SMED30025698

Overview
NameSMED30025698
Smed IDSMED30025698
Length (bp)1475
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025698 (SMED30025698) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025698 (SMED30025698) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025698 (SMED30025698) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025698 (SMED30025698) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025698

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30025698 SmedASXL_019473SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025698 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001318:43379..44852 +7352
Homology
BLAST of SMED30025698 vs. Ensembl Human
Match: PLRG1 (pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HGNC:9089])

HSP 1 Score: 430.254 bits (1105), Expect = 1.785e-146
Identity = 198/322 (61.49%), Postives = 255/322 (79.19%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN +TVN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+EDD ATEE+ P+SW+P I ++
Sbjct:  181 WHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKR 502          
BLAST of SMED30025698 vs. Ensembl Human
Match: PLRG1 (pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HGNC:9089])

HSP 1 Score: 429.483 bits (1103), Expect = 4.844e-146
Identity = 198/322 (61.49%), Postives = 255/322 (79.19%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN +TVN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+EDD ATEE+ P+SW+P I ++
Sbjct:  190 WHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKR 511          
BLAST of SMED30025698 vs. Ensembl Human
Match: PLRG1 (pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HGNC:9089])

HSP 1 Score: 229.18 bits (583), Expect = 6.849e-73
Identity = 103/153 (67.32%), Postives = 128/153 (83.66%), Query Frame = -1
Query:  486 IWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHP 944
            IW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP
Sbjct:    2 IWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHP 154          

HSP 2 Score: 56.9954 bits (136), Expect = 4.512e-9
Identity = 37/141 (26.24%), Postives = 61/141 (43.26%), Query Frame = -1
Query:  396 WDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGH 815
            WDL   K+     GH S V  + +      L + G D  V+ WD+     +    GH  AV  +     +  +++ S D+T R+WD+R   +   L+ H  AV +V         ++GS D  I+ + L  G+    +  H
Sbjct:    3 WDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNH 143          

HSP 3 Score: 49.6766 bits (117), Expect = 1.465e-6
Identity = 28/104 (26.92%), Postives = 45/104 (43.27%), Query Frame = -1
Query:  738 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHP 1049
            K+ R   GH   V  +   P  +  +T S D   +IW+V       +L+GH + V  V+     P + +   D T++ WDL   K       H  +V  + +HP
Sbjct:   51 KVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHP 154          
BLAST of SMED30025698 vs. Ensembl Human
Match: WDR5 (WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12757])

HSP 1 Score: 134.42 bits (337), Expect = 9.751e-35
Identity = 82/302 (27.15%), Postives = 152/302 (50.33%), Query Frame = -1
Query:  156 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1037
             ++GHT  V  + FSP+ E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K WD+   K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       VSG  D  +Y W+ ++    QKLQ     G  D    ++  +   T   + +  +E DKTIK +K D
Sbjct:   40 TLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ-----GHTD---VVISTACHPTENIIASAALENDKTIKLWKSD 333          

HSP 2 Score: 80.4925 bits (197), Expect = 5.824e-16
Identity = 50/178 (28.09%), Postives = 84/178 (47.19%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D +LL++   D  +++WD+ +   +  L GH + V   +   QSNL  ++SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   34 NYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 209          
BLAST of SMED30025698 vs. Ensembl Human
Match: FBXW7 (F-box and WD repeat domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16712])

HSP 1 Score: 131.724 bits (330), Expect = 5.173e-32
Identity = 93/295 (31.53%), Postives = 152/295 (51.53%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ E  + I   +GHTS V C+ +H     +++G RD+ +RVWD+ T   +H+L GH   VA+VRC Q +   V+SG++D  V++WD         L  H   V S+    I  H +SGS D  I+ + +  G  +  + GH   + +    ++N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F++    ++T   D T+K +
Sbjct:  374 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLHVLMGH---VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGI--HVVSGSLDTSIRVWDVETGNCIHTLTGH-QSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNK-----HQSAVTCLQFNKNF--VITSSDDGTVKLW 649          

HSP 2 Score: 117.087 bits (292), Expect = 2.929e-27
Identity = 82/267 (30.71%), Postives = 134/267 (50.19%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S    +   I+GS DR LK+WN + G+   +L GH S VR + +  +   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D +V+VWD  T+  +H L GH + V S+  Q +   V+SGS D ++R+WD+        LT H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +           N  ++  +DGT+  WD K+G   + L +    GS
Sbjct:  412 KCLRTLVGHTGGV--WSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL--QFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKD--NILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGS 668          
BLAST of SMED30025698 vs. Ensembl Celegans
Match: plrg-1 (PLeiotropic ReGulator (Vertebrate) homolog [Source:UniProtKB/TrEMBL;Acc:G5EEL2])

HSP 1 Score: 418.313 bits (1074), Expect = 4.214e-143
Identity = 218/432 (50.46%), Postives = 291/432 (67.36%), Query Frame = -1
Query:   99 FRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1394
             RS+KR H+    Y   I + +  +    N++ +L      ++G    I +  T L+I +    +  ++           +    + +  +D  T+ ++P KA  + KP WHAPWKL RV SGHTGWVR +   P N++F +G  DR++KIW++ +G+L+LSLTGH+S VR VK+S RHP++FS GEDK VKCWDLE NKVIRHYHGH SAV  L +HP LD+L+T  RDS  RVWDMRTK  VH  +GH + VA V CQS  P+VI+ SHDATVRLWDL A ++   LT+HKK+VR++ IHP  + F S S D IKQ+ LP+G+FMQN+ GHN IIN ++ N++ V VSG ++G+L FWDW+SG+ FQK+Q+ PQPGS++SE  I    FD+T  RL+T E DKTIK YKEDDEATEES PI WRP I +K
Sbjct:    9 IRSMKRKHE----YGNVIKKVEEMKVRRENEMLAL-PTSQPMHGTGSVIASAGTPLAITDGSGKLVNQQQGSAKSGTLLPLVPLGNSSKGEDNTTRSLLPSKAPMMMKPKWHAPWKLYRVASGHTGWVRAVDVEPGNQWFASGGADRIIKIWDLASGQLKLSLTGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKAQVHCFAGHTNTVADVVCQSVDPQVITASHDATVRLWDLAAGRSMCTLTHHKKSVRALTIHPRLNMFASASPDNIKQWKLPKGEFMQNLSGHNAIINTLSSNDDGVVVSGADNGSLCFWDWRSGFCFQKIQTKPQPGSIESEAGIYASCFDKTGLRLITAEADKTIKMYKEDDEATEESHPIVWRPEIVKK 435          
BLAST of SMED30025698 vs. Ensembl Celegans
Match: plrg-1 (PLeiotropic ReGulator (Vertebrate) homolog [Source:UniProtKB/TrEMBL;Acc:G5EEL2])

HSP 1 Score: 419.083 bits (1076), Expect = 1.017e-142
Identity = 222/461 (48.16%), Postives = 295/461 (63.99%), Query Frame = -1
Query:   99 SLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGIL-----------------------LNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1412
            +L    F+SLKR+ D +   +            LI  +K  +EYG +                       ++G    I +  T L+I +    +  ++           +    + +  +D  T+ ++P KA  + KP WHAPWKL RV SGHTGWVR +   P N++F +G  DR++KIW++ +G+L+LSLTGH+S VR VK+S RHP++FS GEDK VKCWDLE NKVIRHYHGH SAV  L +HP LD+L+T  RDS  RVWDMRTK  VH  +GH + VA V CQS  P+VI+ SHDATVRLWDL A ++   LT+HKK+VR++ IHP  + F S S D IKQ+ LP+G+FMQN+ GHN IIN ++ N++ V VSG ++G+L FWDW+SG+ FQK+Q+ PQPGS++SE  I    FD+T  RL+T E DKTIK YKEDDEATEES PI WRP I +K
Sbjct:   31 ALLNQVFKSLKRAQDLFYHDYAQPPPMPEENDSLIRSMKRKHEYGNVIKKVEEMKVRRENEMLALPTSQPMHGTGSVIASAGTPLAITDGSGKLVNQQQGSAKSGTLLPLVPLGNSSKGEDNTTRSLLPSKAPMMMKPKWHAPWKLYRVASGHTGWVRAVDVEPGNQWFASGGADRIIKIWDLASGQLKLSLTGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKAQVHCFAGHTNTVADVVCQSVDPQVITASHDATVRLWDLAAGRSMCTLTHHKKSVRALTIHPRLNMFASASPDNIKQWKLPKGEFMQNLSGHNAIINTLSSNDDGVVVSGADNGSLCFWDWRSGFCFQKIQTKPQPGSIESEAGIYASCFDKTGLRLITAEADKTIKMYKEDDEATEESHPIVWRPEIVKK 491          
BLAST of SMED30025698 vs. Ensembl Celegans
Match: plrg-1 (PLeiotropic ReGulator (Vertebrate) homolog [Source:UniProtKB/TrEMBL;Acc:G5EEL2])

HSP 1 Score: 419.083 bits (1076), Expect = 1.017e-142
Identity = 222/461 (48.16%), Postives = 295/461 (63.99%), Query Frame = -1
Query:   99 SLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGIL-----------------------LNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1412
            +L    F+SLKR+ D +   +            LI  +K  +EYG +                       ++G    I +  T L+I +    +  ++           +    + +  +D  T+ ++P KA  + KP WHAPWKL RV SGHTGWVR +   P N++F +G  DR++KIW++ +G+L+LSLTGH+S VR VK+S RHP++FS GEDK VKCWDLE NKVIRHYHGH SAV  L +HP LD+L+T  RDS  RVWDMRTK  VH  +GH + VA V CQS  P+VI+ SHDATVRLWDL A ++   LT+HKK+VR++ IHP  + F S S D IKQ+ LP+G+FMQN+ GHN IIN ++ N++ V VSG ++G+L FWDW+SG+ FQK+Q+ PQPGS++SE  I    FD+T  RL+T E DKTIK YKEDDEATEES PI WRP I +K
Sbjct:   31 ALLNQVFKSLKRAQDLFYHDYAQPPPMPEENDSLIRSMKRKHEYGNVIKKVEEMKVRRENEMLALPTSQPMHGTGSVIASAGTPLAITDGSGKLVNQQQGSAKSGTLLPLVPLGNSSKGEDNTTRSLLPSKAPMMMKPKWHAPWKLYRVASGHTGWVRAVDVEPGNQWFASGGADRIIKIWDLASGQLKLSLTGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKAQVHCFAGHTNTVADVVCQSVDPQVITASHDATVRLWDLAAGRSMCTLTHHKKSVRALTIHPRLNMFASASPDNIKQWKLPKGEFMQNLSGHNAIINTLSSNDDGVVVSGADNGSLCFWDWRSGFCFQKIQTKPQPGSIESEAGIYASCFDKTGLRLITAEADKTIKMYKEDDEATEESHPIVWRPEIVKK 491          
BLAST of SMED30025698 vs. Ensembl Celegans
Match: plrg-1 (PLeiotropic ReGulator (Vertebrate) homolog [Source:UniProtKB/TrEMBL;Acc:G5EEL2])

HSP 1 Score: 419.083 bits (1076), Expect = 1.017e-142
Identity = 222/461 (48.16%), Postives = 295/461 (63.99%), Query Frame = -1
Query:   99 SLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGIL-----------------------LNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1412
            +L    F+SLKR+ D +   +            LI  +K  +EYG +                       ++G    I +  T L+I +    +  ++           +    + +  +D  T+ ++P KA  + KP WHAPWKL RV SGHTGWVR +   P N++F +G  DR++KIW++ +G+L+LSLTGH+S VR VK+S RHP++FS GEDK VKCWDLE NKVIRHYHGH SAV  L +HP LD+L+T  RDS  RVWDMRTK  VH  +GH + VA V CQS  P+VI+ SHDATVRLWDL A ++   LT+HKK+VR++ IHP  + F S S D IKQ+ LP+G+FMQN+ GHN IIN ++ N++ V VSG ++G+L FWDW+SG+ FQK+Q+ PQPGS++SE  I    FD+T  RL+T E DKTIK YKEDDEATEES PI WRP I +K
Sbjct:   31 ALLNQVFKSLKRAQDLFYHDYAQPPPMPEENDSLIRSMKRKHEYGNVIKKVEEMKVRRENEMLALPTSQPMHGTGSVIASAGTPLAITDGSGKLVNQQQGSAKSGTLLPLVPLGNSSKGEDNTTRSLLPSKAPMMMKPKWHAPWKLYRVASGHTGWVRAVDVEPGNQWFASGGADRIIKIWDLASGQLKLSLTGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKAQVHCFAGHTNTVADVVCQSVDPQVITASHDATVRLWDLAAGRSMCTLTHHKKSVRALTIHPRLNMFASASPDNIKQWKLPKGEFMQNLSGHNAIINTLSSNDDGVVVSGADNGSLCFWDWRSGFCFQKIQTKPQPGSIESEAGIYASCFDKTGLRLITAEADKTIKMYKEDDEATEESHPIVWRPEIVKK 491          
BLAST of SMED30025698 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 122.865 bits (307), Expect = 9.711e-31
Identity = 74/269 (27.51%), Postives = 135/269 (50.19%), Query Frame = -1
Query:  264 WKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQP 1052
            +KL   + GHT  +    FSP  +Y  T S D+ +KIWN+D+     +LTGH  GV  +  S     V S  +DKT+K +++  +++ +   GH + V+C + +P   L+++G  D  VR+WD++T + +  L  H D V++V    +   + SGS+D  VR+WD    +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       +SG  D  +Y W+ ++    Q L+   QP
Sbjct:   77 YKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQP 345          

HSP 2 Score: 80.4925 bits (197), Expect = 2.950e-16
Identity = 45/201 (22.39%), Postives = 89/201 (44.28%), Query Frame = -1
Query:  459 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHY-HGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPE---VISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGS 1049
            ++ + + GH  +V C +F+P +   ++GS D  ++IW+V  G    +L  H   V  V  +     + S   D  V+ WD    + I+         V  +   P+   ++    DS +++WD      +   +GH ++   +    ++     +ISGS D  + +W+L+  +    L  H + V +   HP+ +   SG+
Sbjct:  162 RMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGA 362          

HSP 3 Score: 55.0694 bits (131), Expect = 5.389e-8
Identity = 32/120 (26.67%), Postives = 56/120 (46.67%), Query Frame = -1
Query:  687 VRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSG---------VRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGG--RDSVVRVW 1013
            V  + FSP+ +Y +  + D  LK+W+   GK     TGH +          V G K      ++ S  ED  +  W+L+  ++++   GHT  V   D HP  +++ +G    D+ + +W
Sbjct:  259 VAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGK------WIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIW 372          
BLAST of SMED30025698 vs. Ensembl Fly
Match: Tango4 (gene:FBgn0030365 transcript:FBtr0073622)

HSP 1 Score: 466.077 bits (1198), Expect = 3.468e-161
Identity = 238/474 (50.21%), Postives = 315/474 (66.46%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLN--------------------------GNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXX-------XXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD + S  G + E D    +L   IK+ + YG++L+                          G+  +  + +  L  +N   A   ++  P       S+   +  NSN D +    +         KA ++PKP WHAPWKL RV+SGH GWVRCI+  P NE+F TG+ DR++KIW++ +GKL+LSLTGHVS VRGV +S +HPY+FSCGED+ VKCWDLE NKVIRHYHGH SAVY L +HP +D+L T GRDS  R+WDMRTK NVH L+GH + VASV  Q+  P++I+GSHD+TVRLWDL A K+   LTNHKK+VRS+ +HP    F S S D IKQ+  PEG+F+QN+ GH +I+N +  N   V VSGG++GT++FWDW++GYNFQ+ Q+P QPGS+DSE  I    FD++  RL+T E DKTIK YKEDDEA+EES PI+WRP++ ++
Sbjct:    7 QKHSVHTLIFRSLKRTHDLFVSNQGNLPEIDERLEKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQTPGDKTLAITDGSATDAASGAGSLVKYNAG-ARPAEKTAPLVTGTHTSLVRASLANSNADMSANGAIASHLQLIPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYKEDDEASEESHPINWRPDLLKR 479          
BLAST of SMED30025698 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 135.191 bits (339), Expect = 3.365e-35
Identity = 83/301 (27.57%), Postives = 152/301 (50.50%), Query Frame = -1
Query:  156 VSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1034
            ++GHT  V  + FSP+ E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K W+L   K ++   GH++ V+C + +P  +L+++G  D  VR+WD+RT   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       VSG  D  +Y W+ +S    QKLQ           +++L  +   T   + +  +E DKTIK +K D
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQG--------HTDTVLCTACHPTENIIASAALENDKTIKLWKSD 360          

HSP 2 Score: 83.5741 bits (205), Expect = 3.298e-17
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D  LL++G  D  ++VW++ T  ++  L GH + V   +   QSNL  ++SGS D +VR+WD+R  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   61 NYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 236          
BLAST of SMED30025698 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 135.191 bits (339), Expect = 3.365e-35
Identity = 83/301 (27.57%), Postives = 152/301 (50.50%), Query Frame = -1
Query:  156 VSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1034
            ++GHT  V  + FSP+ E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K W+L   K ++   GH++ V+C + +P  +L+++G  D  VR+WD+RT   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       VSG  D  +Y W+ +S    QKLQ           +++L  +   T   + +  +E DKTIK +K D
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQG--------HTDTVLCTACHPTENIIASAALENDKTIKLWKSD 360          

HSP 2 Score: 83.5741 bits (205), Expect = 3.298e-17
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D  LL++G  D  ++VW++ T  ++  L GH + V   +   QSNL  ++SGS D +VR+WD+R  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   61 NYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 236          
BLAST of SMED30025698 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073246)

HSP 1 Score: 123.25 bits (308), Expect = 2.673e-29
Identity = 91/305 (29.84%), Postives = 151/305 (49.51%), Query Frame = -1
Query:  165 DWHA-PWKLCRVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1067
            +W + P +  +V+ GH   V  C+ FS      ++GSDD  LK+W+  NGK   +L GH  GV   ++S     + S   D+T+K WD++    +    GHTS V C+ +H     +++G RD+ +RVWD+     +H+L GH   +A+VRC Q +   ++SG++D  V++W     +    L  H   V S+    +  H +SGS D  I+ + +  G     + GH   + +      N+ VSG  D T+  WD  +G   Q L  P +       +++    F+  S+ +VT   D T+K +
Sbjct:  978 NWRSRPVRKPKVLKGHDDHVITCLQFS--GNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGN--IIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHG--SKVVSGSRDATLRVWDIEQGSCLHVLVGH---LAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGL--HVVSGSLDTSIRVWDVETGNCKHTLMGH-QSLTSGMELRQNILVSGNADSTVKVWDITTGQCLQTLSGPNK-----HHSAVTCLQFN--SRFVVTSSDDGTVKLW 1263          

HSP 2 Score: 112.464 bits (280), Expect = 8.432e-26
Identity = 83/268 (30.97%), Postives = 132/268 (49.25%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRH-PYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXX--XXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V     S      I+GS DR LK+W++D+G    +L GH S VR +   H H   V S   D T++ WD+EQ   +    GH +AV C+    D  L+++G  D +V++W    +  +H L GH + V S+  Q +   V+SGS D ++R+WD+     +  L  H+     + +    +  +SG+AD  +K + +  GQ +Q + G N            +   V+  +DGT+  WD K+G   + L +    GS
Sbjct: 1026 KCLRTLVGHTGGVWSSQMS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCM---HLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQY--DGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSL--QFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELR--QNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFNSRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGS 1282          
BLAST of SMED30025698 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073245)

HSP 1 Score: 123.25 bits (308), Expect = 2.673e-29
Identity = 91/305 (29.84%), Postives = 151/305 (49.51%), Query Frame = -1
Query:  165 DWHA-PWKLCRVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1067
            +W + P +  +V+ GH   V  C+ FS      ++GSDD  LK+W+  NGK   +L GH  GV   ++S     + S   D+T+K WD++    +    GHTS V C+ +H     +++G RD+ +RVWD+     +H+L GH   +A+VRC Q +   ++SG++D  V++W     +    L  H   V S+    +  H +SGS D  I+ + +  G     + GH   + +      N+ VSG  D T+  WD  +G   Q L  P +       +++    F+  S+ +VT   D T+K +
Sbjct:  978 NWRSRPVRKPKVLKGHDDHVITCLQFS--GNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGN--IIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHG--SKVVSGSRDATLRVWDIEQGSCLHVLVGH---LAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGL--HVVSGSLDTSIRVWDVETGNCKHTLMGH-QSLTSGMELRQNILVSGNADSTVKVWDITTGQCLQTLSGPNK-----HHSAVTCLQFN--SRFVVTSSDDGTVKLW 1263          

HSP 2 Score: 112.464 bits (280), Expect = 8.432e-26
Identity = 83/268 (30.97%), Postives = 132/268 (49.25%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRH-PYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXX--XXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V     S      I+GS DR LK+W++D+G    +L GH S VR +   H H   V S   D T++ WD+EQ   +    GH +AV C+    D  L+++G  D +V++W    +  +H L GH + V S+  Q +   V+SGS D ++R+WD+     +  L  H+     + +    +  +SG+AD  +K + +  GQ +Q + G N            +   V+  +DGT+  WD K+G   + L +    GS
Sbjct: 1026 KCLRTLVGHTGGVWSSQMS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCM---HLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQY--DGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSL--QFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELR--QNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFNSRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGS 1282          
BLAST of SMED30025698 vs. Ensembl Zebrafish
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 435.647 bits (1119), Expect = 9.537e-149
Identity = 237/503 (47.12%), Postives = 318/503 (63.22%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDN------------SETELINKIKSLNE------------YG------------ILLNGNNPNITAPSTDLSIFNRELAISRKR-----VLPFPEPKAKSIFINNDEN---------------------SNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD + + H   +  D             +E + +  +  L E            YG             L+ G +P  +AP   L+   + L +  +       L  P  +A+        +                     S  +  T+ +VP+KA T+PKP WH PWKL RV+SGH GWVR I+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S+R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RD+  RVWD+RTK NVH LSGH + VA+V+CQS  P+V++GSHD T+RLWDL A KT++ LTNHKK+VR++ +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I    FD++  RL+T E DKTIK YKEDD ATEES P++W+P I ++
Sbjct:    6 QKHSVHTLVFRSLKRTHDMFVADHAKPIAQDEQSFKVKMAAKMRAEYKAVLHMPVLKEGREKGSLHTSDPYGQSAYPLPDTTPEYLVTGTHPYPSAPGVALTADTQMLKMPSEMGVHSMALALPPSQARQEASRTAASVAEIHRHAGGAERSHPPQHALSLMEGGTRTLVPRKAPTMPKPQWHPPWKLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVKCQSAEPQVVTGSHDTTIRLWDLVAGKTRATLTNHKKSVRALVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTIHMWDWRTGYNFQRIHAAVQPGSLDSESGIFSCVFDQSESRLITAEADKTIKVYKEDDTATEESHPVNWKPEILKR 508          
BLAST of SMED30025698 vs. Ensembl Zebrafish
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 433.721 bits (1114), Expect = 4.864e-148
Identity = 236/501 (47.11%), Postives = 317/501 (63.27%), Query Frame = -1
Query:   99 HSLHTLCFRSLKRSHDSYESYHGAILESDN------------SETELINKIKSLNE------------YG------------ILLNGNNPNITAPSTDLSIFNRELAISRKR-----VLPFPEPKAKSIFINNDEN---------------------SNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1415
            HS+HTL FRSLKR+HD + + H   +  D             +E + +  +  L E            YG             L+ G +P  +AP   L+   + L +  +       L  P  +A+        +                     S  +  T+ +VP+KA T+PKP WH PWKL RV+SGH GWVR I+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S+R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RD+  RVWD+RTK NVH LSGH + VA+V+CQS  P+V++GSHD T+RLWDL A KT++ LTNHKK+VR++ +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I    FD++  RL+T E DKTIK YKEDD ATEES P++W+P I ++
Sbjct:    2 HSVHTLVFRSLKRTHDMFVADHAKPIAQDEQSFKVKMAAKMRAEYKAVLHMPVLKEGREKGSLHTSDPYGQSAYPLPDTTPEYLVTGTHPYPSAPGVVLTADTQMLKMPSEMGVHSMALALPPSQARQEASRTAASVAEIHRHAGGAERSHPPQHALSLMEGGTRTLVPRKAPTMPKPQWHPPWKLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVKCQSAEPQVVTGSHDTTIRLWDLVAGKTRATLTNHKKSVRALVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTIHMWDWRTGYNFQRIHAAVQPGSLDSESGIFSCVFDQSESRLITAEADKTIKVYKEDDTATEESHPVNWKPEILKR 502          
BLAST of SMED30025698 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 133.265 bits (334), Expect = 1.599e-34
Identity = 80/302 (26.49%), Postives = 150/302 (49.67%), Query Frame = -1
Query:  156 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1037
             ++GHT  V  + FSP  E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K WD+   K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       VSG  D  +Y W+ ++    QKLQ           + ++  +   T   + +  +E DKTIK +K D
Sbjct:   40 TLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQG--------HTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          

HSP 2 Score: 80.1073 bits (196), Expect = 5.411e-16
Identity = 50/178 (28.09%), Postives = 84/178 (47.19%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D +LL++   D  +++WD+ +   +  L GH + V   +   QSNL  ++SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   34 NYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 209          
BLAST of SMED30025698 vs. Ensembl Zebrafish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-090313-79])

HSP 1 Score: 130.183 bits (326), Expect = 3.884e-32
Identity = 93/295 (31.53%), Postives = 152/295 (51.53%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ E  + I   +GHTS V C+ +H     +++G RD+ +RVWD+ T   +H+L GH   VA+VRC Q +   V+SG++D  V++WD         L  H   V S+    I  H +SGS D  I+ + +  G  +  + GH   + +    ++N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F++    ++T   D T+K +
Sbjct:  211 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLHVLMGH---VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGI--HVVSGSLDTSIRVWDVETGNCIHTLTGH-QSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHK-----HQSAVTCLQFNKNF--VITSSDDGTVKLW 486          

HSP 2 Score: 115.546 bits (288), Expect = 3.663e-27
Identity = 81/267 (30.34%), Postives = 134/267 (50.19%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S    +   I+GS DR LK+WN + G+   +L GH S VR + +  +   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D +V+VWD  T+  +H L GH + V S+  Q +   V+SGS D ++R+WD+        LT H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +           N  ++  +DGT+  WD ++G   + L +    GS
Sbjct:  249 KCLRTLVGHTGGV--WSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL--QFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKD--NILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGS 505          
BLAST of SMED30025698 vs. Ensembl Zebrafish
Match: CR381538.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:564991])

HSP 1 Score: 130.568 bits (327), Expect = 4.425e-32
Identity = 93/295 (31.53%), Postives = 152/295 (51.53%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ E  + I   +GHTS V C+ +H     +++G RD+ +RVWD+ T   +H+L GH   VA+VRC Q +   V+SG++D  V++WD         L  H   V S+    I  H +SGS D  I+ + +  G  +  + GH   + +    ++N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F++    ++T   D T+K +
Sbjct:  251 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLHVLMGH---VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGI--HVVSGSLDTSIRVWDVETGNCIHTLTGH-QSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHK-----HQSAVTCLQFNKNF--VITSSDDGTVKLW 526          

HSP 2 Score: 115.931 bits (289), Expect = 3.974e-27
Identity = 81/267 (30.34%), Postives = 134/267 (50.19%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S    +   I+GS DR LK+WN + G+   +L GH S VR + +  +   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D +V+VWD  T+  +H L GH + V S+  Q +   V+SGS D ++R+WD+        LT H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +           N  ++  +DGT+  WD ++G   + L +    GS
Sbjct:  289 KCLRTLVGHTGGV--WSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL--QFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKD--NILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGS 545          
BLAST of SMED30025698 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 432.95 bits (1112), Expect = 1.653e-147
Identity = 227/495 (45.86%), Postives = 301/495 (60.81%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYG--------------------------ILLNGNNPNITAPSTDLS-------IFNRELAISRKRVLP---------------------FPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD + + +   +  D    +L   +K   EY                            +L G +P  + P   L+       + +   A S    LP                      PE             S    N+ LV  K         WH PWKL RV+SGH GWVRC++  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK  VH L GH +AVA+VRCQ+  P++I+GSHD T+RLWD+   KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:   11 QKHSVHTLIFRSLKRTHDMFVADNAKPIPIDEESHKLKMSVKLRTEYSSVLHMPVLKENREKGSEQYNYGTESEYMLTGTHPYPSGPGVALTADTQIQRMPSESAAQSLALALPPSQLEAQRTAASVGDIYRHAGHPERSQPPGLSMASMESGGTKNSALVAKKAPTMPKP-QWHPPWKLYRVISGHLGWVRCLAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKAGVHTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWDMVGGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESGIFACTFDQSESRLITAEADKTIKVYREDETATEETHPVSWKPEIIKR 504          
BLAST of SMED30025698 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 423.705 bits (1088), Expect = 2.996e-144
Identity = 192/323 (59.44%), Postives = 251/323 (77.71%), Query Frame = -1
Query:   99 DWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1067
             WH PWKL RV+SGH GWVRC++  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK  VH L GH +AVA+VRCQ+  P++I+GSHD T+RLWD+   KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  154 QWHPPWKLYRVISGHLGWVRCLAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKAGVHTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWDMVGGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESGIFACTFDQSESRLITAEADKTIKVYREDETATEETHPVSWKPEIIKR 476          
BLAST of SMED30025698 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 423.32 bits (1087), Expect = 6.784e-144
Identity = 192/322 (59.63%), Postives = 251/322 (77.95%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRC++  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK  VH L GH +AVA+VRCQ+  P++I+GSHD T+RLWD+   KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  175 WHPPWKLYRVISGHLGWVRCLAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKAGVHTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWDMVGGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESGIFACTFDQSESRLITAEADKTIKVYREDETATEETHPVSWKPEIIKR 496          
BLAST of SMED30025698 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 423.705 bits (1088), Expect = 9.781e-144
Identity = 192/322 (59.63%), Postives = 251/322 (77.95%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRC++  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK  VH L GH +AVA+VRCQ+  P++I+GSHD T+RLWD+   KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  193 WHPPWKLYRVISGHLGWVRCLAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKAGVHTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWDMVGGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESGIFACTFDQSESRLITAEADKTIKVYREDETATEETHPVSWKPEIIKR 514          
BLAST of SMED30025698 vs. Ensembl Xenopus
Match: stam (signal transducing adaptor molecule [Source:Xenbase;Acc:XB-GENE-482429])

HSP 1 Score: 421.779 bits (1083), Expect = 1.131e-142
Identity = 192/322 (59.63%), Postives = 251/322 (77.95%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRC++  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK  VH L GH +AVA+VRCQ+  P++I+GSHD T+RLWD+   KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  219 WHPPWKLYRVISGHLGWVRCLAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKAGVHTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWDMVGGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESGIFACTFDQSESRLITAEADKTIKVYREDETATEETHPVSWKPEIIKR 540          
BLAST of SMED30025698 vs. Ensembl Mouse
Match: Plrg1 (pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI:1858197])

HSP 1 Score: 433.335 bits (1113), Expect = 6.593e-148
Identity = 198/322 (61.49%), Postives = 255/322 (79.19%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP LD+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP+   F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FDR+  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  180 WHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPLLYTFASGSPDNIKQWKFPDGGFIQNLSGHNAIINTLAVNADGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDRSESRLLTAEADKTIKVYREDETATEETHPVSWKPEIIKR 501          
BLAST of SMED30025698 vs. Ensembl Mouse
Match: Plrg1 (pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI:1858197])

HSP 1 Score: 432.95 bits (1112), Expect = 1.365e-147
Identity = 198/322 (61.49%), Postives = 255/322 (79.19%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP LD+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP+   F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FDR+  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  189 WHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPLLYTFASGSPDNIKQWKFPDGGFIQNLSGHNAIINTLAVNADGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDRSESRLLTAEADKTIKVYREDETATEETHPVSWKPEIIKR 510          
BLAST of SMED30025698 vs. Ensembl Mouse
Match: Plrg1 (pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI:1858197])

HSP 1 Score: 304.679 bits (779), Expect = 3.022e-99
Identity = 170/377 (45.09%), Postives = 227/377 (60.21%), Query Frame = -1
Query:  483 QGHSLHTLCFRSLKRSHDSYESYHG--AILESDNSETELINKIKS--------------LNEYG----------------------ILLNGNNPNITAPSTDLSI---FNRELAISRKRVLPFPEPKAKSIFINNDENSNQDY---------------------NTQ--LXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPI 1421
            Q HS+HTL FRSLKR+HD + + +G    L+ ++ + ++  K+++              L E G                       L+ G +P    P   L+      R  + S  + L    P    +  N    +  +Y                     NT+   ++ KKA T+PKP WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP LD+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP+
Sbjct:    6 QKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYPHKQYPANQGQDVEYLVTGTHPYPAGPGVALTADTKIQRMPSESAAQSLAVALPSQTRVDANRTGPAGSEYRHPGASDRSQPTAMNSIMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPL 382          
BLAST of SMED30025698 vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 134.42 bits (337), Expect = 6.694e-35
Identity = 82/302 (27.15%), Postives = 152/302 (50.33%), Query Frame = -1
Query:  156 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1037
             ++GHT  V  + FSP+ E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K WD+   K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       VSG  D  +Y W+ ++    QKLQ     G  D    ++  +   T   + +  +E DKTIK +K D
Sbjct:   40 TLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ-----GHTD---VVISTACHPTENIIASAALENDKTIKLWKSD 333          

HSP 2 Score: 80.4925 bits (197), Expect = 3.998e-16
Identity = 50/178 (28.09%), Postives = 84/178 (47.19%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D +LL++   D  +++WD+ +   +  L GH + V   +   QSNL  ++SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   34 NYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 209          
BLAST of SMED30025698 vs. Ensembl Mouse
Match: Fbxw7 (F-box and WD-40 domain protein 7 [Source:MGI Symbol;Acc:MGI:1354695])

HSP 1 Score: 132.494 bits (332), Expect = 1.625e-32
Identity = 93/295 (31.53%), Postives = 152/295 (51.53%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ E  + I   +GHTS V C+ +H     +++G RD+ +RVWD+ T   +H+L GH   VA+VRC Q +   V+SG++D  V++WD         L  H   V S+    I  H +SGS D  I+ + +  G  +  + GH   + +    ++N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F++    ++T   D T+K +
Sbjct:  377 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLHVLMGH---VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGI--HVVSGSLDTSIRVWDVETGNCIHTLTGH-QSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSK-----HQSAVTCLQFNKNF--VITSSDDGTVKLW 652          

HSP 2 Score: 117.472 bits (293), Expect = 1.654e-27
Identity = 82/267 (30.71%), Postives = 134/267 (50.19%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S    +   I+GS DR LK+WN + G+   +L GH S VR + +  +   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D +V+VWD  T+  +H L GH + V S+  Q +   V+SGS D ++R+WD+        LT H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +           N  ++  +DGT+  WD K+G   + L +    GS
Sbjct:  415 KCLRTLVGHTGGV--WSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL--QFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKD--NILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGS 671          
BLAST of SMED30025698 vs. UniProt/SwissProt
Match: sp|Q2KID6|PLRG1_BOVIN (Pleiotropic regulator 1 OS=Bos taurus OX=9913 GN=PLRG1 PE=2 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 5.428e-148
Identity = 238/507 (46.94%), Postives = 316/507 (62.33%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSY------------ESY-----------HGAILESDNSETELINKIK--SLNEYG-------------ILLNGNNPNITAPSTDLS-------IFNRELAISRKRVLPFPEPKA---KSIFINND------------------ENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD +            ES+           +G +L    S+  L  K+   + + YG              L+ G +P    P   L+       + +   A S    LP  + +A   + +    +                  E SN   N+ L+  K         WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN +TVN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK YKEDD ATEE+ P+SW+P I ++
Sbjct:    6 QKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKVPQNASDSYGHKQYPANQGQEVEYLVTGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPASQARADANRPVPAGGEYRHPGAPDRAQPAGAVVMEGSNAK-NSALMAKKAPTMPKP-QWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYKEDDTATEETHPVSWKPEIIKR 510          
BLAST of SMED30025698 vs. UniProt/SwissProt
Match: sp|Q922V4|PLRG1_MOUSE (Pleiotropic regulator 1 OS=Mus musculus OX=10090 GN=Plrg1 PE=1 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 9.551e-147
Identity = 198/322 (61.49%), Postives = 255/322 (79.19%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP LD+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP+   F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FDR+  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  189 WHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPLLYTFASGSPDNIKQWKFPDGGFIQNLSGHNAIINTLAVNADGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDRSESRLLTAEADKTIKVYREDETATEETHPVSWKPEIIKR 510          
BLAST of SMED30025698 vs. UniProt/SwissProt
Match: sp|Q9WUC8|PLRG1_RAT (Pleiotropic regulator 1 OS=Rattus norvegicus OX=10116 GN=Plrg1 PE=2 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 4.870e-146
Identity = 197/322 (61.18%), Postives = 255/322 (79.19%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP+   F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FDR+  RL+T E DKTIK Y+ED+ ATEE+ P+SW+P I ++
Sbjct:  190 WHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPLHYTFASGSPDNIKQWKFPDGGFIQNLSGHNAIINTLAVNTDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDRSESRLLTAEADKTIKVYREDETATEETHPVSWKPEIIKR 511          
BLAST of SMED30025698 vs. UniProt/SwissProt
Match: sp|O43660|PLRG1_HUMAN (Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1 PE=1 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 2.326e-145
Identity = 198/322 (61.49%), Postives = 255/322 (79.19%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVRCI+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RDS  R+WD+RTK +VH LSGH +AVA+VRCQ+  P++I+GSHD T+RLWDL A KT+  LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN +TVN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD++  RL+T E DKTIK Y+EDD ATEE+ P+SW+P I ++
Sbjct:  190 WHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLTVNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYREDDTATEETHPVSWKPEIIKR 511          
BLAST of SMED30025698 vs. UniProt/SwissProt
Match: sp|Q4WT34|PRP46_ASPFU (Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=prp46 PE=3 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 1.553e-142
Identity = 197/323 (60.99%), Postives = 247/323 (76.47%), Query Frame = -1
Query:   99 DWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1067
            DWH PWKL RV+SGH GWVR ++  P+NE+F +G+ DR +KIWN+  G LRL+LTGH+S VRG+ +S RHPY+FSCGEDK VKCWDLE NKVIRHYHGH S VY L +HP LDLL+TGGRD V RVWDMRT+ N+H+LSGH+  VA ++CQ   P++I+GS DATVRLWDL A KT  VLT+HKK VR++ IHP    F S S   IKQ+  PEG FMQN +GHN +IN++ VNE+NV  SGG++G++ FWDWK+GY FQ + +  QPGSLD+E  I+  +FDRT  RL+T E DKTIK +K DDEAT ES P++W P + R+
Sbjct:  129 DWHPPWKLMRVISGHLGWVRSLAVEPNNEWFASGAGDRTIKIWNLATGALRLTLTGHISTVRGLAVSPRHPYLFSCGEDKMVKCWDLETNKVIRHYHGHLSGVYTLALHPRLDLLVTGGRDGVARVWDMRTRSNIHVLSGHKGTVADLKCQEADPQIITGSLDATVRLWDLAAGKTMGVLTHHKKGVRNLAIHPREFTFASASTGSIKQWKCPEGDFMQNFEGHNAVINSLAVNEDNVLFSGGDNGSMCFWDWKTGYKFQSIDTMAQPGSLDAEAGIMSATFDRTGLRLITGEADKTIKVWKPDDEATPESHPVTWAPTLGRQ 451          
BLAST of SMED30025698 vs. TrEMBL
Match: A0A4S2LGE4 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007756 PE=4 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 7.036e-171
Identity = 252/445 (56.63%), Postives = 334/445 (75.06%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLN--GNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSN--QDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD +ES    + E+D     L   +K+ ++YG +L     NP     S  LS      + +   ++P  + K K +    D+N++  Q    ++++PKKA T+PKP WH PWKLCRVVSGHTGWVRC++F P NE+F+TG+ DRM+K+W+  +G L+L+LTGH+S VRGV IS RHPY+FSCGEDKTV+CWDLEQNKVIRHYHGH SAVY +D+HP +D+L+T GRD+  RVWDMRTK+NVH L+GH + VA+VRCQ + P+VI+GSHDATVRLWDL A +T + LTNHKK+VRS+ IHP  + F+SGS D IKQ+ LPEG F+QNM GHN IINA+ +N++NV VSGG++G+++FWDW+SGYNFQ+LQ+  QPGS+DSE  I   +FDR+  RLV+ E DKTIK +KED+ ATEE+ P+ WRP + ++
Sbjct:    5 QRHSVHTLVFRSLKRTHDMFESDQARLPEADPLSEALKTAVKARDQYGPVLKQASTNPLKQTKSAALS------SAAPGAIVPVEKNKPKPML---DQNTSLVQVGGEKILLPKKAPTMPKPTWHPPWKLCRVVSGHTGWVRCVAFDPTNEFFVTGAGDRMIKVWDFASGTLKLTLTGHISVVRGVVISARHPYLFSCGEDKTVRCWDLEQNKVIRHYHGHMSAVYGIDLHPTIDVLVTCGRDATARVWDMRTKVNVHTLTGHSNTVAAVRCQESDPQVITGSHDATVRLWDLAAGRTITCLTNHKKSVRSICIHPTQNCFISGSPDNIKQWKLPEGVFLQNMSGHNAIINALAINQDNVVVSGGDNGSMHFWDWRSGYNFQRLQTQVQPGSIDSEAGIFALAFDRSGSRLVSCEADKTIKIFKEDETATEETHPLYWRPGLLKR 440          
BLAST of SMED30025698 vs. TrEMBL
Match: A0A074ZFR4 (WD domain, G-beta repeat protein OS=Opisthorchis viverrini OX=6198 GN=T265_07849 PE=4 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 3.081e-170
Identity = 253/445 (56.85%), Postives = 333/445 (74.83%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLN--GNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSN--QDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD +ES    + E D     L   +K+ ++YG +L     NP     S  LS      + +   ++P  + K K +    D+N++  Q    +L++PKKA T+PKP WH PWKLCRVVSGHTGWVRC++F P NE+F+TG+ DRM+K+W+  +G L+L+LTGH+S VRGV IS RHPY+FSCGEDKTV+CWDLEQNKVIRHYHGH SAVY +D+HP +D+L+T GRD+  RVWDMRTK+NVH L+GH + VA+VRCQ + P+VI+GSHDATVRLWDL A +T + LTNHKK+VRS+ IHP  + F+SGS D IKQ+ LPEG F+QNM GHN IINA+ +N++NV VSGG++G+++FWDW+SGYNFQ+LQ+  QPGS+DSE  I   +FDR+  RLV+ E DKTIK +KED+ ATEE+ P+ WRP + ++
Sbjct:   18 QRHSVHTLVFRSLKRTHDMFESDQARLPEVDPLSEALKTAVKARDQYGPVLKQASTNPLKQTKSAALS------SAAPGAIVPVEKNKPKPML---DQNTSLVQVGGEKLLLPKKAPTMPKPTWHPPWKLCRVVSGHTGWVRCVAFDPTNEFFVTGAGDRMIKVWDFASGTLKLTLTGHISVVRGVVISARHPYLFSCGEDKTVRCWDLEQNKVIRHYHGHMSAVYGIDLHPTIDVLVTCGRDATARVWDMRTKVNVHTLTGHSNTVAAVRCQESDPQVITGSHDATVRLWDLAAGRTITCLTNHKKSVRSICIHPTQNCFISGSPDNIKQWKLPEGVFLQNMSGHNAIINALAINQDNVVVSGGDNGSMHFWDWRSGYNFQRLQTQVQPGSIDSEAGIFALAFDRSGSRLVSCEADKTIKIFKEDETATEETHPLYWRPGLLKR 453          
BLAST of SMED30025698 vs. TrEMBL
Match: A0A0X3NVG0 (Pleiotropic regulator 1 OS=Schistocephalus solidus OX=70667 GN=PLRG1 PE=4 SV=1)

HSP 1 Score: 494.582 bits (1272), Expect = 2.147e-169
Identity = 248/447 (55.48%), Postives = 327/447 (73.15%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLN------GNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD +E+    + E D    ++   +K  ++YG +L+        N  ++ PS+D          S K V+P  +     +  N+D +  Q  N +L++PK+A T+PKP WH PWKL RV+SGH+GWVRCISF P NE+F TG+ DRM+KIW+  +G L+L+LTGH+S VRGV +S R PY+FSCGEDKTVKCWDLEQNKVIRHYHGH SAV+ +D+HP LD+L+T GRD+ VRVWDMRTK+NVH ++GH + V++VRCQ + P+VI+GSHDAT+RLWDL   +T   LTNHKK+VRSVFIHP  + F S S D IKQ+ LP+G F+QNM GHN I+NA+T+N + V VSGG++G+++FWDWKSGYNFQ+LQS  QPGS++SE  I   +FDR+  RLV+ E DKTIK +KED+ A EE+ P +WRP + RK
Sbjct:    6 QRHSVHTLVFRSLKRTHDMFEADQARLPELDEKSEKIKMNVKKRDQYGPILHQPIVTPTQNATLSLPSSD----------SDKSVVPVEKQGPAKLPTNSDTHIVQIGNEKLLLPKRAPTMPKPVWHPPWKLFRVISGHSGWVRCISFDPTNEFFATGAADRMIKIWDFASGTLKLTLTGHISAVRGVVVSPRQPYLFSCGEDKTVKCWDLEQNKVIRHYHGHMSAVHAIDLHPTLDILVTCGRDATVRVWDMRTKVNVHTMTGHTNTVSTVRCQESDPQVITGSHDATIRLWDLATGRTMCCLTNHKKSVRSVFIHPTQNAFASASPDNIKQWKLPQGTFLQNMSGHNAIVNALTINMDGVVVSGGDNGSMHFWDWKSGYNFQRLQSQVQPGSINSEAGIFALAFDRSGSRLVSAEADKTIKIFKEDETAMEETHPTNWRPGLLRK 442          
BLAST of SMED30025698 vs. TrEMBL
Match: A0A5K3EML0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 6.614e-169
Identity = 249/451 (55.21%), Postives = 324/451 (71.84%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLNG---------NNPNITAPSTDLSIFNRELAISRKRVLPF-PEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD +ES    + E D +  ++   +K  ++YG +LN            P++  PS+D              ++PF  + +  + F N D +  Q  N +L++PKKA T+PKP WH PWKL RV+SGH+GWVRCISF P NE+F TG+ DRM+KIW+  +G L+L+LTGH+S VRGV IS R PY+FSCGEDKTVKCWDLEQNKVIRHYHGH SAVY +D+HP LD+L+T GRD+  RVWDMRTK+N+H L+GH + V+SVRCQ + P+VI+ SHDATVRLWDL A KT   LTNHKK+VR++ IHP  + F+S S D IKQ+ LP G F+QN+ GH  ++NA+ VN + V VSGG++G+++FWDW+SGYNFQK+ S  QPGS++SE  I   +FDR+  RLVT E DKTIK YKED+ ATEE+ P +WRP + RK
Sbjct:    6 QRHSVHTLVFRSLKRTHDMFESDQARLPEIDEASHKIKMALKRRDQYGPILNKPMEPVAKRQAQPSLQPPSSD-------------EIVPFEKQEETNNSFSNTDSHIVQVGNEKLLLPKKAPTMPKPTWHPPWKLARVISGHSGWVRCISFDPTNEFFATGAADRMIKIWDFASGYLKLTLTGHISAVRGVVISPRQPYLFSCGEDKTVKCWDLEQNKVIRHYHGHMSAVYDIDLHPTLDVLVTCGRDATARVWDMRTKVNIHTLTGHSNTVSSVRCQESDPQVITASHDATVRLWDLAAGKTMVCLTNHKKSVRAIAIHPTQNAFISASPDNIKQWKLPTGTFLQNLSGHKALVNALAVNMDGVVVSGGDNGSMHFWDWRSGYNFQKISSIAQPGSINSEAGIFALAFDRSGSRLVTAEADKTIKIYKEDENATEETHPTNWRPGLLRK 443          
BLAST of SMED30025698 vs. TrEMBL
Match: C1LEU2 (Pleiotropic regulator 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_001193 PE=2 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 9.491e-168
Identity = 250/441 (56.69%), Postives = 331/441 (75.06%), Query Frame = -1
Query:   99 QGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1421
            Q HS+HTL FRSLKR+HD +E+    + E D     L   IK+ ++YG +L   + N   P  ++S   +  AI         + K KS    N  +  Q  N +L++PKKA T+PKP WH PWKLCRVVSGHTGWVRC++F P N++F+TG+ DRM+K+W+  +G L+L+LTGH+S VRGV +S RHPY+FSCGEDKTV+CWDLEQNKVIRHYHGH SAVY +D+HP +D+++T GRD+  RVWDMRTK+NVH L+GH + VA+VRCQ + P+VI+GSHDATVRLWDL A +T + LTNHKK+VR++ IHP  + F+SGS D IKQ+ LP+G F+QN+ GHN IINA+TVNE+NV VSGG++G+++FWDWKSG+NFQ+LQ+  QPGS+DSE  I   +FDR+  RLV+ E DK+IK +KED+ ATEE+ P+ WRP + +K
Sbjct:    5 QRHSVHTLVFRSLKRTHDMFEADQNRLPEVDEKSNSLKVAIKAKDQYGPVLKEPSQNPLKPKENISDACQPGAIVSSE-----KSKPKSTLEQN-ASIVQIGNEKLLLPKKAPTMPKPTWHPPWKLCRVVSGHTGWVRCVAFDPTNDFFVTGAADRMIKVWDFASGTLKLTLTGHISTVRGVVVSARHPYLFSCGEDKTVRCWDLEQNKVIRHYHGHMSAVYDIDIHPTIDVILTCGRDATARVWDMRTKVNVHTLTGHSNTVATVRCQESDPQVITGSHDATVRLWDLAAGRTIACLTNHKKSVRALCIHPTQNAFVSGSPDNIKQWKLPDGVFLQNLSGHNAIINAITVNEDNVVVSGGDNGSVHFWDWKSGFNFQRLQAQVQPGSIDSEAGIFALTFDRSGSRLVSCEADKSIKIFKEDETATEETHPLYWRPGLLKK 439          
BLAST of SMED30025698 vs. Ensembl Cavefish
Match: plrg1 (pleiotropic regulator 1 [Source:NCBI gene;Acc:103042237])

HSP 1 Score: 424.476 bits (1090), Expect = 1.362e-144
Identity = 195/322 (60.56%), Postives = 251/322 (77.95%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVR I+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RD+  RVWD+RTK NVH L+GH + VA+V+CQS  P++I+GSHD T+RLWDL A KT++ LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I    FD +  RL+T E DKTIK Y+EDD ATEES P++W+P I ++
Sbjct:  171 WHPPWKLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTIDVLVTCSRDATARVWDIRTKANVHTLTGHTNTVATVKCQSAEPQIITGSHDTTIRLWDLIAGKTRATLTNHKKSVRAVVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTIHMWDWRTGYNFQRIHAAVQPGSLDSESGIFSCVFDHSESRLITAEADKTIKVYREDDTATEESHPVNWKPEIIKR 492          
BLAST of SMED30025698 vs. Ensembl Cavefish
Match: plrg1 (pleiotropic regulator 1 [Source:NCBI gene;Acc:103042237])

HSP 1 Score: 424.476 bits (1090), Expect = 2.665e-144
Identity = 195/322 (60.56%), Postives = 251/322 (77.95%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVR I+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+L+T  RD+  RVWD+RTK NVH L+GH + VA+V+CQS  P++I+GSHD T+RLWDL A KT++ LTNHKK+VR+V +HP    F SGS D IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I    FD +  RL+T E DKTIK Y+EDD ATEES P++W+P I ++
Sbjct:  190 WHPPWKLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTIDVLVTCSRDATARVWDIRTKANVHTLTGHTNTVATVKCQSAEPQIITGSHDTTIRLWDLIAGKTRATLTNHKKSVRAVVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTIHMWDWRTGYNFQRIHAAVQPGSLDSESGIFSCVFDHSESRLITAEADKTIKVYREDDTATEESHPVNWKPEIIKR 511          
BLAST of SMED30025698 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 132.88 bits (333), Expect = 1.674e-34
Identity = 82/302 (27.15%), Postives = 151/302 (50.00%), Query Frame = -1
Query:  156 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1037
             ++GHT  V  + FSP  E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K WD+   K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       VSG  D  +Y W+ ++    QKLQ     G  D    ++  +   T   + +  +E DKTIK +K D
Sbjct:   40 TLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ-----GHTD---VVISTACHPTENIIASAALENDKTIKLWKSD 333          

HSP 2 Score: 80.1073 bits (196), Expect = 4.984e-16
Identity = 50/178 (28.09%), Postives = 84/178 (47.19%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D +LL++   D  +++WD+ +   +  L GH + V   +   QSNL  ++SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   34 NYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 209          
BLAST of SMED30025698 vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 132.494 bits (332), Expect = 2.306e-34
Identity = 84/303 (27.72%), Postives = 153/303 (50.50%), Query Frame = -1
Query:  156 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLV---TVEGDKTIKFYKED 1037
             ++GHT  +  + FSP+ E+  + S D+++KIW   +GK   SL+GH  G+  V  S     + S  +DKT+K WD+   K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      V  N +       VSG  D  +Y W+ ++    QKLQ     G  D    ++  +    S+ ++    +E DKTIK +K D
Sbjct:   37 TLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQ-----GHAD----VVIATACHPSENIIASAALENDKTIKLWKSD 330          

HSP 2 Score: 84.3445 bits (207), Expect = 1.830e-17
Identity = 52/178 (29.21%), Postives = 85/178 (47.75%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   +  VK S    ++ S   DK +K W     K  +   GH   +  +   PD +LL++   D  +++WDM +   +  L GH + V   +   QSNL  V+SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   31 NYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNL--VVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTL 206          
BLAST of SMED30025698 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 129.413 bits (324), Expect = 6.340e-32
Identity = 93/295 (31.53%), Postives = 151/295 (51.19%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ E    I   +GHTS V C+ +H     +++G RD+ +RVWD+ T   +H+L GH   VA+VRC Q +   V+SG++D  V++WD         L  H   V S+    I  H +SGS D  I+ + +  G  +  + GH   + +    ++N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F++    ++T   D T+K +
Sbjct:  215 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLHVLMGH---VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGI--HVVSGSLDTSIRVWDVETGNCIHTLTGH-QSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHK-----HQSAVTCLQFNKNF--VITSSDDGTVKLW 490          

HSP 2 Score: 114.775 bits (286), Expect = 5.508e-27
Identity = 81/267 (30.34%), Postives = 133/267 (49.81%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S    +   I+GS DR LK+WN + G    +L GH S VR + +  +   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D +V+VWD  T+  +H L GH + V S+  Q +   V+SGS D ++R+WD+        LT H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +           N  ++  +DGT+  WD ++G   + L +    GS
Sbjct:  253 KCLRTLVGHTGGV--WSSQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL--QFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGS 509          
BLAST of SMED30025698 vs. Ensembl Sea Lamprey
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 420.239 bits (1079), Expect = 3.515e-143
Identity = 192/322 (59.63%), Postives = 246/322 (76.40%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVR I+  P N++F+TGS DR +KIW +  GKL+LSLTGH+S VRGV +S R PY+FSCGEDK +KCWDLE NKVIRHYHGH SA Y LD+HP +D+L+T GRD+  RVWD+RTK NVH L+GH + VA V+CQ+  P++I+GSHD TVRLWDL A K++  LTNHKK+VRSV +HP    F S S D IKQ+  P+G F QN+ GHN IIN + +N + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I   +FD +  RL+T E DKTIK YKEDD A+EE+ PI+W+P I ++
Sbjct:  199 WHPPWKLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWELATGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQIKCWDLEYNKVIRHYHGHLSAAYALDLHPTIDVLVTCGRDATARVWDIRTKANVHTLTGHTNTVADVKCQAVEPQIITGSHDCTVRLWDLAAGKSRVTLTNHKKSVRSVVLHPRQYTFASASPDNIKQWKFPDGVFFQNLSGHNAIINCLALNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESGIFACAFDHSESRLITAEADKTIKLYKEDDTASEETHPINWKPEILKR 520          
BLAST of SMED30025698 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 8.876e-34
Identity = 93/295 (31.53%), Postives = 154/295 (52.20%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ +  + +   +GHTS V C+ +H   + +++G RD+ +RVWD+ T   +H+L+GH   VA+VRC Q +   V+SG++D TV++WD  +      L  H   V S+    +  H +SGS D  I+ +    G  +  + GH   + +     +N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F R  + +VT   D T+K +
Sbjct:  227 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLHG--NRVVSGSRDATLRVWDIETGQCLHVLAGH---VAAVRCVQYDGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFDGV--HIVSGSLDTSIRVWDAETGTCLHTLVGH-QSLTSGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNK-----HQSAVTCLQFSR--KLVVTSSDDGTVKLW 502          

HSP 2 Score: 111.694 bits (278), Expect = 1.338e-26
Identity = 81/268 (30.22%), Postives = 130/268 (48.51%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHP-YVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S        ++GS DR LK+WN D G+   +L GH S VR +   H H   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D  V+VWD  ++  +H L GH + V S+  Q +   ++SGS D ++R+WD         L  H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +            + V+  +DGT+  WD ++G   + L S    GS
Sbjct:  265 KCLRTLVGHTGGV--WSSQMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCM---HLHGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQY--DGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSL--QFDGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELRD--NILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSRKLVVTSSDDGTVKLWDLRTGDFLRNLVSLDSGGS 521          
BLAST of SMED30025698 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 107.071 bits (266), Expect = 7.555e-26
Identity = 77/314 (24.52%), Postives = 139/314 (44.27%), Query Frame = -1
Query:  162 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPIT--------------------DHFMSGSAD-GIKQFSLPEGQFMQNMKGHXX-XXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYK 1037
             +SGH   V  + F P     ++ S+D  +K+W+ + G    +L GH   V+ +        + SC  D TVK WD +  + +R  HGH   V  +   P+ D L++  RD  +++W+++T   V   +GHR+ V  VR   +   + S S+D TVR+W     + ++ L  H+  V  V   P                       + +SGS D  IK + +  G  +  + GH+  +   +        +S  +D TL  WD+K+    + L +         E+ +    F +T+  ++T   D+++K ++
Sbjct:   42 ALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAA--------HEHFVTSLDFHKTAPYVITGSVDQSVKVWE 347          

HSP 2 Score: 77.7962 bits (190), Expect = 5.171e-16
Identity = 55/216 (25.46%), Postives = 88/216 (40.74%), Query Frame = -1
Query:  453 RVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNL--------------------PEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD 1040
            R + GHT  V+ ISF    +   + S D  +K+W+  + +   ++ GH   V  V       ++ S   DKT+K W+++    ++ + GH   V  +  + D  L+ +   D  VRVW   TK     L  H   V  V    +                     P ++SGS D T+++WD+        L  H   VR V  HP     +S + D
Sbjct:   83 RTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADD 298          

HSP 3 Score: 77.0258 bits (188), Expect = 1.038e-15
Identity = 46/183 (25.14%), Postives = 77/183 (42.08%), Query Frame = -1
Query:  552 RVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGH--------------------VSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLR 1040
            +  +GH  WVR +  + D     + S+D+ +++W     + +  L  H                     +G    K     PY+ S   DKT+K WD+     +    GH + V  +  HP    +++   D  +RVWD + K     L+ H   V S+      P VI+GS D +V++W+ R
Sbjct:  167 KTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWECR 349          

HSP 4 Score: 76.2554 bits (186), Expect = 1.764e-15
Identity = 42/150 (28.00%), Postives = 69/150 (46.00%), Query Frame = -1
Query:  678 WHAPWKLCRV-VSGHTGWVRCISFSPD--------------------NEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMR 1064
            W    K C+  +  H   V C+S++PD                      Y ++GS D+ +K+W++  G   ++L GH + VRGV       ++ SC +DKT++ WD +  +  +    H   V  LD H     ++TG  D  V+VW+ R
Sbjct:  200 WVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWECR 349          

HSP 5 Score: 68.9366 bits (167), Expect = 4.509e-13
Identity = 40/140 (28.57%), Postives = 66/140 (47.14%), Query Frame = -1
Query:  498 RLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSV 917
            + +L+GH S V  V        + S  ED T+K WD E     R   GHT +V  +       +L +   D  V++WD ++   +  + GH   V+SV    N   ++S S D T+++W+++        T H++ VR V
Sbjct:   40 KYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMV 179          

HSP 6 Score: 50.8322 bits (120), Expect = 3.017e-7
Identity = 51/197 (25.89%), Postives = 83/197 (42.13%), Query Frame = -1
Query:  105 HILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHX-XXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGY---------NFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIA 662
            + LSGHR  V  V        ++S S DAT+++WD      +  L  H  +V+ +          S SAD  +K +     + ++ M GH+  + +   +   +  VS   D T+  W+ ++GY          + ++  P Q GSL     I   S D+T +  VT    K  K    + E   E   +SW P+ A
Sbjct:   41 YALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSL-----IASCSNDQTVRVWVT--ATKECKAELREHEHVVEC--VSWAPDAA 228          
BLAST of SMED30025698 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 104.375 bits (259), Expect = 2.126e-24
Identity = 60/195 (30.77%), Postives = 93/195 (47.69%), Query Frame = -1
Query:  453 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD 1037
            V   HT  VR +SFS D +  +T SDD+ +K+W V   K   SL  H + VR  K S     + S  +D+TV+ WD    + +  ++ H   V  +D HP    +   G D+ V+VWD+R    +     H  AV S+        +I+ S+D+T+++ DL   +    L  H+    +V      D F SG +D
Sbjct:   97 VFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSD 291          

HSP 2 Score: 85.5001 bits (210), Expect = 3.852e-18
Identity = 75/295 (25.42%), Postives = 110/295 (37.29%), Query Frame = -1
Query:  315 PWK----LCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAV--------------------------------YCLDMH----------PDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXX-XXXXXXXVSGGNDGTLYFW 1055
            PW+    L R   GH   +  + F+P+ +   +GS D  L +WN           GH   V  V+ S     V S   DKTV+ W          +  HT+ V                                Y L+ H          PD  L+++G  D  VRVWD  ++  VH    H   V  V    +   + +   D TV++WD+R  K       H  AV S+  HP  ++ ++ S D  +K   L EG+    + GH     AV      +   SGG+D  +  W
Sbjct:    3 PWQEDPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          

HSP 3 Score: 73.1738 bits (178), Expect = 3.204e-14
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = -1
Query:  312 EQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXX-XXXXXXXXXXXXXVSGGNDGTLYFWD 806
            E   + RH+ GH   +  +D +P++  L +G  D+ + VW+ + +   +   GH+DAV SV+   +   V+S S D TVRLW        +V   H   VRSV         ++ S D  IK +++   +F+ ++  H+  + +A    +  + VSG +D T+  WD
Sbjct:    6 EDPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWD 172          

HSP 4 Score: 57.7658 bits (138), Expect = 3.037e-9
Identity = 55/265 (20.75%), Postives = 91/265 (34.34%), Query Frame = -1
Query:  171 DNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQF-----------SLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIK 932
            ++  L     GH   +  V  +     + S   D  +  W+ +       + GH  AV  +   P   L+++  RD  VR+W    K    +   H   V SV   ++   +++ S D ++++W +   K    L  H   VRS    P     +SGS D   +                G F+  +  H                + G D T+  WD +     Q  Q            ++   SF  T   L+T   D T+K
Sbjct:    6 EDPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFH---------PSGTCIAAAGTDNTVKVWDIRMNKLLQHYQV--------HGAAVNSLSFHPTGNYLITASNDSTLK 253          
BLAST of SMED30025698 vs. Ensembl Sea Lamprey
Match: WDR86 (WD repeat domain 86 [Source:HGNC Symbol;Acc:HGNC:28020])

HSP 1 Score: 95.9005 bits (237), Expect = 3.988e-22
Identity = 65/240 (27.08%), Postives = 106/240 (44.17%), Query Frame = -1
Query:  396 RVVSGHTGWVRCISFSPD-NEYFITGSDDRMLKIWNVD----NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--------------ASVRCQSNLPE-----VISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGH 1040
            R++ G TG V C+S   D +   +TG +D    +W+ +     G+ R +L GH   +    ++      F+C  D+T +CWD++    ++ Y GH   V    + P    L +   D   R WD RT   + + +GHR  V              +S    + L E     ++SGS D TVRLW L +      L  H+  V  + +        SG ADG ++++ L  GQ +++   H
Sbjct:    7 RILVGPTGGVNCMSAGEDGSALLLTGGEDGSAALWDAEAPQGQGR-RATLRGHEGYITHCALAADGARAFTCSADRTARCWDVQSGHCLQVYRGHAGVVN--RVVPHAGWLFSSSYDKTARCWDTRTGDALRVFAGHRSCVLPLALYCPPKGERRSSSAALAALEENTTLLLMSGSVDGTVRLWRLSSGACARTLRGHQGPVLCLAVDASNGALYSGGADGTVRKWDLSSGQQLRSYTEH 243          

HSP 2 Score: 91.2781 bits (225), Expect = 1.330e-20
Identity = 76/283 (26.86%), Postives = 118/283 (41.70%), Query Frame = -1
Query:  426 LAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCR--VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTS-----AVYC---------------LDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPE 1208
            +   R R+L  P          N  ++ +D +  L+   +  +    D  AP    R   + GH G++   + + D     T S DR  + W+V +G       GH +GV    + H   ++FS   DKT +CWD      +R + GH S     A+YC               L+ +  L LLM+G  D  VR+W + +      L GH+  V  +   ++   + SG  D TVR WDL + +     T H   V  + +     H  SGS+DG  +  L E
Sbjct:    1 MGTGRTRILVGPTGGV------NCMSAGEDGSALLLTGGEDGSAALWDAEAPQGQGRRATLRGHEGYITHCALAADGARAFTCSADRTARCWDVQSGHCLQVYRGH-AGVVNRVVPH-AGWLFSSSYDKTARCWDTRTGDALRVFAGHRSCVLPLALYCPPKGERRSSSAALAALEENTTL-LLMSGSVDGTVRLWRLSSGACARTLRGHQGPVLCLAVDASNGALYSGGADGTVRKWDLSSGQQLRSYTEHTDLV--ICLQLANRHLYSGSSDGTARRWLSE 272          

HSP 3 Score: 63.1586 bits (152), Expect = 3.430e-11
Identity = 59/235 (25.11%), Postives = 85/235 (36.17%), Query Frame = -1
Query:  396 RVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGV---------RGVKISHRHPY----------VFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNMKGH 1040
            +V  GH G V      P   +  + S D+  + W+   G       GH S V         +G + S               + S   D TV+ W L      R   GH   V CL +      L +GG D  VR WD+ +   +   + H D V  ++  +    + SGS D T R W         V   HK  V ++  H       +GS D + + F    G   +  KGH
Sbjct:   95 QVYRGHAGVVN--RVVPHAGWLFSSSYDKTARCWDTRTGDALRVFAGHRSCVLPLALYCPPKGERRSSSAALAALEENTTLLLMSGSVDGTVRLWRLSSGACARTLRGHQGPVLCLAVDASNGALYSGGADGTVRKWDLSSGQQLRSYTEHTDLVICLQLANR--HLYSGSSDGTARRWLSEVGGCARVYRPHKHTVSTLRYHDGI--LFTGSGDTLARAFDARSGALKRTFKGH 323          

HSP 4 Score: 62.7734 bits (151), Expect = 4.834e-11
Identity = 39/162 (24.07%), Postives = 71/162 (43.83%), Query Frame = -1
Query:  492 FITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFI 977
             ++GS D  +++W + +G    +L GH   V  + +   +  ++S G D TV+ WDL   + +R Y  HT  V CL +      L +G  D   R W         +   H+  V+++R    +  + +GS D   R +D R+   +     H   +  + +
Sbjct:  175 LMSGSVDGTVRLWRLSSGACARTLRGHQGPVLCLAVDASNGALYSGGADGTVRKWDLSSGQQLRSYTEHTDLVICLQLAN--RHLYSGSSDGTARRWLSEVGGCARVYRPHKHTVSTLRYHDGI--LFTGSGDTLARAFDARSGALKRTFKGHTGIINCLEV 332          
BLAST of SMED30025698 vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 334.339 bits (856), Expect = 6.245e-111
Identity = 159/326 (48.77%), Postives = 224/326 (68.71%), Query Frame = -1
Query:   99 DWHAPWKLCRVVSGHTGWVRCISFSP-DNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXV-SGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFP-ISWRPNIARK 1067
            +WHAPWKL RV++GH GWVRC++  P DNE+FITGS+D  +K+W++  GKL+ +L GHV  VR V +S RHPY+FS  EDKTVKCWDLE+N++IR Y+GH S V  + +HP LDL+ T GRDSV+++WDMRT+I V  L GH+  +  V+C    P+V+S S DATVRLWD+ A KT  VLT+HK++VR+  +HP      S   D I+ + L EG  + N +   T I        +  + +GG++G L F+D+KSG+ +Q L +    GSL+ E S+L  +FD+T  RL+T E DK+IK +K+D+ AT+ES P ++W PN++ K
Sbjct:  124 EWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIWKQDETATKESEPGLAWNPNLSAK 449          
BLAST of SMED30025698 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 112.464 bits (280), Expect = 9.566e-27
Identity = 60/198 (30.30%), Postives = 100/198 (50.51%), Query Frame = -1
Query:  453 CRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNH-KKAVRSVFIHPITDHFMSGSAD 1043
            C+ + GH+G V   SFSPDN+Y ++GS+D+ +++W++D     +S  GH   V  V  S    Y  +   D+T + W  +    +R + GH + V C+  HP+   + TG  D   R+WD+ T  +V +  GH   V S+    +   + +GS D  + +WD+   K    +  H K A+ S+      +  +SG AD
Sbjct:  518 CKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGAD 715          

HSP 2 Score: 98.9821 bits (245), Expect = 1.872e-22
Identity = 71/256 (27.73%), Postives = 107/256 (41.80%), Query Frame = -1
Query:  306 VRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRL-----------------SLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXX--XXXXXXXXXXXVSGGNDGTLYFWDWK 1013
            + C+ FS D      G  D  +KIW++D   L                   +L GH   V     S  + Y+ S  EDKTV+ W ++ +  +  Y GH   V+ +   P      T   D   R+W       + I +GH + V  V    N   V +GS D T R+WD+    +  +   H   V S+ + P      +GS DG I  + +  G+ ++ M+GH      +     E NV +SGG D T+  WD K
Sbjct:  469 MSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724          
BLAST of SMED30025698 vs. Ensembl Yeast
Match: COP1 (Alpha subunit of COPI vesicle coatomer complex; complex surrounds transport vesicles in the early secretory pathway [Source:SGD;Acc:S000002304])

HSP 1 Score: 110.538 bits (275), Expect = 5.289e-26
Identity = 67/223 (30.04%), Postives = 97/223 (43.50%), Query Frame = -1
Query:  453 HTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWD-------------------MRTKINV-----------HILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLT--NHKKAVRSVFIHPITDHFMSGSAD 1025
            H G VR + F P    F++  DD  +K+W++D  K   +LTGH+  VR V      P++ S  +D+T++ W+ +  K I    GH   V C   HP  DL+++   D  +R+WD                   M  + N+            IL GH   V        LP ++SGS D  V+LW + A K   V T   H   V SV  HP  +  +S   D
Sbjct:   52 HEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGED 274          

HSP 2 Score: 86.6557 bits (213), Expect = 2.091e-18
Identity = 43/144 (29.86%), Postives = 68/144 (47.22%), Query Frame = -1
Query:  453 RGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD 884
            +G+      P+V       T++ WD     ++  +  H   V  LD HP   + ++ G D  ++VW + T   ++ L+GH D V +V     LP +IS S D T+R+W+ +  K  + LT H   V     HP  D  +S S D
Sbjct:   15 KGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLD 158          

HSP 3 Score: 80.4925 bits (197), Expect = 2.096e-16
Identity = 39/152 (25.66%), Postives = 70/152 (46.05%), Query Frame = -1
Query:  555 RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDL 1010
            + I+F P   + +       +++W+   G L      H   VRG+      P   S G+D T+K W L+ NK +    GH   V  +  H +L  +++   D  +R+W+ + +  +  L+GH   V   +       ++S S D T+R+WD+
Sbjct:   15 KGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDI 166          

HSP 4 Score: 76.2554 bits (186), Expect = 4.253e-15
Identity = 64/238 (26.89%), Postives = 96/238 (40.34%), Query Frame = -1
Query:  432 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDL---------------------EQNK--------VIRH-YHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMR-TKI-NVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSL 1049
            K    ++GH  +VR + F  +  + I+ SDD+ ++IWN  N K    LTGH   V   +       + S   D+T++ WD+                     +QN         V++    GHT  V     HP L L+++G  D  V++W M  TK   V    GH + V SV    +   +IS   D T+R+WDL                  +  HP  + F +    GI  F L
Sbjct:   86 KCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKL 323          

HSP 5 Score: 50.0618 bits (118), Expect = 6.562e-7
Identity = 28/115 (24.35%), Postives = 47/115 (40.87%), Query Frame = -1
Query:  453 KVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD 797
            K++  +   ++    +  HP    ++     S +++WD R    +H    H   V  +      P  +S   D T+++W L   K    LT H   VR+VF H      +S S D
Sbjct:    2 KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDD 116          
BLAST of SMED30025698 vs. Ensembl Yeast
Match: CDC4 (F-box protein required for both the G1/S and G2/M phase transitions; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as a ubiquitin-protein ligase directing ubiquitination of cyclin-dependent kinase (CDK) phosphorylated substrates, such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p [Source:SGD;Acc:S000001885])

HSP 1 Score: 97.8265 bits (242), Expect = 5.006e-22
Identity = 66/226 (29.20%), Postives = 114/226 (50.44%), Query Frame = -1
Query:  474 DWHAPWKLCR--VVSGH-TGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDM--HPDLDLLMTGGRDSVVRVWDMRTKIN-----------------------VHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDH 1067
            +W+ P  + +   + GH T  + C+ F  ++ Y ITG+DD+M+++++  N K  L L+GH  GV  +K +H    V S   D+TV+ WD+++      + GH S V CLD+  + ++  ++TG RD+ + VW +  + +                       V +L GH  +V +V    N+  V+SGS+D T+ +WD+   K   +L+ H   + S     I DH
Sbjct:  364 NWYNPKFVPQRTTLRGHMTSVITCLQF--EDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILV-SGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNI--VVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYST----IYDH 580          
BLAST of SMED30025698 vs. Ensembl Yeast
Match: SEC27 (Essential beta'-coat protein of the COPI coatomer; involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP [Source:SGD;Acc:S000003105])

HSP 1 Score: 95.5153 bits (236), Expect = 3.042e-21
Identity = 62/206 (30.10%), Postives = 96/206 (46.60%), Query Frame = -1
Query:  432 GHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNG-KLRLSLTGHVSGVRGVKISHRHPYVFSCG-EDKTVKCWDLEQNKV-IRHYHGHTSAVYCLDMHP--DLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPI--TDHFMSGSADGIKQFSL 1028
             H  ++R I+  P   Y ++GSDD  +K+WN +N   L  +  GH   V  V  + + P  F+ G  D+TVK W L Q+        G    V  +D +P  D   ++T   D  +++WD +TK  V  L GH   V+       LP +ISGS D T+++W+    K +  L    +    +  HP    ++  SG  +G    SL
Sbjct:   95 AHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL 300          

HSP 2 Score: 92.4337 bits (228), Expect = 2.996e-20
Identity = 55/193 (28.50%), Postives = 88/193 (45.60%), Query Frame = -1
Query:  450 VRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRH-YHGHTSAVYCLDMHP-DLDLLMTGGRDSVVRVWDM-RTKINVHILSGHRDAVASVRCQ--SNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG 1013
            VR   F     + I GSDD  ++++N + G+  +    H   +R + +    PYV S  +D TVK W+ E N  +   + GH   V C+  +P D     +G  D  V+VW + ++  N  + +G    V  V      + P +I+ S D T+++WD +     + L  H   V     HP     +SGS DG
Sbjct:   58 VRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDG 250          

HSP 3 Score: 78.1814 bits (191), Expect = 1.102e-15
Identity = 40/135 (29.63%), Postives = 66/135 (48.89%), Query Frame = -1
Query:  675 DWHAPWKLCRVVSGHTGWVRCISFSP-DNEYFITGSDDRMLKIWNVDNGKLRLSL-TGHVSGVRGVKIS--HRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRT 1067
            +W   W L +   GH  +V C++F+P D   F +G  DR +K+W++       +L TG   GV  V        PY+ +  +D T+K WD +    +    GH S V     HP L ++++G  D  +++W+  T
Sbjct:  125 NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSST 259          

HSP 4 Score: 58.151 bits (139), Expect = 1.824e-9
Identity = 54/259 (20.85%), Postives = 109/259 (42.08%), Query Frame = -1
Query:  285 RVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINV-HILSGHRDAVASVRCQSNLPEVI-SGSHDATVRLWDL-RAAKTQSVLTNHKKAVRSVFIHPITD--HFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXX-XXXXXXVSGGNDGTLYFWDWKSGYNFQK 1040
            +  S  +  V+ I F P   + +T      +++WN +      S+    + VR  K   R  ++    +D  ++ ++    + +  +  H   +  + +HP    +++G  D  V++W+      +     GH   V  V      P    SG  D TV++W L ++    ++ T  ++ V  V  +P+ D  + ++ S D  IK +       +  ++GH + ++         + +SG  DGTL  W+  S Y  +K
Sbjct:    7 KTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWN-SSTYKVEK 264          
BLAST of SMED30025698 vs. Ensembl Nematostella
Match: EDO33344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI1])

HSP 1 Score: 429.483 bits (1103), Expect = 1.250e-146
Identity = 231/508 (45.47%), Postives = 318/508 (62.60%), Query Frame = -1
Query:   99 HSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYG----------------------------------ILLNGNNPNITAP----STDLSIFNRELAIS------------------RKRVLPFPEPKAKSIFINNDE-------------NSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1415
            HS+HTL FRSLKR+HD +   H   +  D    ++    K  +EY                                    ++ G +P   AP    +++ +++ RE++ +                  +KR L   + + K++     E              + Q  +T L+  +K  ++PKP WHAPWKL RV+SGHTGWVR ++  P N++F TGS DR +KIW++ +GKL+LSLTGH+S VRG+ +S RHPY+FS GEDK VKCWDLE NKVIRHYHGH SAVY  D+HP +D+L+T GRD+  RVWD+RTK  +H L+GH + V+SVR Q+  P+VI+GSHD T+RLWDL A K+   LTNHKK++R+V ++P    F S S D IK +  P+G F+QN+ GHNTIIN + VN +NV VSGG++G++YFWDWK+GYNFQ++Q   QPGSLDSE  I   +FD++S RL+T E DKTIK YKED+ ATEES P++W+P I ++
Sbjct:    9 HSVHTLVFRSLKRTHDLFLHDHALPVAQDEHSEKIKIACKVRDEYDPIKDLVPVSSAKETHGQNMTSHSDRLQQQAQHPETIIQGGHPYPHAPGVPLTSETAVYPREISEAGKQRILSELPLSDSQLEAQKRSLGIVDIRQKAMASGGQERLGPKSKALVSIGGTKQQQSTALMHQRKTPSLPKPQWHAPWKLMRVISGHTGWVRSVAVEPGNKWFATGSADRTIKIWDLGSGKLKLSLTGHISTVRGLVVSPRHPYLFSAGEDKLVKCWDLEYNKVIRHYHGHLSAVYDADIHPTIDVLLTCGRDATTRVWDIRTKACIHTLTGHTNTVSSVRAQAVDPQVITGSHDCTIRLWDLAAGKSAVTLTNHKKSIRAVTLNPNLFTFASASPDNIKMWKFPDGNFLQNLSGHNTIINCLAVNSDNVLVSGGDNGSMYFWDWKTGYNFQRIQGTAQPGSLDSEAGIFSMTFDQSSSRLITTEADKTIKIYKEDEMATEESHPVNWKPEITKR 516          
BLAST of SMED30025698 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 126.716 bits (317), Expect = 1.733e-32
Identity = 81/308 (26.30%), Postives = 150/308 (48.70%), Query Frame = -1
Query:  156 WKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLV---TVEGDKTIKFYKED 1052
            ++L   ++GH   V  + FS + E+  + S D+++KIW   +GK   ++TGH  G+  V  S    ++ S  +DKT+K WD    K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V +V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      V  N +       VSG  D  +Y W+         LQS      LD  + ++       ++ ++    +E DKTIK +K D
Sbjct:   55 YQLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWN---------LQSKEVVQKLDGHSDVVLCCACHPTENIIASGALENDKTIKIWKSD 353          

HSP 2 Score: 79.7221 bits (195), Expect = 2.620e-16
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N +L+ +LTGH   V  VK SH   ++ S   DK +K W     K  +   GH   +  +    D   L++   D  +++WD  T   +  L GH + V   +   QSNL  ++SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   54 NYQLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTL 229          

HSP 3 Score: 77.411 bits (189), Expect = 1.467e-15
Identity = 53/214 (24.77%), Postives = 90/214 (42.06%), Query Frame = -1
Query:  561 APWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGH------------------------------VSG-------------VRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDL---DLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGS--HDATVRLW 1058
            A  K  + + GH+ +V C +F+P +   ++GS D  ++IW+V  GK   +L  H                               SG             V  VK S    Y+ +   D T+K WD  + K ++ Y GH +  YC+  +  +     +++G  D  V +W++++K  V  L GH D V    C      + SG+  +D T+++W
Sbjct:  137 ATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGHSDVVLCCACHPTENIIASGALENDKTIKIW 350          
BLAST of SMED30025698 vs. Ensembl Nematostella
Match: EDO42306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1V2])

HSP 1 Score: 127.872 bits (320), Expect = 1.241e-31
Identity = 97/301 (32.23%), Postives = 153/301 (50.83%), Query Frame = -1
Query:  165 APWKLCRVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1058
             P +  +++ GH   V  C+ FS      ++GSDD  LK+W+  +GK   +LTGH  GV   ++S     + S   D+T+K W+ E    +   +GHTS V C+DMH   +++++G RD  +RVWD  T   +H+L GH   +A+VRC + +   V+SG++D  V++WD    +    L  H   V S+       + +SGS D  I+ +    GQ +  + GH   + +     NN  VSG  D T+  WD  +G   Q LQ+   P    S  + L FS    S+ ++T   D T+K +
Sbjct:  278 GPLRPSKILKGHDDHVITCLQFS--GSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGH--IIVSGSTDRTLKVWNAETGYCMHTLYGHTSTVRCMDMHE--EVVVSGSRDGTLRVWDTTTGNCLHVLVGH---LAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGT--YIVSGSLDTSIRVWHAETGQCLHTLVGH-QSLTSGMELRNNTLVSGNADSTVKIWDITTG---QCLQTLAGPNKHQSAVTCLQFS----SKFVITSSDDGTVKIW 559          
BLAST of SMED30025698 vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 119.013 bits (297), Expect = 3.105e-30
Identity = 62/199 (31.16%), Postives = 104/199 (52.26%), Query Frame = -1
Query:  450 LCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG 1046
            L   + GH  WV  +  +PD++  I+ S D+ +KIW+V+      SL GH   VRG+ I+     + S  +D+T++ W+LE    +    GH+  VYC+   PD    ++G  D++V++WD+ +   V  L GH   + +V    +  +VIS   D  V++W L + +  + L  H ++VR V + P     +SGS D 
Sbjct:   89 LVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDA 287          

HSP 2 Score: 117.087 bits (292), Expect = 1.177e-29
Identity = 75/239 (31.38%), Postives = 121/239 (50.63%), Query Frame = -1
Query:  315 HTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXX-XXXXXVSGGNDGTLYFW 1025
            HT  V  ++ SP  ++ ++G+ D  +KIW++D   L  +L GH + V GV ++     + S   DKTVK WD+E    +    GH   V  + +  D   L++  +D  +R+W++ T  +V  L GH + V  V C  +    ISGS D  V++WDL +AK    L  H   + +V + P     +S   D  +K +SL  G+ + ++ GH+  +  VTV+ +    VSG  D T   W
Sbjct:   54 HTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          

HSP 3 Score: 102.449 bits (254), Expect = 1.918e-24
Identity = 72/258 (27.91%), Postives = 124/258 (48.06%), Query Frame = -1
Query:  279 LCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXX-XXXXXVSGGNDGTLYFWDWKSGYNFQKLQ 1046
            L R + G +  +  I+ +PD +  ITG  D  +++W+ + GK    L  H   V  + +S    ++ S   D TVK WD++   ++    GH + V  + + PD   +++   D  V++WD+ T   V+ L GH   V  +   S+   ++S S D T+R+W+L      S L  H + V  V   P     +SGS D  +K + L   + ++++ GH + I AV V  + +  +S G+D  +  W  +SG     L 
Sbjct:    5 LLRTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLH 262          

HSP 4 Score: 100.138 bits (248), Expect = 1.140e-23
Identity = 54/156 (34.62%), Postives = 83/156 (53.21%), Query Frame = -1
Query:  561 GHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLW 1028
            GH G VR I+ + D    ++ S DR L+IWN++      +L GH   V  V  S    +  S  ED  VK WDLE  K +R   GHTS ++ + + PD   +++ G D+ V+VW + +   +  L GH ++V  V    +   ++SGS DAT ++W
Sbjct:  137 GHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          

HSP 5 Score: 93.5893 bits (231), Expect = 2.321e-21
Identity = 60/218 (27.52%), Postives = 105/218 (48.17%), Query Frame = -1
Query:  282 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXX-XXXXXVSGGNDGTLYFWDWKSGYNFQKL 929
             G L  ++ G    + G+ ++     + + G D +++ WD E  K +     HT  VY L + P  D L++G  D  V++WDM T   VH L GH++ V+ V    +   +IS S+D TV++WD+      + L  H   VR + I       +S S D  ++ ++L     +  ++GH+  +  V  + ++  A+SG  D  +  WD +S    + L
Sbjct:    2 GGPLLRTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSL 219          

HSP 6 Score: 52.373 bits (124), Expect = 1.467e-7
Identity = 27/79 (34.18%), Postives = 42/79 (53.16%), Query Frame = -1
Query:  813 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCW 1049
            K  R + GHT  +  ++ +PD    I+  DD  +K+W++++G+   SL GH   VR V +S     + S  ED T K W
Sbjct:  214 KEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          
BLAST of SMED30025698 vs. Ensembl Nematostella
Match: KATNB1 (Katanin p80 WD40 repeat-containing subunit B1 [Source:UniProtKB/TrEMBL;Acc:A7SV12])

HSP 1 Score: 120.939 bits (302), Expect = 3.464e-29
Identity = 66/201 (32.84%), Postives = 99/201 (49.25%), Query Frame = -1
Query:  453 WKLCRVVSGHTGWVRCISFSPDN-EYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD 1052
            WKL   V+ H   + C+S  P      +TG +DR + +W V    + +SL GH S V  V+ +     V +  +  T+K WDLE  K++R   GH S++  LD HP  D + +G  D+ +++WD+R K  +    GH D V  +R   +   +ISG  D   +LWDL A K  +    H   V     HP      +GS+D
Sbjct:    9 WKLQEFVA-HGSNINCLSLGPSTGRVMVTGGEDRKVNMWAVGQPNVIMSLAGHTSPVECVQFNSGEDLVVAGSQSGTLKIWDLEAAKILRTLTGHKSSIRSLDFHPFGDFVASGSLDTNLKLWDIRRKGCIFTYKGHTDCVNHLRFSPDGRWIISGGEDGAAKLWDLTAGKIINDFKMHTGPVNCAEFHPKEFLLATGSSD 208          

HSP 2 Score: 90.1225 bits (222), Expect = 3.967e-19
Identity = 45/144 (31.25%), Postives = 69/144 (47.92%), Query Frame = -1
Query:  618 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC 1049
            K+ R ++GH   +R + F P  ++  +GS D  LK+W++       +  GH   V  ++ S    ++ S GED   K WDL   K+I  +  HT  V C + HP   LL TG  D  V+ WD+ T     ++S        +RC
Sbjct:   94 KILRTLTGHKSSIRSLDFHPFGDFVASGSLDTNLKLWDIRRKGCIFTYKGHTDCVNHLRFSPDGRWIISGGEDGAAKLWDLTAGKIINDFKMHTGPVNCAEFHPKEFLLATGSSDRTVKYWDLET---FELVSSTSPETHPIRC 234          

HSP 3 Score: 81.6481 bits (200), Expect = 1.892e-16
Identity = 63/242 (26.03%), Postives = 105/242 (43.39%), Query Frame = -1
Query:  120 GEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXX-XXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISW 839
            GED+ V  W + Q  VI    GHTS V C+  +   DL++ G +   +++WD+     +  L+GH+ ++ S+        V SGS D  ++LWD+R          H   V  +   P     +SG  DG  K + L  G+ + + K H   +N      +  +  +G +D T+ +WD ++ +      SP         + I    F      L +   D ++K Y  +     ESFP+ W
Sbjct:   38 GEDRKVNMWAVGQPNVIMSLAGHTSPVECVQFNSGEDLVVAGSQSGTLKIWDLEAAKILRTLTGHKSSIRSLDFHPFGDFVASGSLDTNLKLWDIRRKGCIFTYKGHTDCVNHLRFSPDGRWIISGGEDGAAKLWDLTAGKIINDFKMHTGPVNCAEFHPKEFLLATGSSDRTVKYWDLET-FELVSSTSP-------ETHPIRCIGFHTDGLCLFSGAQD-SLKVYGWEPIKCYESFPLGW 270          

HSP 4 Score: 65.0846 bits (157), Expect = 2.942e-11
Identity = 33/110 (30.00%), Postives = 54/110 (49.09%), Query Frame = -1
Query:  699 GHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSV 1028
            GHT  V  + FSPD  + I+G +D   K+W++  GK+      H   V   +   +   + +   D+TVK WDLE  +++      T  + C+  H D   L +G +DS+
Sbjct:  143 GHTDCVNHLRFSPDGRWIISGGEDGAAKLWDLTAGKIINDFKMHTGPVNCAEFHPKEFLLATGSSDRTVKYWDLETFELVSSTSPETHPIRCIGFHTDGLCLFSGAQDSL 252          
BLAST of SMED30025698 vs. Ensembl Medaka
Match: plrg1 (pleiotropic regulator 1 [Source:NCBI gene;Acc:101163300])

HSP 1 Score: 427.557 bits (1098), Expect = 1.150e-145
Identity = 197/322 (61.18%), Postives = 253/322 (78.57%), Query Frame = -1
Query:   99 WHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1064
            WH PWKL RV+SGH GWVR I+  P N++F+TGS DR +KIW++ +GKL+LSLTGH+S VRGV +S R PY+FSCGEDK VKCWDLE NKVIRHYHGH SAVY LD+HP +D+LMT  RD+  RVWD+RTK NVH L+GH + VA+VRCQ+  P+VI+GSHD+T+RLWDL A KT++ LTNHKK+VR++ +HP    F SGSAD IKQ+  P+G F+QN+ GHN IIN + VN + V VSG ++GT++ WDW++GYNFQ++ +  QPGSLDSE+ I    FD +  RL+T E DKTIK YKED+ ATEES P++W+P I ++
Sbjct:  186 WHPPWKLFRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTIDVLMTCSRDATARVWDIRTKANVHTLTGHTNTVATVRCQAAEPQVITGSHDSTIRLWDLIAGKTRATLTNHKKSVRTLVMHPRQYTFASGSADNIKQWMFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTIHMWDWRTGYNFQRIHAAVQPGSLDSESGIFACVFDHSESRLITAEADKTIKVYKEDETATEESHPVNWKPEILKR 507          
BLAST of SMED30025698 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 132.88 bits (333), Expect = 1.615e-34
Identity = 80/301 (26.58%), Postives = 150/301 (49.83%), Query Frame = -1
Query:  156 VSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1034
            ++GHT  V  + FSP  E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K WD+   K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D  +K +   +G+ ++   GH      +  N +       VSG  D  +Y W+ ++    QKLQ           + ++  +   T   + +  +E DKTIK +K D
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQG--------HTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          

HSP 2 Score: 80.1073 bits (196), Expect = 4.155e-16
Identity = 50/178 (28.09%), Postives = 84/178 (47.19%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D +LL++   D  +++WD+ +   +  L GH + V   +   QSNL  ++SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   34 NYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 209          
BLAST of SMED30025698 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 128.257 bits (321), Expect = 7.468e-33
Identity = 82/303 (27.06%), Postives = 147/303 (48.51%), Query Frame = -1
Query:  156 VSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT-QSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQ---FSLPEGQFMQNMKGHXXXXXXXXXXXXXX----XVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVT--VEGDKTIKFYKED 1034
            ++GHT  V  + FSP  E+  + S D+++KIW   +GK   +++GH  G+  V  S     + S  +DKT+K WD+   K ++   GH++ V+C + +P  +L+++G  D  VR+WD++T   +  L  H D V++V    +   ++S S+D   R+WD  + +  ++++ +    V  V   P   + ++ + D       F     Q ++   GH      +  N +       VSG  D  +Y W+ ++    QKLQ     G  D    ++  +   T   + +  +E DKTIK +K D
Sbjct:   40 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNSSLTFVFFYVNSQCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ-----GHTD---VVISTACHPTENIIASAALENDKTIKLWKSD 334          

HSP 2 Score: 80.1073 bits (196), Expect = 4.478e-16
Identity = 50/178 (28.09%), Postives = 84/178 (47.19%), Query Frame = -1
Query:  405 NGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAV--ASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGI-KQFSLPEGQFMQNM 929
            N  L+ +L GH   V  VK S    ++ S   DK +K W     K  +   GH   +  +    D +LL++   D  +++WD+ +   +  L GH + V   +   QSNL  ++SGS D +VR+WD++  K    L  H   V +V  +      +S S DG+ + +    GQ ++ +
Sbjct:   33 NYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL 208          

HSP 3 Score: 75.0998 bits (183), Expect = 1.878e-14
Identity = 54/254 (21.26%), Postives = 106/254 (41.73%), Query Frame = -1
Query:  432 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWD------MRTKIN---------------------------------------VHILSGHRDAVASVRCQSNLPE---VISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSL 1049
            K  + +SGH   +  +++S D+   ++ SDD+ LKIW+V++GK   +L GH + V     + +   + S   D++V+ WD++  K ++    H+  V  +  + D  L+++   D + R+WD      ++T I+                                       +   +GH++    +    ++     ++SGS D  V +W+L+  +    L  H   V S   HP  +   S + +  K   L
Sbjct:   77 KFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNSSLTFVFFYVNSQCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKL 330          
BLAST of SMED30025698 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 130.568 bits (327), Expect = 2.296e-32
Identity = 93/295 (31.53%), Postives = 152/295 (51.53%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ E  + I   +GHTS V C+ +H     +++G RD+ +RVWD+ T   +H+L GH   VA+VRC Q +   V+SG++D  V++WD         L  H   V S+    I  H +SGS D  I+ + +  G  +  + GH   + +    ++N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F++    ++T   D T+K +
Sbjct:  220 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLHVLMGH---VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGI--HVVSGSLDTSIRVWDVETGNCIHTLTGH-QSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHK-----HQSAVTCLQFNKNF--VITSSDDGTVKLW 495          

HSP 2 Score: 116.316 bits (290), Expect = 2.042e-27
Identity = 82/267 (30.71%), Postives = 133/267 (49.81%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S        I+GS DR LK+WN + G+   +L GH S VR + +  +   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D +V+VWD  T+  +H L GH + V S+  Q +   V+SGS D ++R+WD+        LT H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +           N  ++  +DGT+  WD K+G   + L +    GS
Sbjct:  258 KCLRTLVGHTGGV--WSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL--QFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGS 514          
BLAST of SMED30025698 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 131.339 bits (329), Expect = 3.416e-32
Identity = 93/295 (31.53%), Postives = 152/295 (51.53%), Query Frame = -1
Query:  165 RVVSGHTGWV-RCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRC-QSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 1040
            +V+ GH   V  C+ F  +    ++GSDD  LK+W+   GK   +L GH  GV   ++  R   + S   D+T+K W+ E  + I   +GHTS V C+ +H     +++G RD+ +RVWD+ T   +H+L GH   VA+VRC Q +   V+SG++D  V++WD         L  H   V S+    I  H +SGS D  I+ + +  G  +  + GH   + +    ++N+ VSG  D T+  WD K+G   Q LQ P +      ++++    F++    ++T   D T+K +
Sbjct:  445 KVLKGHDDHVITCLQFCGNR--IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLHVLMGH---VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGI--HVVSGSLDTSIRVWDVETGNCIHTLTGH-QSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHK-----HQSAVTCLQFNKNF--VITSSDDGTVKLW 720          

HSP 2 Score: 115.931 bits (289), Expect = 4.227e-27
Identity = 82/267 (30.71%), Postives = 133/267 (49.81%), Query Frame = -1
Query:  258 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKG--HXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGS 1049
            K  R + GHTG V   S        I+GS DR LK+WN + G+   +L GH S VR + +  +   V S   D T++ WD+E  + +    GH +AV C+    D   +++G  D +V+VWD  T+  +H L GH + V S+  Q +   V+SGS D ++R+WD+        LT H+     + +    +  +SG+AD  +K + +  GQ +Q ++G   +           N  ++  +DGT+  WD K+G   + L +    GS
Sbjct:  483 KCLRTLVGHTGGV--WSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQY--DGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL--QFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGS 739          
BLAST of SMED30025698 vs. Planmine SMEST
Match: SMESG000010494.1 (SMESG000010494.1)

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 444/444 (100.00%), Postives = 444/444 (100.00%), Query Frame = -1
Query:   99 MANQGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHXXXXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 1430
            MANQGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLVVPKKAKTVPKPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHNTIINAVTVNENNVAVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK
Sbjct:    1 MANQGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEYGILLNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLVVPKKAKTVPKPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHNTIINAVTVNENNVAVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARK 444          
BLAST of SMED30025698 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 103.219 bits (256), Expect = 2.057e-23
Identity = 59/195 (30.26%), Postives = 93/195 (47.69%), Query Frame = -1
Query:  453 VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD 1037
            V   HT  VR +  S DN   +TGSDD+ +K+W +   K   SL  H + VR V+ S     + S  +DKT+K WD    + I  +  H   V  L  HP+   + +GG DS V +WD+R    +   + H   V +V    +   +IS S D++++++DL   +    +  H+  +         + F SG AD
Sbjct:   93 VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGAD 287          

HSP 2 Score: 99.7525 bits (247), Expect = 2.630e-22
Identity = 63/240 (26.25%), Postives = 108/240 (45.00%), Query Frame = -1
Query:  315 GHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGHXXXXXXXXXXX-XXXXVSGGNDGTLYFW 1028
            GH   +  + FSP  +   + S D+ +++W        L    H + VR V IS  +  + +  +DKT+K W + + K     + H + V C+    D  L+ +   D  +++WD   +  +H    H   V S+    N   + SG  D+ V +WD+R  K     T+H   V +V  HP  +  +S S D  +K + L EG+ +  ++GH   I     +    +  SGG D  ++ W
Sbjct:   54 GHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          

HSP 3 Score: 89.7373 bits (221), Expect = 6.028e-19
Identity = 75/298 (25.17%), Postives = 123/298 (41.28%), Query Frame = -1
Query:  162 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXXXXXXXX-XXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYK 1049
            KL     GH   V C+ F+P++    +G  D  L IWN           GH   +  VK S     V S   DKTV+ W          +  HT+ V  +D+  D   ++TG  D  ++VW M  +   + L+ H++ V  VR  S+   + S S D T++LWD    +       H   V S+  HP   +  SG  D  +  + +   + +Q+   H + +NAV+     N  +S  +D ++  +D   G     +Q          E  ILG +F    +   +   D  +  ++
Sbjct:    5 KLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQG--------HEGPILGTAFSHCGEMFASGGADHQVFLWQ 294          

HSP 4 Score: 71.633 bits (174), Expect = 4.326e-13
Identity = 49/168 (29.17%), Postives = 77/168 (45.83%), Query Frame = -1
Query:  312 LEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXX-XXXXXXXXXXXXXVSGGNDGTLYFWD 809
            +E  K+  H+ GH   V C+D +P+   L +GG DS + +W+ + +   +   GH DA+ SV+       V S S D TVRLW         V   H   VRSV I       ++GS D  IK + +   +F  ++  H   +      ++  +  S  +D T+  WD
Sbjct:    1 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD 168          

HSP 5 Score: 65.4698 bits (158), Expect = 3.724e-11
Identity = 59/259 (22.78%), Postives = 99/259 (38.22%), Query Frame = -1
Query:  165 VDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG-IKQFSLPEGQFMQNMKGHXX-XXXXXXXXXXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFY 935
            +++ KL++   GH   V  V  +     + S G D  +  W+ +       + GH  A+  +   P   L+ +  RD  VR+W    K    +   H   V SV    +  E+++GS D T+++W +   K    L  HK  VR V          S S D  IK +     + +   + H   + +       +   SGG D  +  WD +     Q   S   P        +   SF  +   L++   D ++K Y
Sbjct:    1 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSP--------VNAVSFHPSGNFLISSSDDSSMKIY 251          

HSP 6 Score: 51.9878 bits (123), Expect = 6.841e-7
Identity = 27/83 (32.53%), Postives = 40/83 (48.19%), Query Frame = -1
Query:  801 KLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQ 1049
            KL +  + HT  V  +SF P   + I+ SDD  +KI+++  G+L  ++ GH   + G   SH      S G D  V  W   Q
Sbjct:  215 KLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQ 297          
BLAST of SMED30025698 vs. Planmine SMEST
Match: SMESG000071691.1 (SMESG000071691.1)

HSP 1 Score: 103.99 bits (258), Expect = 2.090e-23
Identity = 59/205 (28.78%), Postives = 101/205 (49.27%), Query Frame = -1
Query:  438 WKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQF 1052
            +KL   +  H G V CI    + + F T SDD   K+W++D+ ++ ++  GH + V      +    + +   D T+K W+L   + +  + GH+ +++ +D H     L T   D  ++VWD+ +     IL GH D+V SV+   N   +++ S D TV LWD R +     ++ H+ AV S  I+    +  S  A G  +F
Sbjct:  301 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTSDDDSWKLWSLDSLQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKF 505          

HSP 2 Score: 90.8929 bits (224), Expect = 3.992e-19
Identity = 50/163 (30.67%), Postives = 72/163 (44.17%), Query Frame = -1
Query:  540 GHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKT 1028
            GHT WV C +F  D E   T S D  LKIWN+   +   +  GH   +  V      P++ +   DKT+K WDL   K      GH+ +V  +    + ++L+T   D  V +WD R       +SGH+ AV S         + S      ++ WD R   T
Sbjct:  351 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLAT 513          

HSP 3 Score: 57.3806 bits (137), Expect = 1.863e-8
Identity = 45/172 (26.16%), Postives = 74/172 (43.02%), Query Frame = -1
Query:  561 CR-VVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQ-----NKVIRHYHGHTSAVY-----CLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLW 1043
            CR ++ GH+  V  + F  ++   +T S D+ + +W+        S++GH   V    I+ +   + SC     +K WD  Q     N +   +H      Y     C+ M            DSV+++ +  +  NV  L GH D+V S     +   +IS S D TVR+W
Sbjct:  429 CRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAM---------SSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 590          
BLAST of SMED30025698 vs. Planmine SMEST
Match: SMESG000035997.1 (SMESG000035997.1)

HSP 1 Score: 101.679 bits (252), Expect = 3.905e-23
Identity = 67/278 (24.10%), Postives = 119/278 (42.81%), Query Frame = -1
Query:  498 DNSETELINKIKSLNEYGILLNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDENSNQDYNTQLXXXXXXXXXXXPDWHAPWKLCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSV 1331
            DN   E     K   + G L+      +      L ++ ++L I R   + F +PK K+    +D  SN  +  +             DW        V+ GH   + C+ F P    F++GS+D  +KIW+ ++G    +L GH + V+ +        + SC  D  +K WD  +   ++   GH   V  +   P  D L++  RD  +++W++ T   V    GH D V  V+   +   + S S+D +VR+W +   + +     H+  V+ +
Sbjct:   21 DNGYKETYAIFKGEAKIGKLIKNFQDFLKKSGHQLFVYKKKLMIWR---VSFKKPKKKT----HDVISNATFKGR--------KSSSVDWLPRIPARHVLKGHRASITCVRFHPLYNVFVSGSEDATIKIWDYESGDYERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEFTCVKTLSGHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKECKFDFREHEHVVQCI 283          
BLAST of SMED30025698 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.063e-22
Identity = 61/222 (27.48%), Postives = 106/222 (47.75%), Query Frame = -1
Query:  396 LCRVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRH--PYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKI-NVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLR-AAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEGQFMQNMKGH 1046
            L     GHT  V C+ F+P +    TG  D +  +W+V++GK   +L GH + V  ++    H   ++ +   D TV  WD+   + +    GH + +     + D   + T   D  +++WD+R    ++  L+GH D V  V   +   +V S   D TVRLWD++  +K   +   H+  V  V  +P     +S SAD   + ++   G+ +Q ++GH
Sbjct:   47 LYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGH 268          

HSP 2 Score: 84.7297 bits (208), Expect = 6.177e-18
Identity = 78/302 (25.83%), Postives = 132/302 (43.71%), Query Frame = -1
Query:  162 VSGHTGWVRCISFS-PDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHP--DLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLR-AAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADG------IKQFSLPEGQFMQNMKGHXXXXXXXXXX-XXXXXVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILGFSFDRTSQRLVTVEGDKTIKFYK 1034
            + GH   V  I+++ P ++  +TGS D+  K+W+ ++G L  +  GH + V  V+ +     V + G D     WD+E  K + +  GHT+ V  L      +   L+TG  D  V +WD+     V  L GH   +++     +   V + S D ++++WDLR  A+    L  H   V  V    +     S  AD       +K FS P   F    KGH   ++ VT N +  V +S   D +   W+  +G   Q L+           + I   +F+    +++T   D T + ++
Sbjct:    8 LEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIF----KGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHT--------DEIFSCAFNYDGSKIITGSKDNTCRIWQ 297          

HSP 3 Score: 72.4034 bits (176), Expect = 7.983e-14
Identity = 60/215 (27.91%), Postives = 97/215 (45.12%), Query Frame = -1
Query:  306 GKLRLSLTGHVSGVRGVKISHRHPY---VFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQS--NLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSAD-GIKQFSLPEG-QFMQNMKGHX-XXXXXXXXXXXXXXVSGGNDGTLYFWDWK 926
            G    +L GH + V    I++  P+   + +   DKT K W      +   + GHT+ V C+  +P   L+ TGG D++  +WD+ +   V  L GH   V S++     N   +I+GS D TV LWD+   +  S L  H   + +   +    +  + S D  IK + L  G + +  + GH   +++    N      S G D T+  WD K
Sbjct:    2 GTTLFTLEGHKNVVY--SIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVK 214          
The following BLAST results are available for this feature:
BLAST of SMED30025698 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLRG11.785e-14661.49pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HG... [more]
PLRG14.844e-14661.49pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HG... [more]
PLRG16.849e-7367.32pleiotropic regulator 1 [Source:HGNC Symbol;Acc:HG... [more]
WDR59.751e-3527.15WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12... [more]
FBXW75.173e-3231.53F-box and WD repeat domain containing 7 [Source:HG... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plrg-14.214e-14350.46PLeiotropic ReGulator (Vertebrate) homolog [Sourc... [more]
plrg-11.017e-14248.16PLeiotropic ReGulator (Vertebrate) homolog [Sourc... [more]
plrg-11.017e-14248.16PLeiotropic ReGulator (Vertebrate) homolog [Sourc... [more]
plrg-11.017e-14248.16PLeiotropic ReGulator (Vertebrate) homolog [Sourc... [more]
wdr-5.19.711e-3127.51WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tango43.468e-16150.21gene:FBgn0030365 transcript:FBtr0073622[more]
wds3.365e-3527.57gene:FBgn0040066 transcript:FBtr0308566[more]
wds3.365e-3527.57gene:FBgn0040066 transcript:FBtr0070438[more]
ago2.673e-2929.84gene:FBgn0041171 transcript:FBtr0073246[more]
ago2.673e-2929.84gene:FBgn0041171 transcript:FBtr0073245[more]
back to top
BLAST of SMED30025698 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plrg19.537e-14947.12pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
plrg14.864e-14847.11pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
wdr51.599e-3426.49WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
fbxw73.884e-3231.53F-box and WD repeat domain containing 7 [Source:ZF... [more]
CR381538.14.425e-3231.53F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stam1.653e-14745.86signal transducing adaptor molecule [Source:Xenbas... [more]
stam2.996e-14459.44signal transducing adaptor molecule [Source:Xenbas... [more]
stam6.784e-14459.63signal transducing adaptor molecule [Source:Xenbas... [more]
stam9.781e-14459.63signal transducing adaptor molecule [Source:Xenbas... [more]
stam1.131e-14259.63signal transducing adaptor molecule [Source:Xenbas... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plrg16.593e-14861.49pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI... [more]
Plrg11.365e-14761.49pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI... [more]
Plrg13.022e-9945.09pleiotropic regulator 1 [Source:MGI Symbol;Acc:MGI... [more]
Wdr56.694e-3527.15WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
Fbxw71.625e-3231.53F-box and WD-40 domain protein 7 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30025698 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KID6|PLRG1_BOVIN5.428e-14846.94Pleiotropic regulator 1 OS=Bos taurus OX=9913 GN=P... [more]
sp|Q922V4|PLRG1_MOUSE9.551e-14761.49Pleiotropic regulator 1 OS=Mus musculus OX=10090 G... [more]
sp|Q9WUC8|PLRG1_RAT4.870e-14661.18Pleiotropic regulator 1 OS=Rattus norvegicus OX=10... [more]
sp|O43660|PLRG1_HUMAN2.326e-14561.49Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN... [more]
sp|Q4WT34|PRP46_ASPFU1.553e-14260.99Pre-mRNA-splicing factor prp46 OS=Neosartorya fumi... [more]
back to top
BLAST of SMED30025698 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LGE47.036e-17156.63WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A074ZFR43.081e-17056.85WD domain, G-beta repeat protein OS=Opisthorchis v... [more]
A0A0X3NVG02.147e-16955.48Pleiotropic regulator 1 OS=Schistocephalus solidus... [more]
A0A5K3EML06.614e-16955.21Uncharacterized protein OS=Mesocestoides corti OX=... [more]
C1LEU29.491e-16856.69Pleiotropic regulator 1 OS=Schistosoma japonicum O... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plrg11.362e-14460.56pleiotropic regulator 1 [Source:NCBI gene;Acc:1030... [more]
plrg12.665e-14460.56pleiotropic regulator 1 [Source:NCBI gene;Acc:1030... [more]
wdr51.674e-3427.15WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007963.22.306e-3427.72WD repeat-containing protein 5-like [Source:NCBI g... [more]
fbxw76.340e-3231.53F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plrg13.515e-14359.63pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000008862.18.876e-3431.53pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
pafah1b1b7.555e-2624.52platelet-activating factor acetylhydrolase 1b, reg... [more]
POC1A2.126e-2430.77POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
WDR863.988e-2227.08WD repeat domain 86 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP466.245e-11148.77Member of the NineTeen Complex (NTC); this complex... [more]
TAF59.566e-2730.30Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
COP15.289e-2630.04Alpha subunit of COPI vesicle coatomer complex; co... [more]
CDC45.006e-2229.20F-box protein required for both the G1/S and G2/M ... [more]
SEC273.042e-2130.10Essential beta'-coat protein of the COPI coatomer;... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333441.250e-14645.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332971.733e-3226.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423061.241e-3132.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497673.105e-3031.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
KATNB13.464e-2932.84Katanin p80 WD40 repeat-containing subunit B1 [So... [more]
back to top
BLAST of SMED30025698 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plrg11.150e-14561.18pleiotropic regulator 1 [Source:NCBI gene;Acc:1011... [more]
wdr51.615e-3426.58WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
wdr57.468e-3327.06WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
fbxw72.296e-3231.53F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw73.416e-3231.53F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of SMED30025698 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010494.10.000e+0100.00SMESG000010494.1[more]
SMESG000024482.12.057e-2330.26SMESG000024482.1[more]
SMESG000071691.12.090e-2328.78SMESG000071691.1[more]
SMESG000035997.13.905e-2324.10SMESG000035997.1[more]
SMESG000008519.11.063e-2227.48SMESG000008519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025698 ID=SMED30025698|Name=SMED30025698|organism=Schmidtea mediterranea sexual|type=transcript|length=1475bp
CCCAAATTAGGAATTTATTAACCGATAAACAAAAAGGAGCAATCAAATCA
ATAAAAACAAAAAAGTCAACAAAAATTACATAGAAATCAATACAAATTTT
TCCTAGCAATATTTGGTCTCCAGGAAATCGGAAAGCTCTCCTCGGTCGCT
TCATCGTCCTCCTTGTAGAACTTTATTGTTTTGTCTCCTTCAACAGTGAC
CAATCGCTGGCTGGTTCTGTCGAATGAGAATCCCAATATCGAATTTTCCG
AATCAAGGCTGCCCGGCTGCGGGGGCGATTGGAGTTTCTGGAAATTATAA
CCGGATTTCCAGTCCCAGAAATAGAGCGTTCCATCGTTACCGCCGGACAC
GGCGACATTGTTCTCATTGACAGTGACGGCGTTGATTATCGTGTTGTGGC
CTTTCATGTTCTGCATAAACTGGCCTTCCGGTAGCGAGAATTGCTTGATC
CCGTCCGCTGATCCCGACATGAAATGATCGGTGATCGGATGGATGAAAAC
CGATCGGACGGCTTTTTTGTGATTGGTCAATACAGATTGAGTTTTGGCCG
CTCGCAAATCCCACAAGCGAACTGTTGCATCGTGGGAACCGGAAATTACT
TCCGGGAGATTTGATTGGCACCTCACAGACGCTACGGCATCTCGATGGCC
AGACAAAATGTGAACATTGATTTTTGTGCGCATATCCCACACGCGGACAA
CGCTATCTCGTCCACCGGTCATTAATAAATCCAGATCGGGATGCATATCG
AGACAATAGACGGCAGAAGTGTGTCCATGATAATGACGAATGACTTTATT
CTGCTCTAAATCCCAGCATTTAACGGTTTTATCTTCACCACAACTGAATA
CATAGGGATGTCGGTGACTGATTTTGACACCACGGACTCCACTAACATGA
CCAGTTAGAGATAAGCGTAATTTCCCATTATCGACATTCCATATTTTAAG
CATTCGGTCATCAGATCCAGTGATAAAGTATTCATTGTCGGGACTGAATG
AAATACATCGTACCCAACCGGTATGGCCACTAACAACTCTACATAATTTC
CATGGAGCATGCCAATCGGGTTTTGGAACGGTTTTAGCTTTTTTAGGAAC
AACTAATTGGGTGTTATAATCTTGATTAGAATTTTCATCATTATTTATAA
AAATAGATTTTGCTTTGGGCTCTGGAAATGGCAATACGCGCTTTCTGCTT
ATAGCTAGCTCTCGATTAAAAATACTTAGATCAGTAGACGGAGCGGTTAT
GTTGGGATTATTGCCATTTAAAAGAATACCATATTCATTCAAAGATTTAA
TTTTATTAATCAATTCTGTCTCAGAATTATCAGACTCTAAAATTGCTCCG
TGGTATGACTCATAAGAATCATGACTTCTTTTTAAAGACCTAAAACATAA
AGTATGGAGAGAATGACCTTGATTTGCCATTAAACAAATTATGATAAAAT
AATTATTAAATATTTAAACAAAAAA
back to top

protein sequence of SMED30025698-orf-1

>SMED30025698-orf-1 ID=SMED30025698-orf-1|Name=SMED30025698-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MANQGHSLHTLCFRSLKRSHDSYESYHGAILESDNSETELINKIKSLNEY
GILLNGNNPNITAPSTDLSIFNRELAISRKRVLPFPEPKAKSIFINNDEN
SNQDYNTQLVVPKKAKTVPKPDWHAPWKLCRVVSGHTGWVRCISFSPDNE
YFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGED
KTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDM
RTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSV
LTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQFMQNMKGHNTIIN
AVTVNENNVAVSGGNDGTLYFWDWKSGYNFQKLQSPPQPGSLDSENSILG
FSFDRTSQRLVTVEGDKTIKFYKEDDEATEESFPISWRPNIARKNLY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 278..292
score: 41.32
coord: 152..166
score: 32.17
coord: 236..250
score: 34.48
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 294..332
e-value: 0.25
score: 20.4
coord: 252..291
e-value: 4.7E-6
score: 36.1
coord: 385..423
e-value: 3.1
score: 13.9
coord: 335..373
e-value: 6.6E-5
score: 32.3
coord: 168..207
e-value: 1.9E-7
score: 40.7
coord: 126..165
e-value: 5.2E-12
score: 55.9
coord: 210..249
e-value: 6.6E-10
score: 48.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 212..249
e-value: 1.3E-8
score: 35.3
coord: 128..165
e-value: 1.2E-9
score: 38.7
coord: 255..291
e-value: 9.4E-5
score: 23.1
coord: 337..373
e-value: 0.0042
score: 17.9
coord: 171..207
e-value: 2.5E-6
score: 28.1
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 217..258
score: 15.989
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 342..382
score: 11.812
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 259..300
score: 14.519
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 175..216
score: 12.514
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 133..174
score: 17.426
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 130..425
e-value: 6.8E-109
score: 365.2
NoneNo IPR availablePANTHERPTHR19923WD40 REPEAT PROTEINPRL1/PRL2-RELATEDcoord: 89..444
NoneNo IPR availableCDDcd00200WD40coord: 129..423
e-value: 1.49362E-86
score: 264.197
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 278..292
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 236..250
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 133..432
score: 57.027
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 123..423