Carbonic anhydrase

Overview
NameCarbonic anhydrase
Smed IDSMED30025696
Length (bp)1026
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Carbonic anhydrase (SMED30025696) t-SNE clustered cells

Violin plots show distribution of expression levels for Carbonic anhydrase (SMED30025696) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Carbonic anhydrase (SMED30025696) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Carbonic anhydrase (SMED30025696) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025696

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025696SMESG000035022.1 dd_Smed_v4_10041_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025696SMESG000035022.1 dd_Smed_v4_10041_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025696SMESG000035022.1 dd_Smed_v4_10041_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025696SMESG000035022.1 dd_Smed_v4_10041_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025696SMESG000035022.1 dd_Smed_v6_10041_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025696SMESG000035022.1 dd_Smed_v4_10041_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-1 (Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q22460])

HSP 1 Score: 134.806 bits (338), Expect = 3.828e-37
Identity = 91/262 (34.73%), Postives = 144/262 (54.96%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSFDLHKVREPEVND----YILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPY-NRGSH---EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNK-PDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            MNKI+  +I+++   R+  DL K  E   N+     ++F+C+D R++P  FT+  VG ++VVRNAGN +P   N G+     +++E  A+ELAVKR GI+ I++ GHSDC+A+  L   ++ P   +  S  P+  WV++ G  S  +    L      +KF+ +  P+    A  D  D     D LSQIN LQQ  N+ +  FL+  L    L IH +W ++   GED   +LF  +K++F+ I E+   +L  +L+  Y
Sbjct:    1 MNKILRGVIQFRNTIRK--DLVKQFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSVNTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTS--PMDHWVRRNGFASVKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEFLKEYLESGRLHIHGMWFDIYK-GED---YLFSKDKKRFVVIDEKTVTDLLAELNARY 254          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-1 (Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q22460])

HSP 1 Score: 134.806 bits (338), Expect = 3.828e-37
Identity = 91/262 (34.73%), Postives = 144/262 (54.96%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSFDLHKVREPEVND----YILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPY-NRGSH---EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNK-PDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            MNKI+  +I+++   R+  DL K  E   N+     ++F+C+D R++P  FT+  VG ++VVRNAGN +P   N G+     +++E  A+ELAVKR GI+ I++ GHSDC+A+  L   ++ P   +  S  P+  WV++ G  S  +    L      +KF+ +  P+    A  D  D     D LSQIN LQQ  N+ +  FL+  L    L IH +W ++   GED   +LF  +K++F+ I E+   +L  +L+  Y
Sbjct:    1 MNKILRGVIQFRNTIRK--DLVKQFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSVNTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTS--PMDHWVRRNGFASVKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEFLKEYLESGRLHIHGMWFDIYK-GED---YLFSKDKKRFVVIDEKTVTDLLAELNARY 254          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-2 (Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D3NQB0])

HSP 1 Score: 122.479 bits (306), Expect = 1.031e-32
Identity = 82/259 (31.66%), Postives = 143/259 (55.21%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSF--DLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVP---PYNRGSHEIS--SEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNK-PDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKH-PLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 800
            + +I++ +I++++  R+       ++R+      + F+C+D R++P   T   VG ++VVRN+GN +P    Y    +E+S  +E  A+ELAVKR  I  +I+ GHSDC+A+  L N +K P + + +S  P+  W+++ G  S  K +  L +    P++F +   P     A  D  DK    D LSQIN LQQ ENVA+  FL+  L+  ++ +H +W ++   GE   + +F    ++F+ + E   EEL  +++
Sbjct:    4 LERILNGVIRFRQTVRKDLVKQFERIRDNPHPTAVFFTCMDSRMLPARITSSQVGDMFVVRNSGNMIPHANNYGPSGYEVSVTTEPAALELAVKRGKINHVIVCGHSDCKAINTLYNLHKCPKSFDPES--PMDHWLRRHGFNSIRKLEKRLADKNAGPIEF-VSDNPLFSFSAVIDPEDKLNVEDKLSQINTLQQLENVASHGFLKEFLVSQTVDLHAMWFDI-YTGE---MHMFSKPNKQFVLVDESNVEELIDEVE 255          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-2 (Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D3NQB0])

HSP 1 Score: 105.145 bits (261), Expect = 8.350e-26
Identity = 84/304 (27.63%), Postives = 145/304 (47.70%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSF--DLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYN-------RG-----------------------------------------SHEIS--SEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNK-PDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKH-PLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 800
            + +I++ +I++++  R+       ++R+      + F+C+D R++P   T   VG ++VVRN+GN +P  N       RG                                          +E+S  +E  A+ELAVKR  I  +I+ GHSDC+A+  L N +K P + + +S  P+  W+++ G  S  K +  L +    P++F +   P     A  D  DK    D LSQIN LQQ ENVA+  FL+  L+  ++ +H +W ++   GE   + +F    ++F+ + E   EEL  +++
Sbjct:    4 LERILNGVIRFRQTVRKDLVKQFERIRDNPHPTAVFFTCMDSRMLPARITSSQVGDMFVVRNSGNMIPHANNYGKILRRGDTTGKENREKENWKPRPFLPPETPRREDLVEKVIYCAKSPSGYEVSVTTEPAALELAVKRGKINHVIVCGHSDCKAINTLYNLHKCPKSFDPES--PMDHWLRRHGFNSIRKLEKRLADKNAGPIEF-VSDNPLFSFSAVIDPEDKLNVEDKLSQINTLQQLENVASHGFLKEFLVSQTVDLHAMWFDI-YTGE---MHMFSKPNKQFVLVDESNVEELIDEVE 300          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-2 (Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D3NQB0])

HSP 1 Score: 97.8265 bits (242), Expect = 4.578e-24
Identity = 70/203 (34.48%), Postives = 113/203 (55.67%), Query Frame = 3
Query:  219 LYVVRNAGNFVPP---YNRGSHEIS--SEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNK-PDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKH-PLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 800
            ++VVRN+GN +P    Y    +E+S  +E  A+ELAVKR  I  +I+ GHSDC+A+  L N +K P + + +S  P+  W+++ G  S  K +  L +    P++F +   P     A  D  DK    D LSQIN LQQ ENVA+  FL+  L+  ++ +H +W ++   GE   + +F    ++F+ + E   EEL  +++
Sbjct:    1 MFVVRNSGNMIPHANNYGPSGYEVSVTTEPAALELAVKRGKINHVIVCGHSDCKAINTLYNLHKCPKSFDPES--PMDHWLRRHGFNSIRKLEKRLADKNAGPIEF-VSDNPLFSFSAVIDPEDKLNVEDKLSQINTLQQLENVASHGFLKEFLVSQTVDLHAMWFDI-YTGE---MHMFSKPNKQFVLVDESNVEELIDEVE 196          
BLAST of Carbonic anhydrase vs. Ensembl Fly
Match: CAHbeta (gene:FBgn0037646 transcript:FBtr0081958)

HSP 1 Score: 135.191 bits (339), Expect = 2.336e-37
Identity = 87/259 (33.59%), Postives = 135/259 (52.12%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSF--DLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSHE-ISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPD--TEECKSHGPLSQWVKKFGRESWVKFQMFL-KNPKHPLKFQLKPPPTPPDLAYFDD--KFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            M +I+  I++Y+   R+    +  KVR+      + F+C+D R+IP  +T   VG ++VVRNAGN +P       E  S E  A+EL      I+ II+ GHSDC+AM  L     PD  ++  +   PL  W+      S  +FQ +     K PL F     P    +AY D+  KF   D LSQIN LQQ  N+A++ FL++ L  + L IH LW ++   G+   ++ F    ++FL + E+  + L++++  FY
Sbjct:    1 MERILRGIMRYRNTTREQMVKEFQKVRDNPEPKAVFFTCMDSRMIPTRYTDTHVGDMFVVRNAGNLIPHAQHFQDEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLSPLRSWLCTHANTSLERFQEWRDAGMKDPLIFS-SETPLRRFVAYIDEEQKFALEDKLSQINTLQQMSNIASYGFLKARLESHDLHIHALWFDI-YTGD---IYYFSRGAKRFLPVDEDTVDRLSEEVRRFY 254          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|A8XKV0|BCA1_CAEBR (Beta carbonic anhydrase 1 OS=Caenorhabditis briggsae OX=6238 GN=bca-1 PE=3 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.000e-37
Identity = 91/260 (35.00%), Postives = 146/260 (56.15%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSFDLHKVREPE-VNDY-----ILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPY-NRGSH---EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 800
            MN+II  +I+Y     Q      V++ E V+D+     ++F+C+D R++P  FT+  VG ++VVRNAGN +P   N GS+    I++E  A+ELAVKR  I+ +++ GHSDC+AM  L   ++  T+   S  P+ QW+++ G ES  K    L      +KF+ +  P+    A  D  +K+   D LSQIN LQQ  N++T  FL+  L   +L +H  W  +     D  +FLF  ++++F+ I E+    L+ +L+
Sbjct:    1 MNRIIRGVIQYN----QKIKAGLVKQFEHVSDHPNPTAVMFTCMDSRMLPTRFTQSAVGDMFVVRNAGNMIPAAPNYGSYSEVSINTEPAALELAVKRGKIRHVVVCGHSDCKAMNTLYQLHQCPTKFDVS-SPMDQWLRRNGFESMKKLNERLHIGPKTMKFESEVAPSQSFEAIIDPMEKWSAEDKLSQINVLQQIMNISTHEFLKDYLEAGNLHLHGAWFNI----YDGEVFLFSKDRKRFVVIDEKTVPSLSAELE 251          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|Q22460|BCA1_CAEEL (Beta carbonic anhydrase 1 OS=Caenorhabditis elegans OX=6239 GN=bca-1 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.869e-36
Identity = 91/262 (34.73%), Postives = 144/262 (54.96%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSFDLHKVREPEVND----YILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPY-NRGSH---EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNK-PDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            MNKI+  +I+++   R+  DL K  E   N+     ++F+C+D R++P  FT+  VG ++VVRNAGN +P   N G+     +++E  A+ELAVKR GI+ I++ GHSDC+A+  L   ++ P   +  S  P+  WV++ G  S  +    L      +KF+ +  P+    A  D  D     D LSQIN LQQ  N+ +  FL+  L    L IH +W ++   GED   +LF  +K++F+ I E+   +L  +L+  Y
Sbjct:    1 MNKILRGVIQFRNTIRK--DLVKQFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSVNTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTS--PMDHWVRRNGFASVKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEFLKEYLESGRLHIHGMWFDIYK-GED---YLFSKDKKRFVVIDEKTVTDLLAELNARY 254          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|Q9ZN54|CYNT_HELPJ (Carbonic anhydrase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=cynT PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 8.238e-17
Identity = 53/176 (30.11%), Postives = 90/176 (51.14%), Query Frame = 3
Query:  153 ILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGP-LSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQ-INCLQQSENVATFPFLRSELLDNSLKI 674
            +  SC+D R++PN  T    G LYV+RN GN +PP       +S+ A ++E A+   G++++II GHSDC A     + +    E  K+  P ++ W++            FL+    P+K +LK  P       F + F K   L++ +N   Q  N+ ++ F++  +++N LKI
Sbjct:   34 LFISCVDSRVVPNLITGTQPGELYVIRNMGNVIPPKTSYKESLSTIA-SVEYAIAHVGVQNLIICGHSDCGA---CGSIHLIHDETTKAKTPYIANWIQ------------FLE----PIKEELKNHPQ------FSNHFAKRSWLTERLNARLQLNNLLSYDFIQERVINNELKI 183          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|P27134|CYNT_SYNE7 (Carbonic anhydrase OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=icfA PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.691e-14
Identity = 51/174 (29.31%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  153 ILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKI 674
            +  +C D RI PN  T+  +G L+V+RNAGN +PP+   +     E  +IE A+    I+ +++ GHS C AM+ L   N     + +   PL   V  + + +    ++ L N                   Y  D    ++IL   N L Q EN+ T+P +RS L    L+I
Sbjct:   35 LFITCSDSRIDPNLITQSGMGELFVIRNAGNLIPPFGAAN---GGEGASIEYAIAALNIEHVVVCGHSHCGAMKGLLKLN-----QLQEDMPL---VYDWLQHAQATRRLVLDNYS----------------GYETDDL--VEILVAENVLTQIENLKTYPIVRSRLFQGKLQI 179          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|O24855|CYNT_HELPY (Carbonic anhydrase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=cynT PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.154e-13
Identity = 53/176 (30.11%), Postives = 86/176 (48.86%), Query Frame = 3
Query:  153 ILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGP-LSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQ-INCLQQSENVATFPFLRSELLDNSLKI 674
            +  SC+D R++PN  T    G LYV+ N GN  PP       +S+ A +IE A+   G++++II GHSDC A     + +    E  K+  P ++ W++            FL+    P+K +LK  P       F + F K   L++ +N   Q  N+ ++ F++ +   N LKI
Sbjct:   34 LFISCVDSRVVPNLITGTKPGELYVICNMGNVNPPKTSYKESLSTIA-SIEYAIAHVGVQNLIICGHSDCGA---CGSVHLIHDETTKAKTPYIANWIQ------------FLE----PVKEELKNHPQ------FSNHFAKRSWLTERLNARLQLNNLLSYDFIQEKASKNELKI 183          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A0L8IE68 (Carbonic anhydrase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22017599mg PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.416e-40
Identity = 86/255 (33.73%), Postives = 144/255 (56.47%), Query Frame = 3
Query:   48 IRKMNKIIHRIIKYQKIGRQSFDLH--KVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGS-HEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHG--PLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYF-DDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKD 794
            ++ + KI+  IIKYQ   +    L+   + E    +++  SCID R++P+ FTK+  G  Y+VRNAGN  PP +  + + +++EAGAIE+A     ++ I + GHSDC+AM  L +       +C +H   PL  W+KK+G  S  KF         PL FQ +       +    ++KFP  D LSQ+NCLQQ +++ATFP L  +L  N +++H +W ++        +F+F  ++++F++IT+    +L ++
Sbjct:    1 MKGLEKILRGIIKYQITDKVRVKLNPQNIIEYPTPNFLFISCIDNRVLPSQFTKIDCGDAYIVRNAGNLFPPRDAITFNTVTAEAGAIEVACHLNNVRHIFVCGHSDCKAMNLLFSLK----NQCHTHAGTPLQMWLKKYGVASVRKFDQLDSKFVGPLTFQGRFSQLNFQVNIDPENKFPIEDKLSQVNCLQQLQHIATFPILHDKLSKNQIRLHAIWIDVRT----GNVFIFSRDEKQFVEITDRNYLQLVRE 247          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A2S1PHN3 (Carbonic anhydrase OS=Palaemon carinicauda OX=392227 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.992e-40
Identity = 92/264 (34.85%), Postives = 147/264 (55.68%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSFDLHKVREPEVN------DYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSH-EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYL---SNSNKPDTEECKSHGPLSQWVKKFGRESWVKF-QMFLKNPKHPLKFQLKPPPTPPDLAYFD--DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            M++I+  ++KY    RQ++    V++ EV         + F+C+D R++P  FT+  VG +++VRNAGN VP  N   H EI++E  A+EL     GI+ +I+ GHSDC+AM  L    NS++   E  K H PL  W+ + G  S  K+ Q+ + + + PL FQ    P    +AY D  DKF + D LSQ+N LQQ +N+A++ F+R  L+   + IH LW ++        ++ F   ++KF+ ++E   E L  +   +Y
Sbjct:    3 MSRILLGVMKY----RQNYRAGMVKQFEVVRDDPHPKAVFFTCMDSRMLPTRFTQTNVGDMFIVRNAGNLVPHANLSGHEEITTEPAALELGCVINGIRHVIVCGHSDCKAMNMLHLMRNSDRTSQEIIK-HSPLKAWLVRHGHSSIAKYAQLEVADFQAPLIFQ-AGTPMRRFVAYIDPEDKFNEEDKLSQVNTLQQLQNIASYNFMRDGLVRGRVYIHALWFDIYT----GDIYYFSRQQKKFVDVSENNIERLLDEAKQYY 256          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A0C5DP84 (Carbonic anhydrase OS=Cherax cainii OX=223846 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 7.747e-39
Identity = 89/259 (34.36%), Postives = 140/259 (54.05%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSF--DLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSH-EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPD--TEECKSHGPLSQWVKKFGRESWVKF-QMFLKNPKHPLKFQLKPPPTPPDLAYF--DDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            M +I+  ++KY+   R+        VR+      + F+C+D R++P  FT+  VG +++VRNAGN VP  N   H EI++E  A+EL     GIK +I+ GHSDC+AM  L      D   +E     PL  W+ + G  S  KF Q+ L N + PL FQ +  P    +AY   D+KF + D LSQ+N LQQ +N+A++ F+R  L    + IH LW ++        ++ F   ++ F+ + E   E+L +++  +Y
Sbjct:    3 MYRILQGVMKYRHTQREVMVRQFEVVRDDPHPKAVFFTCMDSRMLPTRFTQTNVGDMFIVRNAGNLVPHANLCGHEEITTEPAALELGCVINGIKHVIVCGHSDCKAMNMLHMMRNSDRTLQEMLKLSPLKAWLMRHGHSSAGKFAQLELSNFQAPLVFQAE-TPMRRFIAYIDPDNKFSEEDKLSQVNTLQQLQNIASYNFMREGLTRGRVYIHALWFDIYT----GDIYYFSRQQKMFVDVNENNMEKLEEEILKYY 256          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A0C5DEX8 (Carbonic anhydrase OS=Cherax destructor OX=6723 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 8.893e-39
Identity = 89/259 (34.36%), Postives = 141/259 (54.44%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSF--DLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSH-EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPD--TEECKSHGPLSQWVKKFGRESWVKF-QMFLKNPKHPLKFQLKPPPTPPDLAYF--DDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            M +I+  ++KY++  R+        VR+      + F+C+D R++P  FT+  VG +++VRNAGN VP  N   H EI++E  A+EL     GIK +I+ GHSDC+AM  L      D   +E     PL  W+ + G  S  KF Q+ L N + PL FQ +  P    +AY   D+KF + D LSQ+N LQQ +N+A++ F+R  L    + IH LW ++        ++ F   ++ F+ + E   E+L +++  +Y
Sbjct:    3 MYRILQGVMKYRQTHREVMVRQFEVVRDDPHPKAVFFTCMDSRMLPTRFTETNVGDMFIVRNAGNLVPHANLCGHEEITTEPAALELGCVINGIKHVIVCGHSDCKAMNMLHMMRNSDRTLQEMLKLSPLKAWLMRHGHSSAGKFAQLELSNFQAPLVFQAE-TPMRRFIAYIDPDNKFSEEDKLSQVNTLQQLQNIASYNFMRDGLTRGRVYIHALWFDIYT----GDIYYFSRQQKMFVDVNENNMEKLEEEVLKYY 256          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A0A0VGR7 (Carbonic anhydrase OS=Cherax quadricarinatus OX=27406 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.222e-38
Identity = 90/259 (34.75%), Postives = 142/259 (54.83%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSF--DLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSH-EISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPD--TEECKSHGPLSQWVKKFGRESWVKF-QMFLKNPKHPLKFQLKPPPTPPDLAYF--DDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*FY 809
            M +I+  ++KY+   R+        VR+      + F+C+D R++P  FT+  VG +++VRNAGN VP  N   H EI++E  A+EL     GIK +I+ GHSDC+AM  L      D   +E     PL  W+ + G  S  KF Q+ L N + PL FQ +  P    +AY   D+KF + D LSQ+N LQQ +N+A++ F+R  L    + IH LW ++   G+   ++ F   ++ F+ + E   E+L +++  +Y
Sbjct:    1 MYRILQGVMKYRHTQREVMVRQFEVVRDDPHPKAVFFTCMDSRMLPTRFTQTNVGDMFIVRNAGNLVPHANLCGHEEITTEPAALELGCVINGIKHVIVCGHSDCKAMNMLHMMRNSDRTLQEMLKLSPLKAWLMRHGHSSAGKFAQLELSNFQAPLVFQAE-TPMRRFIAYIDPDNKFSEEDKLSQVNTLQQLQNIASYNFMRDGLTRGRVYIHALWFDI-YTGD---IYYFSRQQKMFVDVNENNMEKLEEEVLKYY 254          
BLAST of Carbonic anhydrase vs. Ensembl Nematostella
Match: EDO40556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S717])

HSP 1 Score: 110.923 bits (276), Expect = 9.169e-29
Identity = 68/255 (26.67%), Postives = 136/255 (53.33%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSF--DLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYN-RGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYL-SNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLK--FQLKPPPTPPDLAYFD-DKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 800
            M KI+  +++++ + R S    L +V E      +L +C+D RI+P  +     G ++VVR AGN +P     G     SE  A+++A++   ++++++ GHS+C+ M +L S+ ++ D      + P   W+KK G  S  +F+    + +  +K  F+      P ++   + +K   +D LSQ+N LQQ  N+ +FPF+ + L   +L ++ LW ++    ++  +++F   ++KF+ I ++    L  ++D
Sbjct:    1 MEKILQGVVRFRHVLRPSLLPSLREVAEKVAPKTVLVACVDCRIMPETYMSSEPGDMFVVRTAGNLLPHAKLYGDVGSCSELAALQMAIQEGKVENVVVCGHSNCKGMTFLLSHDSRTDNH----YIP---WLKKTGASSLTRFEKVDMSQEGGVKLLFEDATGGEPMEVTIDEGNKLDSVDKLSQVNVLQQLHNLKSFPFISNPLSKGALNLYGLWFDI----KEGEMYMFSRKQKKFVLINKDTVNNLCSEVD 244          
BLAST of Carbonic anhydrase vs. Planmine SMEST
Match: SMESG000035022.1 (SMESG000035022.1)

HSP 1 Score: 512.686 bits (1319), Expect = 0.000e+0
Identity = 248/248 (100.00%), Postives = 248/248 (100.00%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSFDLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 800
            MNKIIHRIIKYQKIGRQSFDLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD
Sbjct:    1 MNKIIHRIIKYQKIGRQSFDLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPYNRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 248          
BLAST of Carbonic anhydrase vs. Planmine SMEST
Match: SMESG000035019.1 (SMESG000035019.1)

HSP 1 Score: 319.316 bits (817), Expect = 2.158e-109
Identity = 154/249 (61.85%), Postives = 194/249 (77.91%), Query Frame = 3
Query:   57 MNKIIHRIIKYQKIGRQSFDLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPY-NRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD 800
            MN+IIHRI+ +QK      D     + E++DYI+ SCIDKRIIPNDFTKVP+GHLYVVRNAGNFVP Y +    EISSE GAIELAV  + IKDIIISGHSDC+AM++LS  N PD+ E  S GPLSQW +K+G+ESW K+Q +L++   P++FQLKP P+PP+ AY D   P LD LSQINCLQQ+ENVATF FLR +LL++ LK+HT+WKE+++  +DPTL+LFD++ EKFLKIT+E S+ L  DLD
Sbjct:    1 MNEIIHRIVNFQK---HVSDSEAGDKEEISDYIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKITDESSDHLIHDLD 246          
The following BLAST results are available for this feature:
BLAST of Carbonic anhydrase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bca-13.828e-3734.73Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss... [more]
bca-13.828e-3734.73Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss... [more]
bca-21.031e-3231.66Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D... [more]
bca-28.350e-2627.63Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D... [more]
bca-24.578e-2434.48Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D... [more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CAHbeta2.336e-3733.59gene:FBgn0037646 transcript:FBtr0081958[more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8XKV0|BCA1_CAEBR1.000e-3735.00Beta carbonic anhydrase 1 OS=Caenorhabditis briggs... [more]
sp|Q22460|BCA1_CAEEL4.869e-3634.73Beta carbonic anhydrase 1 OS=Caenorhabditis elegan... [more]
sp|Q9ZN54|CYNT_HELPJ8.238e-1730.11Carbonic anhydrase OS=Helicobacter pylori (strain ... [more]
sp|P27134|CYNT_SYNE74.691e-1429.31Carbonic anhydrase OS=Synechococcus elongatus (str... [more]
sp|O24855|CYNT_HELPY1.154e-1330.11Carbonic anhydrase OS=Helicobacter pylori (strain ... [more]
back to top
BLAST of Carbonic anhydrase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8IE684.416e-4033.73Carbonic anhydrase OS=Octopus bimaculoides OX=3765... [more]
A0A2S1PHN35.992e-4034.85Carbonic anhydrase OS=Palaemon carinicauda OX=3922... [more]
A0A0C5DP847.747e-3934.36Carbonic anhydrase OS=Cherax cainii OX=223846 PE=2... [more]
A0A0C5DEX88.893e-3934.36Carbonic anhydrase OS=Cherax destructor OX=6723 PE... [more]
A0A0A0VGR71.222e-3834.75Carbonic anhydrase OS=Cherax quadricarinatus OX=27... [more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO405569.169e-2926.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000035022.10.000e+0100.00SMESG000035022.1[more]
SMESG000035019.12.158e-10961.85SMESG000035019.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025696 ID=SMED30025696|Name=Carbonic anhydrase|organism=Schmidtea mediterranea sexual|type=transcript|length=1026bp
TTATCAAAATAATGATATCTCAAATAAATTATTATGCACGTGAATAGATT
CGAAAAATGAATAAAATCATTCATCGAATTATTAAATATCAAAAGATTGG
TCGTCAATCTTTTGATTTACATAAAGTTAGAGAACCAGAAGTTAATGATT
ATATACTTTTTTCTTGTATTGATAAAAGAATAATACCGAATGACTTTACT
AAAGTGCCTGTCGGTCATTTGTATGTTGTAAGAAATGCTGGGAATTTTGT
TCCTCCATATAATCGTGGTTCACATGAAATTTCGAGTGAAGCCGGTGCAA
TAGAATTAGCAGTCAAACGAGCTGGAATAAAGGATATTATAATTTCAGGT
CATTCTGATTGCAGAGCTATGGAATATCTTTCGAATAGTAACAAACCGGA
TACTGAAGAGTGTAAATCTCATGGCCCTTTAAGTCAATGGGTGAAAAAAT
TTGGACGTGAAAGTTGGGTAAAGTTTCAAATGTTTCTCAAAAATCCGAAA
CATCCTTTGAAATTCCAACTGAAACCGCCACCAACGCCGCCAGATTTGGC
TTACTTTGATGACAAATTTCCCAAGCTTGATATTTTGTCACAGATCAATT
GTTTACAGCAAAGTGAAAATGTTGCCACTTTTCCTTTTCTTCGCTCAGAA
TTGCTCGACAATAGTTTAAAAATCCACACTCTTTGGAAAGAGCTAAATGC
AGTGGGTGAGGATCCCACTTTGTTTTTGTTTGACATCAATAAAGAAAAAT
TTTTGAAAATCACAGAAGAATATTCAGAAGAACTTACAAAAGATTTAGAC
TAATTTTATTAATTTAAGATCAATTTTTGAATGTTGCGCGCATGACTCTG
ATTTTTGATTTTGATTTTGGCTTGATCTGAAAGAGATTGAAAGTTGCTTT
TAATAATAAACATTAGTTTTTTTTTAATTACAGAGCTTGTTTATTTATTA
TTAATTTATAATTTGTATGCGTTATGAATATAATCATTTGTTTTGGTATT
ATATTTTTCTATTCGATGAAATCAGC
back to top

protein sequence of SMED30025696-orf-1

>SMED30025696-orf-1 ID=SMED30025696-orf-1|Name=SMED30025696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MNKIIHRIIKYQKIGRQSFDLHKVREPEVNDYILFSCIDKRIIPNDFTKV
PVGHLYVVRNAGNFVPPYNRGSHEISSEAGAIELAVKRAGIKDIIISGHS
DCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHP
LKFQLKPPPTPPDLAYFDDKFPKLDILSQINCLQQSENVATFPFLRSELL
DNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKITEEYSEELTKDLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036874Carbonic_anhydrase_sf
IPR001765Carbonic_anhydrase
Vocabulary: molecular function
TermDefinition
GO:0004089carbonate dehydratase activity
GO:0008270zinc ion binding
GO:0016829lyase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001765Carbonic anhydraseSMARTSM00947Pro_CA_2coord: 25..217
e-value: 8.4E-14
score: 61.9
IPR001765Carbonic anhydrasePFAMPF00484Pro_CAcoord: 33..213
e-value: 8.7E-26
score: 91.1
IPR036874Carbonic anhydrase superfamilyGENE3DG3DSA:3.40.1050.10coord: 5..218
e-value: 1.2E-27
score: 98.7
IPR036874Carbonic anhydrase superfamilySUPERFAMILYSSF53056beta-carbonic anhydrase, cabcoord: 31..211
NoneNo IPR availablePANTHERPTHR11002CARBONIC ANHYDRASEcoord: 1..247
NoneNo IPR availablePANTHERPTHR11002:SF49BETA CARBONIC ANHYDRASE 1coord: 1..247