Transient receptor potential ion channel M b

Overview
NameTransient receptor potential ion channel M b
Smed IDSMED30025705
Length (bp)3591
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential ion channel M b (SMED30025705) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential ion channel M b (SMED30025705) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential ion channel M b (SMED30025705) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential ion channel M b (SMED30025705) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025705

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30025705SMESG000017090.1 dd_Smed_v4_6825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025705SMESG000017090.1 dd_Smed_v4_6825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential ion channel M b vs. Ensembl Human
Match: TRPM7 (transient receptor potential cation channel subfamily M member 7 [Source:HGNC Symbol;Acc:HGNC:17994])

HSP 1 Score: 52.373 bits (124), Expect = 7.062e-6
Identity = 43/182 (23.63%), Postives = 87/182 (47.80%), Query Frame = 1
Query:   16 YHCFIISIALGILKSIGMSKYKFKSIEKSIKTVEK-IQIENVDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD 540
            + CF  S+A+     + +  +  ++IE+   +VEK  +    DAY +I F   +  S  +  K+++L  D  P+      I   LLK      PK++IS++GG++  +    +++ L +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   +V  D
Sbjct:   51 HACFTASLAMK-YSDVKLGDHFNQAIEEW--SVEKHTEQSPTDAYGVINF---QGGSHSYRAKYVRLSYDTKPE-----VILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKE-HASRSSRKICTIGIAPWGVIENRNDLVGRD 220          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Human
Match: TRPM7 (transient receptor potential cation channel subfamily M member 7 [Source:HGNC Symbol;Acc:HGNC:17994])

HSP 1 Score: 52.373 bits (124), Expect = 7.121e-6
Identity = 43/182 (23.63%), Postives = 87/182 (47.80%), Query Frame = 1
Query:   16 YHCFIISIALGILKSIGMSKYKFKSIEKSIKTVEK-IQIENVDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD 540
            + CF  S+A+     + +  +  ++IE+   +VEK  +    DAY +I F   +  S  +  K+++L  D  P+      I   LLK      PK++IS++GG++  +    +++ L +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   +V  D
Sbjct:   51 HACFTASLAMK-YSDVKLGDHFNQAIEEW--SVEKHTEQSPTDAYGVINF---QGGSHSYRAKYVRLSYDTKPE-----VILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKE-HASRSSRKICTIGIAPWGVIENRNDLVGRD 220          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 45.0542 bits (105), Expect = 1.103e-6
Identity = 33/147 (22.45%), Postives = 79/147 (53.74%), Query Frame = 1
Query:  124 QIENVDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDD--KILDKIFGALLKPKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQ----WVIGTGLNCGIHKLISETVQESRFDNEDK-QINLIGFYNFSEIESNQSVVKTDK 543
            Q    DA+  I F   +  +  H  ++++L  D  P D   +++K++G L  P+++I+++GG+ +     E+E+ L + F++ ++   Q    W+I +GL+ G+ + +++ + E+      + QI  IG   +  I+  + +++ ++
Sbjct:  149 QTSTTDAFGTIVF---QGGAHAHKAQYVRLSYDSEPLDVMYLMEKVWG-LEAPRLVITVHGGMSNF----ELEERLGRLFRKGMLKAAQTTGAWIITSGLDSGVVRHVAKALDEAGISARMRSQIVTIGIAPWGVIKRKERLIRQNE 287          

HSP 2 Score: 28.1054 bits (61), Expect = 1.103e-6
Identity = 26/89 (29.21%), Postives = 39/89 (43.82%), Query Frame = 3
Query:  576 ELELRKNFEKY-----CSELKAFTFQILWGGDELSLDWAINSLMTQ---IYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNL 818
            +L LR+N E +     C+  K      L  G   S++ AI+  +T    I  +V  GSG+ AD+I      I+S       + E   NL
Sbjct:  326 DLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSIN-AIHDYVTMKPDIPAIVCDGSGRAADIISFAARYINSDGTFAAEVGEKLRNL 413          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Mouse
Match: Trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:MGI Symbol;Acc:MGI:2675603])

HSP 1 Score: 41.2022 bits (95), Expect = 5.667e-7
Identity = 36/155 (23.23%), Postives = 76/155 (49.03%), Query Frame = 1
Query:  109 TVEKIQIEN-VDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQ----WVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD 540
            +VEK  +++  D +  I F + E +   H  K+++   D   D      +   +LK      PK++IS++GG+++     ++   LK+TF + L+   +    W+I  G+N G+ K + + ++ +      ++I  +G   +  IE+ + +V  D
Sbjct:   73 SVEKHTVKSPTDTFGTINFQDGEHI---HHSKYIRTSWDTKSD-----HLLHLMLKEWNMELPKLVISVHGGLQNF----KISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGDALK-AHSSKSLRKIWTVGIPPWGVIENQRELVGKD 214          

HSP 2 Score: 33.4982 bits (75), Expect = 5.667e-7
Identity = 53/245 (21.63%), Postives = 106/245 (43.27%), Query Frame = 3
Query:  576 ELELRKNFEKYCSELKAFTFQ---------ILWGGDELSLDWAINSLMTQIYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNLEGDL--------DRLRNQLGELWKYRDKILIYDIKSKT-EGLDKQIFEAIKSCLNNNLEKILIYSMSFKEQMIKQTGVFKDEKFKNLENKQKRNVLKSILKNNKPILLELFLENEMSIDMFLEEADLIELYEESINGRIG-CSKLLNEKFQEIKR 1253
            E +LR+N EK+ S  K  T           ++ GG  + L W   ++  +  VVV +G+G+ AD++      ++    +   ++E    L  ++          L   L E   ++D I I+D  S+  + LD  I  A+    + ++ + L  +M++    I +  +      ++ +       +   L  ++   ++L +EN +++  FL    L ELY    N + G  +K L    Q++K+
Sbjct:  253 EEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVMEGGPNVIL-WVWETVKNKEPVVVCEGTGRAADLLAFTYKHLEDGGILRPQVKEELFCLIQNMFNFSLRQSKHLFQILMECMVHKDSITIFDADSEEHQDLDLAILTALLKGTSLSISEQLNLAMAWDRMDIAKKHILT--YGQHWKPGALEQAMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELY----NTKQGPTNKFLRHLVQDVKQ 490          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Mouse
Match: Trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:MGI Symbol;Acc:MGI:2675603])

HSP 1 Score: 41.9726 bits (97), Expect = 8.333e-7
Identity = 35/155 (22.58%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  109 TVEKIQIEN-VDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLI----ADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD 540
            +VEK  +++  D +  I F + E +    +I+           D   D +   +LK      PK++IS++GG+++     ++   LK+TF + L+        W+I  G+N G+ K + + ++ +      ++I  +G   +  IE+ + +V  D
Sbjct:   73 SVEKHTVKSPTDTFGTINFQDGEHIHHSKYIR--------TSWDTKSDHLLHLMLKEWNMELPKLVISVHGGLQNF----KISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGDALK-AHSSKSLRKIWTVGIPPWGVIENQRELVGKD 214          

HSP 2 Score: 32.3426 bits (72), Expect = 8.333e-7
Identity = 55/246 (22.36%), Postives = 108/246 (43.90%), Query Frame = 3
Query:  576 ELELRKNFEKYCSELKAFTFQ---------ILWGGDELSLDWAINSLMTQIYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNLEGDL--------DRLRNQLGELWKYRDKILIYDIKS-KTEGLDKQIFEAIKSCLNNNLEKILIYSMSFKEQMIKQTGVFK-DEKFKNLENKQKRNVLKSILKNNKPILLELFLENEMSIDMFLEEADLIELYEESINGRIGCS-KLLNEKFQEIKR 1253
            E +LR+N EK+ S  K  T           ++ GG  + L W   ++  +  VVV +G+G+ AD++      ++    +   ++E    L  ++          L   L E   ++D I I+D  S + + LD  I  A+    + ++ + L  +M++    I +  +    + +K    +Q    +   L  ++   ++L +EN +++  FL    L ELY    N + G + K L    Q++K+
Sbjct:  253 EEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVMEGGPNVIL-WVWETVKNKEPVVVCEGTGRAADLLAFTYKHLEDGGILRPQVKEELFCLIQNMFNFSLRQSKHLFQILMECMVHKDSITIFDADSEEHQDLDLAILTALLKGTSLSISEQLNLAMAWDRMDIAKKHILTYGQHWKPGALEQ---AMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELY----NTKQGPTNKFLRHLVQDVKQ 490          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Mouse
Match: Trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:MGI Symbol;Acc:MGI:1929996])

HSP 1 Score: 52.7582 bits (125), Expect = 3.827e-6
Identity = 43/182 (23.63%), Postives = 88/182 (48.35%), Query Frame = 1
Query:   16 YHCFIISIALGILKSIGMSKYKFKSIEKSIKTVEK-IQIENVDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD 540
            + CF  S+A+     + + ++  ++IE+   +VEK  +    DAY +I F   +  S  +  K+++L  D  P+      I   LLK      PK++IS++GG++  +    +++ L +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   +V  D
Sbjct:   51 HACFTASLAMK-YSDVKLGEHFNQAIEEW--SVEKHTEQSPTDAYGVINF---QGGSHSYRAKYVRLSYDTKPE-----IILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKE-HASRSSRKICTIGIAPWGVIENRNDLVGRD 220          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Mouse
Match: Trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:MGI Symbol;Acc:MGI:1929996])

HSP 1 Score: 52.7582 bits (125), Expect = 3.925e-6
Identity = 43/182 (23.63%), Postives = 88/182 (48.35%), Query Frame = 1
Query:   16 YHCFIISIALGILKSIGMSKYKFKSIEKSIKTVEK-IQIENVDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD 540
            + CF  S+A+     + + ++  ++IE+   +VEK  +    DAY +I F   +  S  +  K+++L  D  P+      I   LLK      PK++IS++GG++  +    +++ L +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   +V  D
Sbjct:   51 HACFTASLAMK-YSDVKLGEHFNQAIEEW--SVEKHTEQSPTDAYGVINF---QGGSHSYRAKYVRLSYDTKPE-----IILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKE-HASRSSRKICTIGIAPWGVIENRNDLVGRD 220          
BLAST of Transient receptor potential ion channel M b vs. UniProt/SwissProt
Match: sp|Q8CIR4|TRPM6_MOUSE (Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1)

HSP 1 Score: 41.2022 bits (95), Expect = 3.464e-6
Identity = 36/155 (23.23%), Postives = 76/155 (49.03%), Query Frame = 1
Query:  109 TVEKIQIEN-VDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQ----WVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD 540
            +VEK  +++  D +  I F + E +   H  K+++   D   D      +   +LK      PK++IS++GG+++     ++   LK+TF + L+   +    W+I  G+N G+ K + + ++ +      ++I  +G   +  IE+ + +V  D
Sbjct:   73 SVEKHTVKSPTDTFGTINFQDGEHI---HHSKYIRTSWDTKSD-----HLLHLMLKEWNMELPKLVISVHGGLQNF----KISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGDALK-AHSSKSLRKIWTVGIPPWGVIENQRELVGKD 214          

HSP 2 Score: 33.4982 bits (75), Expect = 3.464e-6
Identity = 53/245 (21.63%), Postives = 106/245 (43.27%), Query Frame = 3
Query:  576 ELELRKNFEKYCSELKAFTFQ---------ILWGGDELSLDWAINSLMTQIYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNLEGDL--------DRLRNQLGELWKYRDKILIYDIKSKT-EGLDKQIFEAIKSCLNNNLEKILIYSMSFKEQMIKQTGVFKDEKFKNLENKQKRNVLKSILKNNKPILLELFLENEMSIDMFLEEADLIELYEESINGRIG-CSKLLNEKFQEIKR 1253
            E +LR+N EK+ S  K  T           ++ GG  + L W   ++  +  VVV +G+G+ AD++      ++    +   ++E    L  ++          L   L E   ++D I I+D  S+  + LD  I  A+    + ++ + L  +M++    I +  +      ++ +       +   L  ++   ++L +EN +++  FL    L ELY    N + G  +K L    Q++K+
Sbjct:  253 EEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVMEGGPNVIL-WVWETVKNKEPVVVCEGTGRAADLLAFTYKHLEDGGILRPQVKEELFCLIQNMFNFSLRQSKHLFQILMECMVHKDSITIFDADSEEHQDLDLAILTALLKGTSLSISEQLNLAMAWDRMDIAKKHILT--YGQHWKPGALEQAMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELY----NTKQGPTNKFLRHLVQDVKQ 490          
BLAST of Transient receptor potential ion channel M b vs. TrEMBL
Match: K7JWY8 (C2H2-type domain-containing protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.784e-16
Identity = 59/202 (29.21%), Postives = 102/202 (50.50%), Query Frame = 1
Query: 1954 EWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKC-EDKESESNVMNHCPSANWSRVEKHNYVLKELADELKK--RNINFEKDFVR-KKPKENLRLDLVIR--LKEKIMIVDIKCPFDEK-SAVESARNRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQIGIRYEDSKKMSQKMIQKAIHGSKKTYDHH 2538
            +WRF+ +A+ + L +N  +  Q G     +CR+C  D E+  +V++HC   + +R ++HN +   L     +    I+  +  V  + P   LR D+V+R  +  ++ IVD+  PF+ +  A +  R   + KY  LA+ +   +G   TV  FVV +LG+WD RN  +L  + I    +  M + M+   I  S+  Y  H
Sbjct:  152 DWRFIHRARLDVLPLNAAKRWQRGM--DKRCRRCGSDLETLPHVLSHCGPHSAARQKRHNNIQDRLVKAASRCPGTISVNQTVVGVRGPDAALRPDIVVRDDVNRRVTIVDVAVPFENRLEAFDGVREAKIAKYTPLARQL-TDSGYTVTVEAFVVGALGAWDPRNERVLSLLSISRYYAILMRRLMVSDTIRWSRDIYVEH 350          
BLAST of Transient receptor potential ion channel M b vs. TrEMBL
Match: K7JS44 (C2H2-type domain-containing protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.809e-16
Identity = 59/202 (29.21%), Postives = 102/202 (50.50%), Query Frame = 1
Query: 1954 EWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKC-EDKESESNVMNHCPSANWSRVEKHNYVLKELADELKK--RNINFEKDFVR-KKPKENLRLDLVIR--LKEKIMIVDIKCPFDEK-SAVESARNRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQIGIRYEDSKKMSQKMIQKAIHGSKKTYDHH 2538
            +WRF+ +A+ + L +N  +  Q G     +CR+C  D E+  +V++HC   + +R ++HN +   L     +    I+  +  V  + P   LR D+V+R  +  ++ IVD+  PF+ +  A +  R   + KY  LA+ +   +G   TV  FVV +LG+WD RN  +L  + I    +  M + M+   I  S+  Y  H
Sbjct:  152 DWRFIHRARLDVLPLNAAKRWQRGM--DKRCRRCGSDLETLPHVLSHCGPHSAARQKRHNNIQDRLVKAASRCPGTISVNQTVVGVRGPDAALRPDIVVRDDVNRRVTIVDVAVPFENRLEAFDGVREAKIAKYTPLARQL-TDSGYTVTVEAFVVGALGAWDPRNERVLSLLSISRYYAILMRRLMVSDTIRWSRDIYVEH 350          
BLAST of Transient receptor potential ion channel M b vs. TrEMBL
Match: K7JS43 (C2H2-type domain-containing protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.888e-16
Identity = 59/202 (29.21%), Postives = 102/202 (50.50%), Query Frame = 1
Query: 1954 EWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKC-EDKESESNVMNHCPSANWSRVEKHNYVLKELADELKK--RNINFEKDFVR-KKPKENLRLDLVIR--LKEKIMIVDIKCPFDEK-SAVESARNRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQIGIRYEDSKKMSQKMIQKAIHGSKKTYDHH 2538
            +WRF+ +A+ + L +N  +  Q G     +CR+C  D E+  +V++HC   + +R ++HN +   L     +    I+  +  V  + P   LR D+V+R  +  ++ IVD+  PF+ +  A +  R   + KY  LA+ +   +G   TV  FVV +LG+WD RN  +L  + I    +  M + M+   I  S+  Y  H
Sbjct:  152 DWRFIHRARLDVLPLNAAKRWQRGM--DKRCRRCGSDLETLPHVLSHCGPHSAARQKRHNNIQDRLVKAASRCPGTISVNQTVVGVRGPDAALRPDIVVRDDVNRRVTIVDVAVPFENRLEAFDGVREAKIAKYTPLARQL-TDSGYTVTVEAFVVGALGAWDPRNERVLSLLSISRYYAILMRRLMVSDTIRWSRDIYVEH 350          
BLAST of Transient receptor potential ion channel M b vs. TrEMBL
Match: A0A4Y2TDL7 (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 OS=Araneus ventricosus OX=182803 GN=PO21_49 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.804e-14
Identity = 66/205 (32.20%), Postives = 102/205 (49.76%), Query Frame = 1
Query: 1954 EWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKCE--DKESESNVMNHCPSANWSRVEKHNYVLKELADELKKRNINFEKDFV----RKKPKENLRLDLVIRLKEKIMIVDIKCPFDEK-SAVESARNRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQI---GIRYEDSKKMSQKMIQKAIHGSKKTYDHH 2538
            EWRF+ KA+ N L +N    +   R  +T CR+CE  D E+ ++V+NHC   +     +HN     ++D LK+  I F+   +    +    + LR DLV R   +I I+D+ CPF+ +  A   AR   +DKY  L     A  GL  ++   +V +LGSWD +NN  L++      RY    K  +  + + I  S+  Y  H
Sbjct: 1088 EWRFVHKARTNTLPLNGN--SPWDRSGNTGCRRCEECDLETLAHVLNHCKGRSRGWQLRHN----SISDRLKQALI-FDGCVLIAENQSVGPDGLRPDLVFRKGNEIYIIDVTCPFENRLEAFTDARQLKLDKYAPLIPYF-ANMGLTASIIPILVGALGSWDPKNNSFLKKHMSRSFRY----KFEKLCVSETIRWSRDIYVEH 1280          
BLAST of Transient receptor potential ion channel M b vs. TrEMBL
Match: B4NX04 (Uncharacterized protein OS=Drosophila yakuba OX=7245 GN=Dyak\GE18776 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.384e-14
Identity = 63/202 (31.19%), Postives = 102/202 (50.50%), Query Frame = 1
Query: 1954 EWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKCEDK-ESESNVMNHCPSANWSRVEKHNYVLKELA---DELKKRNINFEKDFVRKKPKENLRLDLVIR--LKEKIMIVDIKCPFDEKS-AVESARNRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQIGIRYEDSKKMSQKMIQKAIHGSKKTYDHH 2538
            +WRF+ +A+   L VN       G     +CR C  + ES  +V+ HC   + +  ++HN V+  LA     L    +N   + V +     LR DLV R     KI+IVD+  PF+  + A ++AR    +KY+ LA+ ++A  G Q  +  F+V +LGSWD +N  +L+ +G+    +  M + M+   I  S+  Y  H
Sbjct:  253 DWRFIHRARLGVLPVNGAIRWGSG---DKRCRVCGYQLESVPHVLCHCMHHSNAMQQRHNAVMDRLAKAGSRLGTPRVNCRVEGVAED-MAALRPDLVWRDERSRKIVIVDVTVPFENGAEAFDNARGEKEEKYRPLAEALRA-MGYQVKLEAFIVGALGSWDPKNERVLKTLGVSRFYAGLMRRLMVADTIRWSRDIYVEH 449          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Cavefish
Match: ENSAMXT00000034560.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000712.1:195631:202616:-1 gene:ENSAMXG00000042811.1 transcript:ENSAMXT00000034560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 4.276e-10
Identity = 42/144 (29.17%), Postives = 69/144 (47.92%), Query Frame = 1
Query: 2038 TKCRKCEDK-ESESNVMNHCPSANWSRVEKHNYVLKELADELKKRNINFEKDFVRKKPKENLRL-DLVIRLKEKIMIVDIKCPFD-EKSAVESARNRNMDKYKELAKDMQAKTGLQ-TTVSTFVVCSLGSWDKRNNEILRQIGI 2457
             KCR+C    ES S+++  CPS   SR+++HN +   LA E ++      ++     P   LRL DLV+      +++D+   F+ E  ++E A    +  Y      + A  G +   V  F V + G W   NN +L +IG+
Sbjct:  990 AKCRRCAAPLESCSHILGQCPSVQSSRIKRHNKMCALLAQEAERYGWTVIREPRISGPLGELRLPDLVLSKGNSALVIDVTVRFEYEARSLEKAAEEKVAYYAPYESQIAALVGAERVQVFGFPVGARGKWPSCNNHVLSEIGL 1133          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 52.373 bits (124), Expect = 3.746e-6
Identity = 47/197 (23.86%), Postives = 91/197 (46.19%), Query Frame = 1
Query:   43 LGILKSIGMSKYKFKSIEKSIKTVEKIQIEN------VDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD----KKREINHLSNLKSLS 585
            +G   S+ M KY    + ++    E+  +EN       DAY II F   +  S  +  K+++L  D  P+      I   +LK      PK++IS++GGI++ D    +++ + +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   ++  D     +  +N LS L  L+
Sbjct:   52 VGFTASLAM-KYSDMKLGEAQPPHEEWSVENHTEQSPTDAYGIINF---QGGSHSYRAKYVRLSHDSRPE-----AILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHS-SRSARKICTIGIAPWGVIENRNDLIGRDVVAPYQTLLNPLSKLNVLN 238          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 52.373 bits (124), Expect = 3.805e-6
Identity = 47/197 (23.86%), Postives = 91/197 (46.19%), Query Frame = 1
Query:   43 LGILKSIGMSKYKFKSIEKSIKTVEKIQIEN------VDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD----KKREINHLSNLKSLS 585
            +G   S+ M KY    + ++    E+  +EN       DAY II F   +  S  +  K+++L  D  P+      I   +LK      PK++IS++GGI++ D    +++ + +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   ++  D     +  +N LS L  L+
Sbjct:   52 VGFTASLAM-KYSDMKLGEAQPPHEEWSVENHTEQSPTDAYGIINF---QGGSHSYRAKYVRLSHDSRPE-----AILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHS-SRSARKICTIGIAPWGVIENRNDLIGRDVVAPYQTLLNPLSKLNVLN 238          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 52.373 bits (124), Expect = 3.877e-6
Identity = 47/197 (23.86%), Postives = 91/197 (46.19%), Query Frame = 1
Query:   43 LGILKSIGMSKYKFKSIEKSIKTVEKIQIEN------VDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD----KKREINHLSNLKSLS 585
            +G   S+ M KY    + ++    E+  +EN       DAY II F   +  S  +  K+++L  D  P+      I   +LK      PK++IS++GGI++ D    +++ + +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   ++  D     +  +N LS L  L+
Sbjct:   62 VGFTASLAM-KYSDMKLGEAQPPHEEWSVENHTEQSPTDAYGIINF---QGGSHSYRAKYVRLSHDSRPE-----AILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHS-SRSARKICTIGIAPWGVIENRNDLIGRDVVAPYQTLLNPLSKLNVLN 248          
BLAST of Transient receptor potential ion channel M b vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 52.373 bits (124), Expect = 3.879e-6
Identity = 47/197 (23.86%), Postives = 91/197 (46.19%), Query Frame = 1
Query:   43 LGILKSIGMSKYKFKSIEKSIKTVEKIQIEN------VDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLK------PKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTD----KKREINHLSNLKSLS 585
            +G   S+ M KY    + ++    E+  +EN       DAY II F   +  S  +  K+++L  D  P+      I   +LK      PK++IS++GGI++ D    +++ + +   +  +    W++  G+N G+ K + + ++E       ++I  IG   +  IE+   ++  D     +  +N LS L  L+
Sbjct:   69 VGFTASLAM-KYSDMKLGEAQPPHEEWSVENHTEQSPTDAYGIINF---QGGSHSYRAKYVRLSHDSRPE-----AILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHS-SRSARKICTIGIAPWGVIENRNDLIGRDVVAPYQTLLNPLSKLNVLN 255          
BLAST of Transient receptor potential ion channel M b vs. Planmine SMEST
Match: SMESG000017090.1 (SMESG000017090.1)

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 374/375 (99.73%), Postives = 375/375 (100.00%), Query Frame = 3
Query:  573 EELELRKNFEKYCSELKAFTFQILWGGDELSLDWAINSLMTQIYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNLEGDLDRLRNQLGELWKYRDKILIYDIKSKTEGLDKQIFEAIKSCLNNNLEKILIYSMSFKEQMIKQTGVFKDEKFKNLENKQKRNVLKSILKNNKPILLELFLENEMSIDMFLEEADLIELYEESINGRIGCSKLLNEKFQEIKRIYSAKNRKKSNDVNNQDCLDQPDANKQSTFNRERIKTPNTDESEKKTEKRNFVRFQFGNXXXXXXXXXXXXXHLLMQXXXXXXXXXXXXSQKLFIWALLSEYFEVAFIIWREGNDHISTALTGSILLKDISKYFIDLSQLSEKYLKES 1697
            +ELELRKNFEKYCSELKAFTFQILWGGDELSLDWAINSLMTQIYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNLEGDLDRLRNQLGELWKYRDKILIYDIKSKTEGLDKQIFEAIKSCLNNNLEKILIYSMSFKEQMIKQTGVFKDEKFKNLENKQKRNVLKSILKNNKPILLELFLENEMSIDMFLEEADLIELYEESINGRIGCSKLLNEKFQEIKRIYSAKNRKKSNDVNNQDCLDQPDANKQSTFNRERIKTPNTDESEKKTEKRNFVRFQFGNKSESKDYHSSKSSHLLMQNIIYEINRNYIESQKLFIWALLSEYFEVAFIIWREGNDHISTALTGSILLKDISKYFIDLSQLSEKYLKES
Sbjct:  190 KELELRKNFEKYCSELKAFTFQILWGGDELSLDWAINSLMTQIYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNLEGDLDRLRNQLGELWKYRDKILIYDIKSKTEGLDKQIFEAIKSCLNNNLEKILIYSMSFKEQMIKQTGVFKDEKFKNLENKQKRNVLKSILKNNKPILLELFLENEMSIDMFLEEADLIELYEESINGRIGCSKLLNEKFQEIKRIYSAKNRKKSNDVNNQDCLDQPDANKQSTFNRERIKTPNTDESEKKTEKRNFVRFQFGNKSESKDYHSSKSSHLLMQNIIYEINRNYIESQKLFIWALLSEYFEVAFIIWREGNDHISTALTGSILLKDISKYFIDLSQLSEKYLKES 564          

HSP 2 Score: 335.109 bits (858), Expect = 0.000e+0
Identity = 168/170 (98.82%), Postives = 169/170 (99.41%), Query Frame = 1
Query:   67 MSKYKFKSIEKSIKTVEKIQIENVDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLKPKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTDKKREINHLSNLK 576
            MSKYKFKSIEKSIKTVEKIQIENVDAYEIIKF EYEDLSKDHFIKFMKLEPDKVPDDKILDKIFG+LLKPKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTDKKREINHLSNLK
Sbjct:    1 MSKYKFKSIEKSIKTVEKIQIENVDAYEIIKFREYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGSLLKPKVIISINGGIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFDNEDKQINLIGFYNFSEIESNQSVVKTDKKREINHLSNLK 170          

HSP 3 Score: 306.99 bits (785), Expect = 8.005e-88
Identity = 160/178 (89.89%), Postives = 162/178 (91.01%), Query Frame = 1
Query: 2641 HSYRTMAIHMMAKIFNKNPTKANSILLRPIDRWEKMSCLQIAVNGNVKEFCNLNACHSFTKRAWIGKFEAKTKSRDLFSNNKENKKSSVLQFRKRIKRYLRAPISKFFTNLVRKFVNCENLEIFIF*VAYVXXXXXXMDVNLFRLNEIGKYKRKIEYWTEIYVYAYFLIFIVEEINQV 3174
            +SYRTMAIHMMAKIFNKNPTKANSILLRPIDRWEKMSCLQIAVNGNVKEFCNLNACHSFTKRAWIGKFEAKTKSRDLFSNNKENKKSSVLQFRKRIKRYLRAPISKFFTNL                VAYVLFLLFFMDVNLFRLNEIGKYKRKIEYWTEIYVYAYFLIFIVEEINQ+
Sbjct:  565 NSYRTMAIHMMAKIFNKNPTKANSILLRPIDRWEKMSCLQIAVNGNVKEFCNLNACHSFTKRAWIGKFEAKTKSRDLFSNNKENKKSSVLQFRKRIKRYLRAPISKFFTNL----------------VAYVLFLLFFMDVNLFRLNEIGKYKRKIEYWTEIYVYAYFLIFIVEEINQI 726          
BLAST of Transient receptor potential ion channel M b vs. Planmine SMEST
Match: SMESG000047667.1 (SMESG000047667.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.504e-123
Identity = 163/266 (61.28%), Postives = 203/266 (76.32%), Query Frame = 1
Query: 1936 KGPPEPEWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKCEDKESESNVMNHCPSANWSRVEKHNYVLKELADELKKRNINFEKDFVRKKPKENLRLDLVIRLKEKIMIVDIKCPFDEKSAVESARNRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQIGIRYEDSKKMSQKMIQKAIHGSKKTYDHHRNFSNG*NQPRYNKMNCGLIWKP--IEPSYHGCCWKHSYRTMAIHMMAKIFNKNPTKANSILLRP 2727
            +G P+P+WRFLTK +AN LD+NMKQANQGGRL +TKCRKCEDKES S+V+NHC S NWSRVEKHN V  ELA EL KRNI+FEKD + K+ K  LR DLVIRLK+KIMIVDIKCPFDE+SA+ESARN+N+DKY+ELAK++QAKT L TT+STFVVCSLG+WDKRNNE+LRQ+GIRYE+SK+M   MI KAIHGS+KTYD HRNF+NG +  +   +    +  P      Y    W   Y +++ +   +  N+NP + +  +  P
Sbjct: 1354 RGLPDPDWRFLTKVRANMLDINMKQANQGGRLGNTKCRKCEDKESASHVINHCASGNWSRVEKHNQVQNELAKELTKRNISFEKDCIPKETKGTLRPDLVIRLKDKIMIVDIKCPFDEESAIESARNKNIDKYRELAKEIQAKTVLPTTISTFVVCSLGTWDKRNNELLRQMGIRYEESKEMRINMIHKAIHGSRKTYDQHRNFNNGSSSSKCRDVERTTLTVPSKFAGRYRQALWDRGY-SISTYGTPEWPNRNPDRRDEDIKLP 1618          

HSP 2 Score: 135.961 bits (341), Expect = 1.504e-123
Identity = 63/90 (70.00%), Postives = 78/90 (86.67%), Query Frame = 2
Query: 1688 EGIETLDKKHKIKVRFVVKENFIENKIKCETQEKTVEFDDSRELSKTLHYMIKEAYYKEWKALKCQGYIINLKMSEYMQWKILRGLPNPN 1957
            E  +TL+KKHKIKVRFV KEN I  KIKC+TQEK  E D+S+ELSK+LH+MIKEAY+KEWK LKCQGYI++LK SE+M+WK+ RGLP+P+
Sbjct: 1271 EAFQTLEKKHKIKVRFVPKENGIGYKIKCDTQEKVEELDNSKELSKSLHWMIKEAYFKEWKTLKCQGYILSLKTSEFMEWKMPRGLPDPD 1360          
BLAST of Transient receptor potential ion channel M b vs. Planmine SMEST
Match: SMESG000069571.1 (SMESG000069571.1)

HSP 1 Score: 339.347 bits (869), Expect = 7.400e-119
Identity = 158/207 (76.33%), Postives = 185/207 (89.37%), Query Frame = 1
Query: 1936 KGPPEPEWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKCEDKESESNVMNHCPSANWSRVEKHNYVLKELADELKKRNINFEKDFVRKKPKENLRLDLVIRLKEKIMIVDIKCPFDEKSAVESARNRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQIGIRYEDSKKMSQKMIQKAIHGSKKTYDHHRNFSNG 2556
            +G P+P+WRFLTKAKAN LDVNMKQANQGGRL STKCRKCEDKES S+V+ HCPS NWSRVEKHN V  EL  EL KRNI+FEKD + K+ K++LR DLVIR K+KIMIVDIKCPFDE+SA+E ARN+NMDKY+ELAK++ +KTGLQTTVSTFVVCSLG+WDKRNNE+LRQIGIRYE++K+M  +MIQK IHGS+KTYDHHRN++NG
Sbjct:  886 RGLPDPDWRFLTKAKANMLDVNMKQANQGGRLGSTKCRKCEDKESASHVIYHCPSGNWSRVEKHNQVQNELTKELAKRNISFEKDSIPKEFKDSLRPDLVIRFKDKIMIVDIKCPFDEESAIEIARNKNMDKYRELAKEIHSKTGLQTTVSTFVVCSLGTWDKRNNELLRQIGIRYEETKEMKIRMIQKTIHGSRKTYDHHRNYNNG 1092          

HSP 2 Score: 109.768 bits (273), Expect = 7.400e-119
Identity = 49/73 (67.12%), Postives = 62/73 (84.93%), Query Frame = 2
Query: 1739 VKENFIENKIKCETQEKTVEFDDSRELSKTLHYMIKEAYYKEWKALKCQGYIINLKMSEYMQWKILRGLPNPN 1957
            + E  I  +IKCETQEK VE D+S++LSKTLH+MI EA Y+EWKALKCQGYII+LK SE+M+WK+ RGLP+P+
Sbjct:  820 LNEGCIGYRIKCETQEKAVELDNSKDLSKTLHWMINEADYREWKALKCQGYIISLKTSEFMEWKMPRGLPDPD 892          
BLAST of Transient receptor potential ion channel M b vs. Planmine SMEST
Match: SMESG000013875.1 (SMESG000013875.1)

HSP 1 Score: 160.229 bits (404), Expect = 3.455e-74
Identity = 76/106 (71.70%), Postives = 88/106 (83.02%), Query Frame = 1
Query: 1936 KGPPEPEWRFLTKAKANKLDVNMKQANQGGRLRSTKCRKCEDKESESNVMNHCPSANWSRVEKHNYVLKELADELKKRNINFEKDFVRKKPKENLRLDLVIRLKEK 2253
            +G P+P+WRFLTK +AN LD+NMKQANQGGRL +TKCRKCEDKES S+V+NHC S NWSRVEKHN V  ELA EL KRNI+FEKD + K+ K  LR DLVIRLK+K
Sbjct:  751 RGLPDPDWRFLTKVRANMLDINMKQANQGGRLGNTKCRKCEDKESASHVINHCASGNWSRVEKHNQVQNELAKELTKRNISFEKDSIPKETKGTLRPDLVIRLKDK 856          

HSP 2 Score: 139.813 bits (351), Expect = 3.455e-74
Identity = 65/90 (72.22%), Postives = 80/90 (88.89%), Query Frame = 2
Query: 1688 EGIETLDKKHKIKVRFVVKENFIENKIKCETQEKTVEFDDSRELSKTLHYMIKEAYYKEWKALKCQGYIINLKMSEYMQWKILRGLPNPN 1957
            E  +TL+KKHKIKVRFV KEN I  KIKC+TQEK VE D+S+ELSK+LH+MIKEAY+KEWKALKCQGYI++LK SE+M+WK+ RGLP+P+
Sbjct:  668 EAFQTLEKKHKIKVRFVPKENGIGYKIKCDTQEKIVELDNSKELSKSLHWMIKEAYFKEWKALKCQGYILSLKTSEFMEWKMPRGLPDPD 757          
BLAST of Transient receptor potential ion channel M b vs. Planmine SMEST
Match: SMESG000004977.1 (SMESG000004977.1)

HSP 1 Score: 121.324 bits (303), Expect = 8.360e-45
Identity = 119/395 (30.13%), Postives = 190/395 (48.10%), Query Frame = 3
Query:  528 CQDG*KKRN*PFIQFE-ELELRKNFEKYCSEL-KAFTFQILWGGDELSLDWAINSLMTQIYVVVMKGSGKRADVICSMLN-----KIDSADNIEMAIQEYCGNLEGDLDRLRNQLGELW-KYRDKILIYDIKSKTEGLDKQIFEAIKSCLNNN-LEKILIYSMSFKEQMIKQTGVFKDEKFKNLENKQKRNVLKSILKNNKPILLELFLENEMSIDMFLEEADLIELYEESINGRIG-CSKLLNEKFQEIKRIYSAKNRKKS----------------NDVNNQDCLDQPDANKQSTFNRERIKTPNTDESEKKTEKRNFVRFQFGNXXXXXXXXXXXXXHLLMQXXXXXXXXXXXXSQKLFIWALLSEYFEVAFIIWREGNDHISTALTGSILL 1634
            C DG +K      Q++ E   R  FEK   E       QIL+ G   +L+ A NSL   I +V++K SG+ ADVI ++L+      ++   +I  A Q      E D+++ +  L E++ KYR++I ++D+  K+  LD++I EA+ S +++N LEKIL  ++ F    I +  VF +  +++L  K      K +LKNN+   ++LFLEN  SI+ FL E DL  LY  S+  +   C  LL +      + + +K RKKS                N + N++   +P         R+ I+   TDE   + + ++F+                                  I  Q LF+WALL+E+ E+A I W+ G +HI +AL  SI+L
Sbjct:  222 CDDGTEK------QYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTSYLEKIKSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSK-RKKSKYLLYPVRRIINMMSGNILQNENIHPKP--------GRQLIR---TDEENFEFQSQSFIEVH----------------------------SKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIIL 570          

HSP 2 Score: 80.4925 bits (197), Expect = 8.360e-45
Identity = 45/142 (31.69%), Postives = 78/142 (54.93%), Query Frame = 1
Query:  124 QIENVDAYEIIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALL------KPKVIISINGGIEDIDFD-KEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQESRFD--NEDKQINLIGFYNFSEIESNQ 522
            +    D + II F  Y D+  +H+  F++   +  P+  I++ ++  ++      KP++IIS+ GG++ ++F+  + +K+ KQ+  E L  D  W+IG G N GIH LISE V E R    N   Q+ L+G   +  I +N+
Sbjct:   51 KCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPE--IVEVVYKLMILYWNFFKPQLIISVTGGLKRMNFNTNQQKKNFKQSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNK 190          

HSP 3 Score: 65.4698 bits (158), Expect = 2.297e-10
Identity = 58/224 (25.89%), Postives = 99/224 (44.20%), Query Frame = 1
Query: 2647 YRTMAIHMMAKIFNKNPTKANSILLRPIDRWEKMSCLQIAVNGNVKEFCNLNACHSFTKRAWIGKF-----------------------------------------EAKTKSRDLFSNN------KENKKSSVLQFRKRIKRYLRAPISKFFTNLVRKFVNCENLEIFIF*VAYVXXXXXXMDVNLFRLNEIGKYKRKIE-YWTEIYVYAYFLIFIVEEINQV 3174
            ++ MAI ++ +  NK      ++L+R +  W  M+CLQIA++GN+ EF + +AC S+ ++ W G+                                          E++T      +N+       ++KK + + ++  IK + + PI KF  +L                ++YVLFLL F+ +NL  L    K   KI+  W EI+++ Y L  I EEI Q+
Sbjct:  596 FQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWKILISIPFSFILIKPLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHL----------------ISYVLFLLVFIYLNLVEL----KLNLKIQNRWAEIFIFFYVLGIITEEIRQI 799          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential ion channel M b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRPM77.062e-623.63transient receptor potential cation channel subfam... [more]
TRPM77.121e-623.63transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtl-21.103e-622.45Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Trpm65.667e-723.23transient receptor potential cation channel, subfa... [more]
Trpm68.333e-722.58transient receptor potential cation channel, subfa... [more]
Trpm73.827e-623.63transient receptor potential cation channel, subfa... [more]
Trpm73.925e-623.63transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential ion channel M b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8CIR4|TRPM6_MOUSE3.464e-623.23Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential ion channel M b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7JWY82.784e-1629.21C2H2-type domain-containing protein OS=Nasonia vit... [more]
K7JS442.809e-1629.21C2H2-type domain-containing protein OS=Nasonia vit... [more]
K7JS432.888e-1629.21C2H2-type domain-containing protein OS=Nasonia vit... [more]
A0A4Y2TDL71.804e-1432.20Retrovirus-related Pol polyprotein from type-1 ret... [more]
B4NX042.384e-1431.19Uncharacterized protein OS=Drosophila yakuba OX=72... [more]
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034560.14.276e-1029.17pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
trpm73.746e-623.86transient receptor potential cation channel subfam... [more]
trpm73.805e-623.86transient receptor potential cation channel subfam... [more]
trpm73.877e-623.86transient receptor potential cation channel subfam... [more]
trpm73.879e-623.86transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential ion channel M b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential ion channel M b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017090.18.005e-8899.73SMESG000017090.1[more]
SMESG000047667.11.504e-12361.28SMESG000047667.1[more]
SMESG000069571.17.400e-11976.33SMESG000069571.1[more]
SMESG000013875.13.455e-7471.70SMESG000013875.1[more]
SMESG000004977.18.360e-4530.13SMESG000004977.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025705 ID=SMED30025705|Name=Transient receptor potential ion channel M b|organism=Schmidtea mediterranea sexual|type=transcript|length=3591bp
GTTTCTTCATTTAATTATCATTGTTTTATTATATCGATTGCGCTCGGAAT
ATTAAAATCGATTGGCATGAGCAAATATAAATTCAAATCTATTGAAAAAT
CAATAAAGACCGTTGAAAAAATACAAATCGAAAATGTCGACGCATACGAA
ATCATCAAATTTATAGAATATGAAGACTTATCCAAGGATCATTTTATAAA
ATTCATGAAGTTAGAGCCGGATAAAGTACCAGATGATAAAATCTTGGACA
AGATTTTTGGGGCGTTGCTTAAACCGAAAGTTATAATTTCCATTAACGGA
GGAATAGAAGATATTGATTTTGATAAAGAAGTGGAAAAGCATCTGAAACA
AACCTTTAAGGAATTTCTGATTGCAGATAACCAATGGGTTATTGGAACTG
GATTGAATTGCGGAATTCACAAATTGATCAGCGAAACTGTGCAAGAATCA
AGATTTGATAACGAGGACAAGCAAATTAACCTTATTGGATTTTATAATTT
TTCTGAGATAGAAAGCAATCAAAGTGTTGTCAAGACGGATAAAAAAAGAG
AAATTAACCATTTATCCAATTTGAAGAGCTTGAGTTACGTAAGAATTTCG
AAAAATATTGTTCAGAATTAAAAGCATTCACCTTTCAAATTCTTTGGGGT
GGAGATGAATTATCTCTGGATTGGGCGATTAATTCACTAATGACCCAAAT
ATATGTTGTAGTGATGAAGGGGTCAGGAAAAAGGGCTGATGTCATATGCT
CAATGCTCAATAAAATTGATTCTGCTGACAACATCGAGATGGCAATACAA
GAATATTGTGGCAATCTTGAAGGAGATCTAGATCGTCTTAGAAATCAGTT
AGGAGAACTTTGGAAATATAGAGACAAAATTTTAATTTATGACATAAAGA
GCAAAACAGAAGGATTAGACAAACAAATATTCGAGGCGATAAAATCATGT
CTAAATAATAACCTTGAGAAAATCCTGATATATTCCATGTCATTCAAGGA
ACAAATGATCAAACAAACAGGAGTCTTTAAAGATGAGAAGTTTAAAAATT
TGGAAAATAAACAAAAGCGAAATGTTTTGAAATCGATTTTGAAAAATAAC
AAACCGATTCTTTTAGAATTGTTTTTGGAAAACGAAATGAGCATCGACAT
GTTTCTTGAAGAAGCGGATCTCATTGAATTATATGAGGAATCTATCAATG
GGAGGATCGGATGCTCAAAATTACTCAATGAAAAATTCCAAGAAATCAAG
AGGATTTATTCCGCCAAAAACCGCAAGAAAAGTAATGATGTCAACAATCA
AGATTGTTTGGATCAACCAGATGCAAACAAACAAAGTACATTCAATCGAG
AACGCATTAAGACTCCCAATACTGACGAAAGTGAAAAGAAAACTGAAAAA
AGAAATTTCGTTAGATTTCAATTTGGAAACAAATCAGAATCAAAAGATTA
TCATAGTTCAAAATCCAGCCACCTCTTGATGCAAAACATCATCTATGAAA
TCAACAGAAACTATATTGAAAGTCAAAAACTATTCATTTGGGCCTTGCTT
TCTGAATACTTTGAAGTTGCTTTCATCATTTGGAGGGAGGGCAATGACCA
TATTTCCACTGCGTTGACAGGATCTATACTGTTGAAAGATATTTCCAAAT
ATTTCATTGATCTAAGTCAATTATCTGAAAAATATTTGAAGGAATCGAAA
CCCTAGATAAGAAACATAAGATCAAAGTCAGATTCGTCGTCAAAGAAAAC
TTTATCGAAAATAAAATAAAATGCGAAACCCAAGAAAAAACAGTCGAATT
CGATGACTCAAGAGAATTGTCCAAGACTCTACATTACATGATAAAAGAAG
CCTACTACAAAGAATGGAAAGCCTTAAAATGCCAAGGATATATAATAAAC
CTCAAGATGTCCGAATATATGCAATGGAAAATACTAAGGGGCCTCCCGAA
CCCGAATGGAGATTCCTAACAAAAGCAAAGGCAAATAAGTTAGATGTAAA
TATGAAGCAGGCTAACCAAGGAGGAAGGTTGAGAAGCACAAAATGCCGAA
AATGCGAAGACAAAGAATCAGAAAGTAATGTAATGAACCACTGTCCTTCC
GCTAATTGGAGCAGAGTTGAAAAGCACAACTACGTACTAAAAGAGTTAGC
AGATGAATTAAAGAAGAGGAATATAAACTTTGAAAAAGACTTTGTCAGAA
AGAAACCAAAGGAAAACTTACGACTAGATTTGGTAATAAGACTAAAAGAG
AAAATTATGATAGTGGATATCAAATGTCCATTTGATGAAAAATCAGCTGT
AGAAAGTGCCAGAAACAGGAATATGGATAAATACAAAGAATTAGCCAAAG
ACATGCAAGCCAAAACTGGGTTACAAACAACAGTCTCAACTTTCGTTGTT
TGTTCTTTGGGATCCTGGGATAAAAGAAACAATGAAATCCTAAGGCAAAT
TGGAATCAGATATGAAGACTCGAAAAAAATGAGCCAAAAGATGATACAAA
AAGCAATACACGGATCAAAAAAAACGTATGACCACCATAGAAATTTCAGC
AACGGGTAAAACCAACCAAGGTACAATAAGATGAATTGTGGACTCATCTG
GAAACCAATCGAGCCTAGCTATCATGGTTGCTGTTGGAAGCATTCCTACA
GAACTATGGCAATTCATATGATGGCCAAGATTTTCAATAAAAATCCGACG
AAGGCAAACTCAATTTTATTGAGACCCATAGATCGTTGGGAGAAAATGAG
CTGCTTGCAGATTGCTGTCAATGGTAATGTCAAAGAATTTTGTAATTTAA
ATGCCTGCCATTCATTCACCAAGCGTGCATGGATAGGCAAGTTTGAAGCC
AAGACCAAGTCGAGAGATCTCTTTTCAAATAACAAAGAAAACAAAAAGTC
TTCGGTTCTTCAATTCCGAAAGCGAATAAAAAGATATTTGCGTGCTCCAA
TATCGAAATTTTTCACTAATCTGGTCAGAAAATTTGTGAACTGTGAAAAT
TTAGAAATTTTTATATTTTAGGTAGCTTACGTTTTGTTTCTCCTATTCTT
TATGGACGTAAACTTGTTCCGATTGAATGAGATTGGTAAATACAAGAGGA
AAATTGAGTATTGGACTGAAATCTACGTTTATGCGTACTTTTTAATATTC
ATTGTTGAGGAAATAAATCAGGTAAATATTATCTGCCGTTTAGTACAGGA
TATTATTTATAACTGGGCCTTTTAACCTGTGGTCCACTGGTGGATTTTGT
GAGACCCCTTTTTGTTTTGTATGCTATTATTACATTGACAAACCAAATTA
TTGTATGGCTAAGTTTGAAGAAAATAAATTTATTTTCAGATAGCCGAATA
AAGATGAAATGCTTGCATTCCGTTATAAAATTGTAAAATTCACTTTTCAA
TTAAAGTGGAGCATAATTTGATGAGAGTATGAAAGTGCCTTTTTTTCTCG
GGAGGAGTCAAAAAATTGATATTTTCTATGATTTCTTGTATTAAAACATG
ATTTGAAATTGTTGAAATATGTTTTGGTCAAATTTCCCATTTCCTTATTT
AAAAGTAGATAACTATGGGGAAAGGATATTGTGTAAGGCAG
back to top

protein sequence of SMED30025705-orf-1

>SMED30025705-orf-1 ID=SMED30025705-orf-1|Name=SMED30025705-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=232bp
MESLKMPRIYNKPQDVRIYAMENTKGPPEPEWRFLTKAKANKLDVNMKQA
NQGGRLRSTKCRKCEDKESESNVMNHCPSANWSRVEKHNYVLKELADELK
KRNINFEKDFVRKKPKENLRLDLVIRLKEKIMIVDIKCPFDEKSAVESAR
NRNMDKYKELAKDMQAKTGLQTTVSTFVVCSLGSWDKRNNEILRQIGIRY
EDSKKMSQKMIQKAIHGSKKTYDHHRNFSNG*
back to top

protein sequence of SMED30025705-orf-2

>SMED30025705-orf-2 ID=SMED30025705-orf-2|Name=SMED30025705-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MTQIYVVVMKGSGKRADVICSMLNKIDSADNIEMAIQEYCGNLEGDLDRL
RNQLGELWKYRDKILIYDIKSKTEGLDKQIFEAIKSCLNNNLEKILIYSM
SFKEQMIKQTGVFKDEKFKNLENKQKRNVLKSILKNNKPILLELFLENEM
SIDMFLEEADLIELYEESINGRIGCSKLLNEKFQEIKRIYSAKNRKKSND
VNNQDCLDQPDANKQSTFNRERIKTPNTDESEKKTEKRNFVRFQFGNKSE
SKDYHSSKSSHLLMQNIIYEINRNYIESQKLFIWALLSEYFEVAFIIWRE
GNDHISTALTGSILLKDISKYFIDLSQLSEKYLKESKP*
back to top

protein sequence of SMED30025705-orf-3

>SMED30025705-orf-3 ID=SMED30025705-orf-3|Name=SMED30025705-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MNCGLIWKPIEPSYHGCCWKHSYRTMAIHMMAKIFNKNPTKANSILLRPI
DRWEKMSCLQIAVNGNVKEFCNLNACHSFTKRAWIGKFEAKTKSRDLFSN
NKENKKSSVLQFRKRIKRYLRAPISKFFTNLVRKFVNCENLEIFIF*
back to top

protein sequence of SMED30025705-orf-4

>SMED30025705-orf-4 ID=SMED30025705-orf-4|Name=SMED30025705-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
VSSFNYHCFIISIALGILKSIGMSKYKFKSIEKSIKTVEKIQIENVDAYE
IIKFIEYEDLSKDHFIKFMKLEPDKVPDDKILDKIFGALLKPKVIISING
GIEDIDFDKEVEKHLKQTFKEFLIADNQWVIGTGLNCGIHKLISETVQES
RFDNEDKQINLIGFYNFSEIESNQSVVKTDKKREINHLSNLKSLSYVRIS
KNIVQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane