of a palmitoyltransferase; this complex adds a palmitoyl lipid moiety to heterolipidated substrates such as Ras1p and Ras2p through a thioester linkage; mutants partially mislocalize Ras2p to the vacuole; palmitoyltransferase is composed of Erf2p and Shr5p [Source:SGD;Acc:S000004236])

HSP 1 Score: 73.9442 bits (180), Expect = 9.611e-15
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = -2
Query:  349 SYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPISQ---IQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITT 702
            S++   +S P  +P   HLS+  L      P +     ++  I       IS+   I+YC  CR+ +P R+ HC+ C  CV+  DHHC W++NCIG  N + FL+FL+ GA+  +++ +T 
Sbjct:  123 SFIRTATSDPGVLPRNIHLSQ--LRNNYQIPQE-----YYNLITLPTHSSISKDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLL-GAILSSVILLTN 235          
BLAST of SMED30025732 vs. Ensembl Yeast
Match: SWF1 (Palmitoyltransferase that acts on transmembrane proteins; including the SNAREs Snc1p, Syn8p, Tlg1p and likely all SNAREs; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; may have a role in vacuole fusion [Source:SGD;Acc:S000002533])

HSP 1 Score: 70.4774 bits (171), Expect = 1.128e-13
Identity = 27/49 (55.10%), Postives = 35/49 (71.43%), Query Frame = -2
Query:  388 CAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLV 534
            C+ CR+++P R+ HC+ C RCVL  DHHC WI+NCIG  N   F LFL+
Sbjct:  136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184          
BLAST of SMED30025732 vs. Ensembl Yeast
Match: PFA4 (Palmitoyltransferase with autoacylation activity; required for palmitoylation of amino acid permeases containing a C-terminal Phe-Trp-Cys site; required for modification of Chs3p; member of the DHHC family of putative palmitoyltransferases [Source:SGD;Acc:S000005363])

HSP 1 Score: 65.855 bits (159), Expect = 5.314e-12
Identity = 28/72 (38.89%), Postives = 39/72 (54.17%), Query Frame = -2
Query:  340 QYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVY-----GALYCALVSITTFVY 540
             +C  C+  +P+R+HHC  C +CVL MDHHC W  NC+G  N   FL FL +       L+C       F++
Sbjct:   78 NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIW 149          
BLAST of SMED30025732 vs. Ensembl Nematostella
Match: EDO39197 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS6])

HSP 1 Score: 157.147 bits (396), Expect = 2.540e-44
Identity = 79/171 (46.20%), Postives = 123/171 (71.93%), Query Frame = -2
Query: 1051 MNFSQXXXXXXXXXXKIQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVF 1563
            MN+ +KK++     KKIQ SN +NQ+RLK+L  Q +HI+ +L+E  ++L  +T D  KY++ ++ LI QGL+QLLE KV+IRCR+ D+ LV+ +      +Y+++T  ++EL+V+    L  + AGG+EL    G++KVVNTLESRL++L +Q++PEIRE+LFG+N+ R F
Sbjct:   54 MNYYEKKEKQVELQKKIQRSNQLNQSRLKVLKSQDDHIKRILDEAVERLGKVTQDQGKYQQIIQGLITQGLYQLLESKVLIRCRKQDVSLVKAVFGPATEEYKKQTKKEIELTVDEQNFLGPDCAGGIELHAKQGKIKVVNTLESRLEMLGRQMMPEIREILFGRNKGRHF 224          

HSP 2 Score: 61.6178 bits (148), Expect = 1.066e-10
Identity = 40/69 (57.97%), Postives = 57/69 (82.61%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL D +V+KQI++M+ FIEQEAKEK +EI++KA+EEF IEK RLVQ +R K+  ++ K+EK++E +KK
Sbjct:    1 MALNDAEVKKQIEHMMKFIEQEAKEKAEEIDAKAEEEFNIEKGRLVQQERLKIMNYYEKKEKQVELQKK 69          
BLAST of SMED30025732 vs. Ensembl Nematostella
Match: EDO40825 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7S6A3])

HSP 1 Score: 108.997 bits (271), Expect = 1.613e-26
Identity = 69/218 (31.65%), Postives = 116/218 (53.21%), Query Frame = -2
Query:   76 SYMAATSSTPCPVPEQFHLSKEDLEVLESFPD-QEARSTFFKSIIAKGKLPISQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFL----NIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFL---YHSTIPKEIIIH-SEFVENFQKVFGKNIFTWFLPI 702
            SY     +    VP QF LSK D +++E+  + +E  +   K++    +     ++YC  C  I+PDR HHC+ C++C+L MDHHC W++NC+G  N K FLLFL Y  LY   V+ T   YF+    N ++ E       + +++ +F ++ +F I       Y+ +L+  N+ T+E     +    P +   H    ++N ++VFG ++  WFLP+
Sbjct:   66 SYWRTILADQGIVPSQFALSKTDKDLVENGENVREVLTRVSKNLPTATRTLSGGVRYCDICCHIKPDRCHHCSMCRKCILKMDHHCPWVNNCVGYSNYKFFLLFLFYAILYTFYVTGTVTKYFIAFWSNSLEGE------GKLHILFLFFVALMFCISLWSLFGYHIYLVSQNKTTLESFRVPHLRYGPSKDAFHLGTRLKNVEQVFGTSVIMWFLPV 277          
BLAST of SMED30025732 vs. Ensembl Nematostella
Match: EDO46304 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RQK1])

HSP 1 Score: 77.411 bits (189), Expect = 2.428e-15
Identity = 36/78 (46.15%), Postives = 48/78 (61.54%), Query Frame = -2
Query:  343 KLPISQIQY--CAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVY---GALYCALVSITTFV 561
            KLP     Y  C  C   +P R HHC+ C+RC+L MDHHC WI+NC+G  N + F+LF +Y   G+LY A+ S   F+
Sbjct:  119 KLPGKPENYLICRKCSQAKPPRTHHCSICKRCILKMDHHCPWINNCVGHFNHRYFILFCIYMTLGSLYVAVSSWDLFL 196          
BLAST of SMED30025732 vs. Ensembl Nematostella
Match: EDO46319 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RQ92])

HSP 1 Score: 76.2554 bits (186), Expect = 4.195e-15
Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = -2
Query:  325 IQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIV 543
            +Q+C  C+  +  RAHHC+ C RCV+ MDHHC WI+NC+G +N KSF LFL +  L C   +I  F+   N V
Sbjct:   84 LQFCHVCQGYKAPRAHHCSKCNRCVMKMDHHCPWINNCVGHYNMKSFTLFLFFVPLGCTHCAIILFLCLYNEV 156          
BLAST of SMED30025732 vs. Ensembl Nematostella
Match: EDO34528 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SP39])

HSP 1 Score: 75.0998 bits (183), Expect = 4.874e-15
Identity = 30/50 (60.00%), Postives = 36/50 (72.00%), Query Frame = -2
Query:  385 CAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVY 534
            C  C  I+ DRAHHC+ CQRC+  MDHHC WI+NC+G  NQK F+LF  Y
Sbjct:  105 CTRCECIKLDRAHHCSTCQRCIRKMDHHCPWINNCVGEDNQKFFILFTFY 154          
BLAST of SMED30025732 vs. Ensembl Medaka
Match: atp6v1e1b (V-type proton ATPase subunit E 1 [Source:NCBI gene;Acc:101174147])

HSP 1 Score: 155.221 bits (391), Expect = 1.757e-57
Identity = 72/157 (45.86%), Postives = 109/157 (69.43%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ SN+MNQARLK+L  + + I D+L E +++L N+  DP +Y   M  L++QG +QLLEPKV IRCR+ D++LV+  +++    Y+      LE+ ++++  L  +++GG+E+   NG++KV NTLESRL L++QQ++PEIR  LFG N NR F D
Sbjct:   70 IQMSNLMNQARLKVLKARDDMISDMLNEARQRLTNIAKDPSRYAGLMDGLLMQGFYQLLEPKVTIRCRKQDVQLVQASIQKNIPIYKAAVKNSLEVRIDQENFLPSDVSGGIEIYNANGKIKVSNTLESRLDLMAQQMMPEIRVALFGANPNRKFLD 226          

HSP 2 Score: 88.5817 bits (218), Expect = 1.757e-57
Identity = 44/69 (63.77%), Postives = 60/69 (86.96%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MAL+D DV+KQIK+M++FIEQEA EK +EI++KA+EEF IEK RLVQ QR K+ E++ K+EK++EQ+KK
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKK 69          
BLAST of SMED30025732 vs. Ensembl Medaka
Match: atp6v1e1a (V-type proton ATPase subunit E 1 [Source:NCBI gene;Acc:101155846])

HSP 1 Score: 150.214 bits (378), Expect = 2.322e-41
Identity = 79/173 (45.66%), Postives = 116/173 (67.05%), Query Frame = -2
Query: 1045 MNFSQXXXXXXXXXXKIQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1563
            M F +KK++     K+IQ S++MNQ RLK+L  + + I D+L E +K+L  L  DP  Y + +  LI+QGL+QLLEPKV IRCRQ D+++V+  + +    Y+E     + + ++RD  L  +I GG+E+   NG++KV NTLESRL+LL++Q++PEIR  LFG N NR F D
Sbjct:   54 MEFFEKKEKQIEQHKRIQTSHLMNQGRLKVLKARDDMITDLLNEARKRLSELAKDPETYSKLLDGLILQGLYQLLEPKVTIRCRQQDVEIVQASVRKNIPIYQEAVRSSIAVRIDRDLFLPPDICGGIEMCNENGKIKVSNTLESRLELLAEQMMPEIRVSLFGANPNRKFLD 226          

HSP 2 Score: 97.4413 bits (241), Expect = 1.160e-22
Identity = 50/72 (69.44%), Postives = 61/72 (84.72%), Query Frame = -1
Query: 1508 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKKNST 1723
            MALTD DV+KQIK+M++FIEQEAKEKV+EINSKA+EEF IEK RLVQ  R K+ EFF K+EK++EQ K+  T
Sbjct:    1 MALTDADVQKQIKHMMAFIEQEAKEKVEEINSKAEEEFNIEKGRLVQTHRVKIMEFFEKKEKQIEQHKRIQT 72          
BLAST of SMED30025732 vs. Ensembl Medaka
Match: zdhhc15b (zinc finger DHHC-type containing 15 [Source:NCBI gene;Acc:101162377])

HSP 1 Score: 131.724 bits (330), Expect = 1.777e-33
Identity = 90/269 (33.46%), Postives = 144/269 (53.53%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVP-EQFHLSKEDLEVLESFPDQEARSTFFKSIIAK--GKLPIS------QIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI---PKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++I   ++ W+Y+  + ++ LF I N+     +LL+F     +F  W+Y  +   TP   P ++F LS  D +  E     E R    K I+ +   KLPIS       I++C  C+V++PDR HHC+ C+ CVL MDHHC W++NC+G  N K FLLFL Y  LYC  ++ T F YFL     + +     +F+++ +  ++ +FFI  +    Y+ +L+  NR T+E          P +   +     N Q+VFG+++  WF+PI
Sbjct:   18 PVLIITAVVLWSYYAYVFELCLFTITNTLEKVAYLLVFHACFAMFS-WTYWKSIF-TPVAAPCKKFQLSYSDKQRYE----MEERPDAQKQILVEIAKKLPISTRAQSGAIRFCDRCQVLKPDRCHHCSVCETCVLKMDHHCPWVNNCVGFSNYKFFLLFLAYSMLYCVFIATTVFRYFLKFWTGD-LPNGPAKFHVLFLMFVALMFFISLMFLFSYHCWLVAKNRSTLEAFSAPVFIGGPDKNGFNVGIKRNLQQVFGEDVRQWFIPI 279          
BLAST of SMED30025732 vs. Ensembl Medaka
Match: zdhhc15b (zinc finger DHHC-type containing 15 [Source:NCBI gene;Acc:101162377])

HSP 1 Score: 131.724 bits (330), Expect = 2.205e-33
Identity = 89/269 (33.09%), Postives = 142/269 (52.79%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVP-EQFHLSKEDLEVLESFPDQEARSTFFKSIIAK--GKLPIS------QIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI---PKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++I   ++ W+Y+  + ++ LF I N+   K   L+  H     + W+Y  +   TP   P ++F LS  D +  E     E R    K I+ +   KLPIS       I++C  C+V++PDR HHC+ C+ CVL MDHHC W++NC+G  N K FLLFL Y  LYC  ++ T F YFL     + +     +F+++ +  ++ +FFI  +    Y+ +L+  NR T+E          P +   +     N Q+VFG+++  WF+PI
Sbjct:   18 PVLIITAVVLWSYYAYVFELCLFTITNTL-EKVAYLLVFHACFAMFSWTYWKSIF-TPVAAPCKKFQLSYSDKQRYE----MEERPDAQKQILVEIAKKLPISTRAQSGAIRFCDRCQVLKPDRCHHCSVCETCVLKMDHHCPWVNNCVGFSNYKFFLLFLAYSMLYCVFIATTVFRYFLKFWTGD-LPNGPAKFHVLFLMFVALMFFISLMFLFSYHCWLVAKNRSTLEAFSAPVFIGGPDKNGFNVGIKRNLQQVFGEDVRQWFIPI 279          
BLAST of SMED30025732 vs. Ensembl Medaka
Match: zdhhc2 (zinc finger DHHC-type palmitoyltransferase 2 [Source:NCBI gene;Acc:101164985])

HSP 1 Score: 129.413 bits (324), Expect = 1.726e-32
Identity = 82/268 (30.60%), Postives = 144/268 (53.73%), Query Frame = -2
Query:   76 PIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFL-----YHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPI 846
            P++   +++ W+Y+  ++Q+ +  I+++   K   L+  H+I + ++W+Y     + P    ++FHLS  D E+LES    E++    + I     LPI        I+YC  C++++PDR HHC+ C +C+L MDHHC W++NC+G  N K F+LFL Y  LYC  V+ T   YF+     + +  T  +F+++ +F  +S+F +       Y+ +L+  NR T+E +      H T      +     +NF++VFG     W +P+
Sbjct:   21 PVLFIAVIVAWSYYAYVLQLCIESIEDTG-EKVVYLLAYHVIFLMFVWAYWQTIFTKPMNPLKEFHLSHSDKELLESENRGESQQEILRRIAKD--LPIYTRTNSGAIRYCDRCQLLKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKYFMLFLAYSLLYCLFVTATDLQYFIKFWT-KGLPDTQAKFHILFLFFSASMFSVSLASLFIYHCWLVCKNRSTLEAVRAPVFRHGTDKNGFSLG--VSKNFRQVFGDEAKYWPVPV 282          
BLAST of SMED30025732 vs. Planmine SMEST
Match: SMESG000000426.1 (SMESG000000426.1)

HSP 1 Score: 382.874 bits (982), Expect = 3.820e-131
Identity = 206/208 (99.04%), Postives = 206/208 (99.04%), Query Frame = -2
Query:   73 MAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKSIIAKGKLPISQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPIV 696
            MAATSSTPCPVPEQFHLSKEDL VLESFPDQEARSTFFKSIIAKGKLPISQIQYCAHCRVIQ DRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVIFILSSIFFIIKLIFSFYNFFLIVSNRLTIEFLYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPIV
Sbjct:    1 MAATSSTPCPVPEQFHLSKEDLAVLESFPDQEARSTFFKSIIAKGKLPISQIQYCAHCRVIQSDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVIFILSSIFFIIKLIFSFYNFFLIVSNRLTIEFLYHSTIPKEIIIHSEFVENFQKVFGKNIFTWFLPIV 208          
BLAST of SMED30025732 vs. Planmine SMEST
Match: SMESG000000425.1 (SMESG000000425.1)

HSP 1 Score: 321.627 bits (823), Expect = 3.405e-121
Identity = 157/157 (100.00%), Postives = 157/157 (100.00%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD
Sbjct:   70 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 226          

HSP 2 Score: 134.035 bits (336), Expect = 3.405e-121
Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = -1
Query: 1517 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 1723
            MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK
Sbjct:    1 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKK 69          
BLAST of SMED30025732 vs. Planmine SMEST
Match: SMESG000064093.1 (SMESG000064093.1)

HSP 1 Score: 132.494 bits (332), Expect = 5.915e-40
Identity = 75/157 (47.77%), Postives = 112/157 (71.34%), Query Frame = -2
Query: 1045 IQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 1515
            IQ+SN+MN A+LKIL  +QEHI+ +LE ++ +L  ++ D   YKET+K+LI Q L QLLE  V+IRC   D+ ++ +IL E  + Y++ T   + + ++R+  L++ I GGVE+   NG+++VVNTL+SRL L+S Q+IPE+RE+LFG N NR F D
Sbjct:   72 IQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETLKQLISQSLLQLLEKDVLIRCHAKDVDIINQILPEVLASYQKTTKRTVNVVIDRENHLNN-IMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 227          

HSP 2 Score: 51.9878 bits (123), Expect = 5.915e-40
Identity = 33/75 (44.00%), Postives = 57/75 (76.00%), Query Frame = -1
Query: 1505 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEK--KLEQRKKNSTF 1723
            + + +++V+KQI+NM + I+ EA EKV+EI +K +EEF+IEK+++VQ+QR+K+ E++ K+E   KL +  +NS  
Sbjct:    3 IVVNENEVQKQIENMTALIDLEANEKVEEIEAKTEEEFQIEKNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNL 77          
BLAST of SMED30025732 vs. Planmine SMEST
Match: SMESG000004244.1 (SMESG000004244.1)

HSP 1 Score: 137.887 bits (346), Expect = 4.327e-36
Identity = 84/267 (31.46%), Postives = 161/267 (60.30%), Query Frame = -2
Query:   76 FPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHL-SKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVVXXXXXXXXXXXXXXXXFYNFFLIVSNRLTIEFLYHSTI--PKEIIIHSEFVENFQKVFGKNIFTWFLPI 849
            F + + +++ICW+Y+  +I++ +     S   K F ++  HL+++ +I+SY+ A  S P P+P +F+L S+E    L+   D++    F + +I K  L +      S I++C+ C++I+PDRAHHC+ C RC+L MDHHC W+ NC+G HN K F+L L YG+L+C  V+ T+  + ++  ++      +   N +++ ++S++FF +++    Y+ +L ++N+ T+E +  S    P+    +   +EN +++ G ++ +WF+PI
Sbjct:   11 FLVYLILVVICWSYYAYVIELCIIW-SKSTVQKVFYILVYHLLVLVFIYSYIKAVISKPPPIPLEFYLDSQEHAISLDINSDRDKWRKFLEELIVKKNLTVYTRDIGSNIRFCSICQLIKPDRAHHCSSCGRCLLRMDHHCPWVGNCVGFHNHKFFILLLGYGSLFCLFVAATSIEFAISWWQDPQPK-NMRGVNFLILVVVSAMFFFVQISLYLYHIYLTINNQTTLESMRRSIFQDPEVDSFNLGAIENLKELMGDSVCSWFVPI 275          
BLAST of SMED30025732 vs. Planmine SMEST
Match: SMESG000004244.1 (SMESG000004244.1)

HSP 1 Score: 121.709 bits (304), Expect = 1.345e-31
Identity = 66/174 (37.93%), Postives = 110/174 (63.22%), Query Frame = -2
Query:  349 FPIMIFVLLICWTYFVSIIQIILFRIDNSRPXXXXXXXXXXXXXXXXIWSYMAATSSTPCPVPEQFHL-SKEDLEVLESFPDQEARSTFFKSIIAKGKLPI------SQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCIGIHNQKSFLLFLVYGALYCALVSITT 849
            F + + +++ICW+Y+  +I++ +     S   K F ++  HL+++ +I+SY+ A  S P P+P +F+L S+E    L+   D++    F + +I K  L +      S I++C+ C++I+PDRAHHC+ C RC+L MDHHC W+ NC+G HN K F+L L YG+L+C  V+ T+
Sbjct:   11 FLVYLILVVICWSYYAYVIELCIIW-SKSTVQKVFYILVYHLLVLVFIYSYIKAVISKPPPIPLEFYLDSQEHAISLDINSDRDKWRKFLEELIVKKNLTVYTRDIGSNIRFCSICQLIKPDRAHHCSSCGRCLLRMDHHCPWVGNCVGFHNHKFFILLLGYGSLFCLFVAATS 183          
The following BLAST results are available for this feature:
BLAST of SMED30025732 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1E14.046e-5342.68ATPase H+ transporting V1 subunit E1 [Source:HGNC ... [more]
ATP6V1E13.732e-4436.94ATPase H+ transporting V1 subunit E1 [Source:HGNC ... [more]
ATP6V1E24.932e-4442.48ATPase H+ transporting V1 subunit E2 [Source:HGNC ... [more]
ATP6V1E24.932e-4442.48ATPase H+ transporting V1 subunit E2 [Source:HGNC ... [more]
ATP6V1E13.851e-4142.68ATPase H+ transporting V1 subunit E1 [Source:HGNC ... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vha-81.284e-3840.91Vacuolar H ATPase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
dhhc-45.022e-2729.26Zinc finger DHHC domain-containing protein 4 [Sou... [more]
dhhc-44.921e-2527.24Zinc finger DHHC domain-containing protein 4 [Sou... [more]
dhhc-41.241e-2427.15Zinc finger DHHC domain-containing protein 4 [Sou... [more]
dhhc-43.711e-2427.15Zinc finger DHHC domain-containing protein 4 [Sou... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vha262.269e-5949.68gene:FBgn0283535 transcript:FBtr0346137[more]
Vha262.269e-5949.68gene:FBgn0283535 transcript:FBtr0078701[more]
Vha262.269e-5949.68gene:FBgn0283535 transcript:FBtr0078700[more]
CG14072.965e-3129.30gene:FBgn0033474 transcript:FBtr0088435[more]
CG14073.416e-3129.30gene:FBgn0033474 transcript:FBtr0330325[more]
back to top
BLAST of SMED30025732 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1e1b1.605e-5947.77ATPase H+ transporting V1 subunit E1b [Source:ZFIN... [more]
atp6v1e1a2.159e-5443.95ATPase H+ transporting V1 subunit E1a [Source:ZFIN... [more]
zdhhc20a1.111e-3332.71zinc finger DHHC-type containing 20a [Source:ZFIN;... [more]
zdhhc29.834e-3332.46zinc finger DHHC-type palmitoyltransferase 2 [Sour... [more]
zdhhc21.743e-3232.46zinc finger DHHC-type palmitoyltransferase 2 [Sour... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfe2l31.518e-5647.13nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
nfe2l34.117e-5247.13nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
nfe2l35.877e-5247.13nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
nfe2l39.343e-5247.13nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
zdhhc21.562e-3431.72zinc finger DHHC-type containing 2 [Source:NCBI ge... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp6v1e19.899e-5443.31ATPase, H+ transporting, lysosomal V1 subunit E1 [... [more]
Atp6v1e21.467e-4038.46ATPase, H+ transporting, lysosomal V1 subunit E2 [... [more]
Atp6v1e21.467e-4038.46ATPase, H+ transporting, lysosomal V1 subunit E2 [... [more]
Atp6v1e21.467e-4038.46ATPase, H+ transporting, lysosomal V1 subunit E2 [... [more]
Zdhhc24.585e-3331.72zinc finger, DHHC domain containing 2 [Source:MGI ... [more]
back to top
BLAST of SMED30025732 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54611|VATE_DROME1.734e-5849.68V-type proton ATPase subunit E OS=Drosophila melan... [more]
sp|P31402|VATE_MANSE4.333e-5547.77V-type proton ATPase subunit E OS=Manduca sexta OX... [more]
sp|P50518|VATE1_MOUSE5.996e-5343.31V-type proton ATPase subunit E 1 OS=Mus musculus O... [more]
sp|P11019|VATE1_BOVIN6.250e-5343.31V-type proton ATPase subunit E 1 OS=Bos taurus OX=... [more]
sp|Q4R761|VATE1_MACFA1.775e-5242.68V-type proton ATPase subunit E 1 OS=Macaca fascicu... [more]
back to top
BLAST of SMED30025732 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A482WJ842.256e-5954.78Uncharacterized protein OS=Laodelphax striatellus ... [more]
A0A1I9WLK61.298e-5852.87Seminal fluid protein OS=Nilaparvata lugens OX=108... [more]
A0A0A1WG852.082e-5849.04V-type proton ATPase subunit E OS=Zeugodacus cucur... [more]
A0A2P6KBS13.312e-5853.50V-type proton ATPase subunit E OS=Nephila clavipes... [more]
A0A034VVJ56.756e-5849.04V-type proton ATPase subunit E OS=Bactrocera dorsa... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1e1b3.050e-5745.86V-type proton ATPase subunit E 1-like [Source:NCBI... [more]
atp6v1e1a2.818e-5348.41V-type proton ATPase subunit E 1-like [Source:NCBI... [more]
atp6v1e1a3.394e-4242.04V-type proton ATPase subunit E 1-like [Source:NCBI... [more]
zdhhc20a2.053e-3131.32zinc finger DHHC-type containing 20a [Source:ZFIN;... [more]
zdhhc24.863e-3130.97zinc finger DHHC-type palmitoyltransferase 2 [Sour... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009927.11.437e-4843.95pep scaffold:Pmarinus_7.0:GL481399:6453:19951:1 ge... [more]
ENSPMAT00000002075.16.530e-2648.57pep scaffold:Pmarinus_7.0:GL478102:45668:49015:-1 ... [more]
ENSPMAT00000003615.12.471e-2360.87pep scaffold:Pmarinus_7.0:GL479041:4766:11691:-1 g... [more]
zdhhc3a6.082e-1841.67zinc finger DHHC-type containing 3a [Source:ZFIN;A... [more]
zdhhc16a2.301e-1642.25zinc finger DHHC-type containing 16a [Source:NCBI ... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
VMA45.809e-3133.96Subunit E of the V1 domain of the vacuolar H+-ATPa... [more]
PFA37.271e-1730.46Palmitoyltransferase for Vac8p; required for vacuo... [more]
ERF29.611e-1533.88Subunit of a palmitoyltransferase; this complex ad... [more]
SWF11.128e-1355.10Palmitoyltransferase that acts on transmembrane pr... [more]
PFA45.314e-1238.89Palmitoyltransferase with autoacylation activity; ... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391972.540e-4446.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408251.613e-2631.65Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO463042.428e-1546.15Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO463194.195e-1547.95Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO345284.874e-1560.00Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of SMED30025732 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1e1b1.757e-5745.86V-type proton ATPase subunit E 1 [Source:NCBI gene... [more]
atp6v1e1a2.322e-4145.66V-type proton ATPase subunit E 1 [Source:NCBI gene... [more]
zdhhc15b1.777e-3333.46zinc finger DHHC-type containing 15 [Source:NCBI g... [more]
zdhhc15b2.205e-3333.09zinc finger DHHC-type containing 15 [Source:NCBI g... [more]
zdhhc21.726e-3230.60zinc finger DHHC-type palmitoyltransferase 2 [Sour... [more]
back to top
BLAST of SMED30025732 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000426.13.820e-13199.04SMESG000000426.1[more]
SMESG000000425.13.405e-121100.00SMESG000000425.1[more]
SMESG000064093.15.915e-4047.77SMESG000064093.1[more]
SMESG000004244.14.327e-3631.46SMESG000004244.1[more]
SMESG000004244.11.345e-3137.93SMESG000004244.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025732 ID=SMED30025732|Name=SMED30025732|organism=Schmidtea mediterranea sexual|type=transcript|length=1816bp
CTCGACAGATTCAATTGATGGCCAGTATAAAAAGGATAATATTAATTTTA
ATCCCAACCATTATAAGAACTAAACAATTGGGAGAAACCATGTGAATATG
TTTTTCCCAAAAACTTTCTGAAAATTTTCAACAAATTCAGAATGAATTAT
TATTTCTTTTGGGATTGTTGAGTGGTATAAAAATTCAATTGTCAACCGGT
TTGAGACTATGAGGAAAAAATTATAAAAACTAAAAATTAATTTAATAATA
AAGAAAATGGACGACAGAATGAATATCACAACTAAATTGAATTCATTTAT
TGTTAGATACATCGATTCTTCCTTGACAATATTCAAGAAATATACGAAAG
TTGTAATTGAAACTAGAGCGCAATAGAGAGCGCCATAAACCAGGAATAGT
AAGAACGATTTCTGGTTATGTATTCCAATGCAATTGCTAATCCAGAAGCA
ATGATGATCCATGTTTAGTACACACCTTTGGCAAAACGTGCAATGATGGG
CTCTGTCGGGCTGTATCACGCGACAATGAGCACAATATTGAATTTGGCTT
ATTGGTAATTTGCCTTTTGCGATAATGGACTTGAAAAATGTTGATCTAGC
CTCTTGATCTGGAAACGATTCAAGAACCTCTAAATCCTCCTTGCTTAGAT
GAAACTGTTCCGGTACAGGACATGGCGTACTCGAAGTAGCTGCCATGTAA
CTCCATATATAAAAAATAAGAATAAGATGAATAAAGATCAACAAAAAGTA
TTTTAATGGTCTTGAATTATCAATTCTAAATAAAATTATTTGTATAATAC
TCACAAAATAAGTCCAACAAATTAATAATACAAAAATCATAATTGGAAAA
CATTTCCATAACAATTTAAATTTCATAACAAATTAAAACTCATAATAACG
CGCTCAGTTGATTAATAAAACAAAACCACATTTTCAATTCTAATTTATCA
AAAAAAAGTTTTACAATGCGATTTCATACAAACAATAACCAAATAATTGT
AAATTATGCTTTATTATGCTTGATACTAATTTCGAAATATCTTAATCATA
AAATACTCTATTCTCATTTTTACCGAACAAAACTTCACGAATTTCCGGAA
TTAATTGTTGACTAAGTAATTTTAATCTGCTCTCTAATGTATTGACAACT
TTCATTCTGCCGTTCGGTACGATCAATTCAACCCCGCCAGCTATCTCATC
CGATAAGCATTGATCTCTATTCACAGACAATTCCAACTTCATATCAGTCT
TTTCTTCGTATTTCGAAGCACATTCTTCCAAAATTTCCTCGACTAATTTA
ATGTCAGATTGGCGGCATCGAATAATTACTTTCGGTTCTAACAGTTGAAA
TAATCCTTGAACGATAAGACGTTTCATTGTTTCCTTATACTTATGCGGAT
CATTTGTAAGGTTATACAATTGCTTCTGAGTTTCTTCTAAAACATCTCTA
ATGTGTTCCTGTTGACAACCTAAAATCTTTAATCGGGCTTGATTCATCAT
GTTTGAATGTTGAATTTTTTTTGCGTTGTTCTAATTTCTTTTCTTCTTTT
GTGAAAAATTCATTCATTTTTGATCGCTGATCTTGAACCAAACGTGATTT
CTCTATTTCAAACTCTTCATCTGCCTTAGAATTTATTTCATCAACCTTTT
CTTTGGCTTCTTGCTCGATAAAAGATATCATATTTTTAATTTGTTTTCGA
ACATCATCGTCTGTTAATGCCATTATTAAATAATTATAATTGATATATTA
ATTAATTTATAAAAATATTAGGAATTATTTATGAAATATCAAATTGATTA
GTTTAAACACTAAAAC
back to top

protein sequence of SMED30025732-orf-1

>SMED30025732-orf-1 ID=SMED30025732-orf-1|Name=SMED30025732-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=269bp
MKFKLLWKCFPIMIFVLLICWTYFVSIIQIILFRIDNSRPLKYFLLIFIH
LILIFYIWSYMAATSSTPCPVPEQFHLSKEDLEVLESFPDQEARSTFFKS
IIAKGKLPISQIQYCAHCRVIQPDRAHHCTFCQRCVLNMDHHCFWISNCI
GIHNQKSFLLFLVYGALYCALVSITTFVYFLNIVKEESMYLTINEFNLVV
IFILSSIFFIIKLIFSFYNFFLIVSNRLTIEFLYHSTIPKEIIIHSEFVE
NFQKVFGKNIFTWFLPIV*
back to top

protein sequence of SMED30025732-orf-2

>SMED30025732-orf-2 ID=SMED30025732-orf-2|Name=SMED30025732-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=153bp
MMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGL
FQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLS
DEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVF
YD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0016409palmitoyltransferase activity
GO:0008270zinc ion binding
GO:0046961proton-transporting ATPase activity, rotational mechanism
Vocabulary: INTERPRO
TermDefinition
IPR001594Palmitoyltrfase_DHHC
IPR002842ATPase_V1_Esu
Vocabulary: cellular component
TermDefinition
GO:0033178proton-transporting two-sector ATPase complex, catalytic domain
Vocabulary: biological process
TermDefinition
GO:0015991ATP hydrolysis coupled proton transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001594Palmitoyltransferase, DHHC domainPFAMPF01529DHHCcoord: 111..233
e-value: 1.8E-30
score: 105.8
NoneNo IPR availablePANTHERPTHR22883:SF147PALMITOYLTRANSFERASEcoord: 12..267
NoneNo IPR availablePANTHERPTHR22883ZINC FINGER DHHC DOMAIN CONTAINING PROTEINcoord: 12..267
NoneNo IPR availablePROSITEPS50216DHHCcoord: 113..163
score: 26.052
NoneNo IPR availableTMHMMTMhelixcoord: 44..63
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 161..183