Transcription factor 7-like 1

Overview
NameTranscription factor 7-like 1
Smed IDSMED30025683
Length (bp)3078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor 7-like 1 (SMED30025683) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor 7-like 1 (SMED30025683) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription factor 7-like 1 (SMED30025683) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription factor 7-like 1 (SMED30025683) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025683

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025683SMESG000017328.1 SmedASXL_010134SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025683SMESG000017328.1 dd_Smed_v4_9140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025683SMESG000017328.1 dd_Smed_v4_9140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025683SMESG000017328.1 Smed-TCF-2smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30025683SMESG000017328.1 Smed-TCF-2smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30025683SMESG000017328.1 Smed-TCF-2smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30025683SMESG000017328.1 dd_Smed_v4_9140_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription factor 7-like 1 vs. Ensembl Human
Match: TCF7 (transcription factor 7 [Source:HGNC Symbol;Acc:HGNC:11639])

HSP 1 Score: 143.665 bits (361), Expect = 4.772e-39
Identity = 65/78 (83.33%), Postives = 71/78 (91.03%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNY 1457
            KKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY
Sbjct:   43 KKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNY 120          
BLAST of Transcription factor 7-like 1 vs. Ensembl Human
Match: TCF7 (transcription factor 7 [Source:HGNC Symbol;Acc:HGNC:11639])

HSP 1 Score: 145.591 bits (366), Expect = 5.331e-39
Identity = 65/78 (83.33%), Postives = 71/78 (91.03%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNY 1457
            KKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY
Sbjct:   54 KKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNY 131          
BLAST of Transcription factor 7-like 1 vs. Ensembl Human
Match: LEF1 (lymphoid enhancer binding factor 1 [Source:HGNC Symbol;Acc:HGNC:6551])

HSP 1 Score: 147.902 bits (372), Expect = 1.142e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  198 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 277          
BLAST of Transcription factor 7-like 1 vs. Ensembl Human
Match: LEF1 (lymphoid enhancer binding factor 1 [Source:HGNC Symbol;Acc:HGNC:6551])

HSP 1 Score: 147.517 bits (371), Expect = 8.344e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  266 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 345          
BLAST of Transcription factor 7-like 1 vs. Ensembl Human
Match: TCF7 (transcription factor 7 [Source:HGNC Symbol;Acc:HGNC:11639])

HSP 1 Score: 144.436 bits (363), Expect = 8.916e-38
Identity = 65/78 (83.33%), Postives = 71/78 (91.03%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNY 1457
            KKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY
Sbjct:  150 KKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNY 227          
BLAST of Transcription factor 7-like 1 vs. Ensembl Celegans
Match: pop-1 (pep chromosome:WBcel235:I:2823254:2830311:-1 gene:WBGene00004077.1 transcript:W10C8.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pop-1)

HSP 1 Score: 103.219 bits (256), Expect = 7.570e-23
Identity = 47/81 (58.02%), Postives = 63/81 (77.78%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEEC--TLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            K  H+KKPLNAFM FMKE R  + EE     K+SA +N+ LGK+WH+LS+E+Q KY+E+A+K+KE H++ YP WSAR+NYA
Sbjct:  188 KDDHVKKPLNAFMWFMKENRKALLEEIGNNEKQSAELNKELGKRWHDLSKEEQAKYFEMAKKDKETHKERYPEWSARENYA 268          
BLAST of Transcription factor 7-like 1 vs. Ensembl Celegans
Match: gei-3 (GEX Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q0G834])

HSP 1 Score: 67.781 bits (164), Expect = 3.711e-11
Identity = 26/71 (36.62%), Postives = 50/71 (70.42%), Query Frame = 3
Query: 1227 KPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGW 1439
            +PH+++P+NAFM+F K  RP V ++   K++  +++ILG+ W+ L+ + + +Y++LA + KE H + +P W
Sbjct:  840 EPHVRRPMNAFMIFSKRHRPLVHQQYPNKDNRTVSKILGEWWYSLAADQKAEYHKLATQVKEAHFKAHPDW 910          
BLAST of Transcription factor 7-like 1 vs. Ensembl Celegans
Match: gei-3 (GEX Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q0G834])

HSP 1 Score: 66.6254 bits (161), Expect = 6.617e-11
Identity = 26/71 (36.62%), Postives = 50/71 (70.42%), Query Frame = 3
Query: 1227 KPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGW 1439
            +PH+++P+NAFM+F K  RP V ++   K++  +++ILG+ W+ L+ + + +Y++LA + KE H + +P W
Sbjct:   75 EPHVRRPMNAFMIFSKRHRPLVHQQYPNKDNRTVSKILGEWWYSLAADQKAEYHKLATQVKEAHFKAHPDW 145          
BLAST of Transcription factor 7-like 1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 52.373 bits (124), Expect = 8.525e-7
Identity = 31/99 (31.31%), Postives = 54/99 (54.55%), Query Frame = 3
Query: 1170 SSRNSVDQRGSVTSPDSPKKP------HIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSAR 1448
            SS  S     SVTS  +  +P      HIK+P+NAFM++ ++ R K+ +      ++ I++ILG +W  +S  ++  YYE   +  +LH + +P +  R
Sbjct:  144 SSGKSTPGNTSVTSEVATPRPQAKSPNHIKRPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYR 242          
BLAST of Transcription factor 7-like 1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 52.373 bits (124), Expect = 8.525e-7
Identity = 31/99 (31.31%), Postives = 54/99 (54.55%), Query Frame = 3
Query: 1170 SSRNSVDQRGSVTSPDSPKKP------HIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSAR 1448
            SS  S     SVTS  +  +P      HIK+P+NAFM++ ++ R K+ +      ++ I++ILG +W  +S  ++  YYE   +  +LH + +P +  R
Sbjct:  144 SSGKSTPGNTSVTSEVATPRPQAKSPNHIKRPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYR 242          
BLAST of Transcription factor 7-like 1 vs. Ensembl Fly
Match: pan (gene:FBgn0085432 transcript:FBtr0334301)

HSP 1 Score: 147.902 bits (372), Expect = 3.335e-36
Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WHELSRE+Q+KYYE AR+E++LH +LYPGWSARDNY 
Sbjct:  269 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYG 347          

HSP 2 Score: 51.6026 bits (122), Expect = 3.442e-6
Identity = 30/57 (52.63%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   45 MPHM----NSSSDDLTFTDEVKVYKDEGDEEEQEKSAEN-LKEDKVGLVN--EGEEK 194
            MPH      SS DDL  TDEVK++KDEGD E+++ S+EN L E+K  L++  E EEK
Sbjct:    1 MPHTHSRHGSSGDDLCSTDEVKIFKDEGDREDEKISSENLLVEEKSSLIDLTESEEK 57          
BLAST of Transcription factor 7-like 1 vs. Ensembl Fly
Match: pan (gene:FBgn0085432 transcript:FBtr0089161)

HSP 1 Score: 147.902 bits (372), Expect = 3.599e-36
Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WHELSRE+Q+KYYE AR+E++LH +LYPGWSARDNY 
Sbjct:  269 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYG 347          

HSP 2 Score: 51.6026 bits (122), Expect = 3.503e-6
Identity = 30/57 (52.63%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   45 MPHM----NSSSDDLTFTDEVKVYKDEGDEEEQEKSAEN-LKEDKVGLVN--EGEEK 194
            MPH      SS DDL  TDEVK++KDEGD E+++ S+EN L E+K  L++  E EEK
Sbjct:    1 MPHTHSRHGSSGDDLCSTDEVKIFKDEGDREDEKISSENLLVEEKSSLIDLTESEEK 57          
BLAST of Transcription factor 7-like 1 vs. Ensembl Fly
Match: pan (gene:FBgn0085432 transcript:FBtr0089159)

HSP 1 Score: 147.902 bits (372), Expect = 3.599e-36
Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WHELSRE+Q+KYYE AR+E++LH +LYPGWSARDNY 
Sbjct:  269 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYG 347          

HSP 2 Score: 51.6026 bits (122), Expect = 3.503e-6
Identity = 30/57 (52.63%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   45 MPHM----NSSSDDLTFTDEVKVYKDEGDEEEQEKSAEN-LKEDKVGLVN--EGEEK 194
            MPH      SS DDL  TDEVK++KDEGD E+++ S+EN L E+K  L++  E EEK
Sbjct:    1 MPHTHSRHGSSGDDLCSTDEVKIFKDEGDREDEKISSENLLVEEKSSLIDLTESEEK 57          
BLAST of Transcription factor 7-like 1 vs. Ensembl Fly
Match: pan (gene:FBgn0085432 transcript:FBtr0089162)

HSP 1 Score: 147.902 bits (372), Expect = 3.599e-36
Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WHELSRE+Q+KYYE AR+E++LH +LYPGWSARDNY 
Sbjct:  269 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYG 347          

HSP 2 Score: 51.6026 bits (122), Expect = 3.503e-6
Identity = 30/57 (52.63%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   45 MPHM----NSSSDDLTFTDEVKVYKDEGDEEEQEKSAEN-LKEDKVGLVN--EGEEK 194
            MPH      SS DDL  TDEVK++KDEGD E+++ S+EN L E+K  L++  E EEK
Sbjct:    1 MPHTHSRHGSSGDDLCSTDEVKIFKDEGDREDEKISSENLLVEEKSSLIDLTESEEK 57          
BLAST of Transcription factor 7-like 1 vs. Ensembl Fly
Match: pan (gene:FBgn0085432 transcript:FBtr0309803)

HSP 1 Score: 147.902 bits (372), Expect = 3.599e-36
Identity = 64/79 (81.01%), Postives = 73/79 (92.41%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WHELSRE+Q+KYYE AR+E++LH +LYPGWSARDNY 
Sbjct:  269 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYG 347          

HSP 2 Score: 51.6026 bits (122), Expect = 3.503e-6
Identity = 30/57 (52.63%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   45 MPHM----NSSSDDLTFTDEVKVYKDEGDEEEQEKSAEN-LKEDKVGLVN--EGEEK 194
            MPH      SS DDL  TDEVK++KDEGD E+++ S+EN L E+K  L++  E EEK
Sbjct:    1 MPHTHSRHGSSGDDLCSTDEVKIFKDEGDREDEKISSENLLVEEKSSLIDLTESEEK 57          
BLAST of Transcription factor 7-like 1 vs. Ensembl Zebrafish
Match: lef1 (lymphoid enhancer-binding factor 1 [Source:ZFIN;Acc:ZDB-GENE-990714-26])

HSP 1 Score: 145.976 bits (367), Expect = 2.881e-40
Identity = 65/81 (80.25%), Postives = 72/81 (88.89%), Query Frame = 3
Query: 1218 SPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
             PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:   21 EPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 101          
BLAST of Transcription factor 7-like 1 vs. Ensembl Zebrafish
Match: tcf7 (transcription factor 7 [Source:ZFIN;Acc:ZDB-GENE-050222-4])

HSP 1 Score: 145.206 bits (365), Expect = 1.482e-38
Identity = 65/81 (80.25%), Postives = 72/81 (88.89%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYAS 1463
            PKKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH L+RE+Q KYYELARKE++LH QLYP WSARDNY S
Sbjct:  116 PKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALTREEQAKYYELARKERQLHMQLYPSWSARDNYVS 196          
BLAST of Transcription factor 7-like 1 vs. Ensembl Zebrafish
Match: tcf7l1b (transcription factor 7 like 1b [Source:NCBI gene;Acc:30556])

HSP 1 Score: 149.443 bits (376), Expect = 2.890e-38
Identity = 67/82 (81.71%), Postives = 73/82 (89.02%), Query Frame = 3
Query: 1215 DSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            D  KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  190 DEDKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYG 271          
BLAST of Transcription factor 7-like 1 vs. Ensembl Zebrafish
Match: tcf7l1a (transcription factor 7 like 1a [Source:NCBI gene;Acc:30523])

HSP 1 Score: 149.828 bits (377), Expect = 2.954e-38
Identity = 66/79 (83.54%), Postives = 72/79 (91.14%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  196 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYG 274          
BLAST of Transcription factor 7-like 1 vs. Ensembl Zebrafish
Match: tcf7 (transcription factor 7 [Source:ZFIN;Acc:ZDB-GENE-050222-4])

HSP 1 Score: 143.665 bits (361), Expect = 4.656e-38
Identity = 65/81 (80.25%), Postives = 72/81 (88.89%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYAS 1463
            PKKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH L+RE+Q KYYELARKE++LH QLYP WSARDNY S
Sbjct:  116 PKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALTREEQAKYYELARKERQLHMQLYPSWSARDNYVS 196          
BLAST of Transcription factor 7-like 1 vs. Ensembl Xenopus
Match: lef1 (lymphoid enhancer binding factor 1 [Source:NCBI gene;Acc:100493178])

HSP 1 Score: 147.132 bits (370), Expect = 9.886e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  266 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 345          
BLAST of Transcription factor 7-like 1 vs. Ensembl Xenopus
Match: lef1 (lymphoid enhancer binding factor 1 [Source:NCBI gene;Acc:100493178])

HSP 1 Score: 147.517 bits (371), Expect = 1.013e-37
Identity = 65/81 (80.25%), Postives = 73/81 (90.12%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYAS 1463
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY +
Sbjct:  279 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYKA 359          
BLAST of Transcription factor 7-like 1 vs. Ensembl Xenopus
Match: tcf7 (transcription factor 7 [Source:NCBI gene;Acc:395061])

HSP 1 Score: 146.747 bits (369), Expect = 2.235e-37
Identity = 66/80 (82.50%), Postives = 73/80 (91.25%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PKKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q+KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  245 PKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQSKYYELARKERQLHMQLYPGWSARDNYG 324          
BLAST of Transcription factor 7-like 1 vs. Ensembl Xenopus
Match: tcf7 (transcription factor 7 [Source:NCBI gene;Acc:395061])

HSP 1 Score: 147.902 bits (372), Expect = 3.208e-37
Identity = 66/80 (82.50%), Postives = 73/80 (91.25%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PKKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q+KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  245 PKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQSKYYELARKERQLHMQLYPGWSARDNYG 324          
BLAST of Transcription factor 7-like 1 vs. Ensembl Xenopus
Match: tcf7 (transcription factor 7 [Source:NCBI gene;Acc:395061])

HSP 1 Score: 148.288 bits (373), Expect = 4.261e-37
Identity = 66/80 (82.50%), Postives = 73/80 (91.25%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PKKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q+KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  274 PKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQSKYYELARKERQLHMQLYPGWSARDNYG 353          
BLAST of Transcription factor 7-like 1 vs. Ensembl Mouse
Match: Lef1 (lymphoid enhancer binding factor 1 [Source:MGI Symbol;Acc:MGI:96770])

HSP 1 Score: 148.288 bits (373), Expect = 1.453e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  226 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 305          
BLAST of Transcription factor 7-like 1 vs. Ensembl Mouse
Match: Tcf7 (transcription factor 7, T cell specific [Source:MGI Symbol;Acc:MGI:98507])

HSP 1 Score: 142.51 bits (358), Expect = 2.790e-38
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:   94 KKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 172          
BLAST of Transcription factor 7-like 1 vs. Ensembl Mouse
Match: Lef1 (lymphoid enhancer binding factor 1 [Source:MGI Symbol;Acc:MGI:96770])

HSP 1 Score: 147.517 bits (371), Expect = 5.085e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  264 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 343          
BLAST of Transcription factor 7-like 1 vs. Ensembl Mouse
Match: Lef1 (lymphoid enhancer binding factor 1 [Source:MGI Symbol;Acc:MGI:96770])

HSP 1 Score: 147.517 bits (371), Expect = 7.699e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  264 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 343          
BLAST of Transcription factor 7-like 1 vs. Ensembl Mouse
Match: Lef1 (lymphoid enhancer binding factor 1 [Source:MGI Symbol;Acc:MGI:96770])

HSP 1 Score: 147.517 bits (371), Expect = 9.879e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  292 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 371          
BLAST of Transcription factor 7-like 1 vs. UniProt/SwissProt
Match: sp|Q9QXN1|LEF1_RAT (Lymphoid enhancer-binding factor 1 OS=Rattus norvegicus OX=10116 GN=Lef1 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 6.530e-37
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  292 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 371          
BLAST of Transcription factor 7-like 1 vs. UniProt/SwissProt
Match: sp|P27782|LEF1_MOUSE (Lymphoid enhancer-binding factor 1 OS=Mus musculus OX=10090 GN=Lef1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 6.910e-37
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  292 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 371          
BLAST of Transcription factor 7-like 1 vs. UniProt/SwissProt
Match: sp|Q9UJU2|LEF1_HUMAN (Lymphoid enhancer-binding factor 1 OS=Homo sapiens OX=9606 GN=LEF1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.686e-37
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  294 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 373          
BLAST of Transcription factor 7-like 1 vs. UniProt/SwissProt
Match: sp|Q9YHE8|T7L1A_DANRE (Transcription factor 7-like 1-A OS=Danio rerio OX=7955 GN=tcf7l1a PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.737e-36
Identity = 66/79 (83.54%), Postives = 72/79 (91.14%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  325 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYG 403          
BLAST of Transcription factor 7-like 1 vs. UniProt/SwissProt
Match: sp|Q800Q5|T7L1B_DANRE (Transcription factor 7-like 1-B OS=Danio rerio OX=7955 GN=tcf7l1b PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 6.330e-36
Identity = 66/82 (80.49%), Postives = 73/82 (89.02%), Query Frame = 3
Query: 1215 DSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            D  KKPHIKKPLNAFML+MKEMR KV  ECTLKE+AAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  319 DEDKKPHIKKPLNAFMLYMKEMRAKVVAECTLKENAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYG 400          
BLAST of Transcription factor 7-like 1 vs. TrEMBL
Match: A0A291LM02 (TCF-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1515.36 bits (3922), Expect = 0.000e+0
Identity = 965/965 (100.00%), Postives = 965/965 (100.00%), Query Frame = 3
Query:   45 MPHMNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFXXXXXXXXXXXXXPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIXXXXXXHFYSLPSTSQLHEAWNCDVXXXXXXXXXXGSHNHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRILTDSRSAADFPGNNSVLHSGMPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQGKYHNYGPTMHQKTTADDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAXXXXXXXXXXXXXXXXXDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWXXXXXXXXXXXXFIYNTTDDSLAELVQTINPDSTKQENRMRHARIDSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDAXXXXXXXXXXXXXXXXXXXIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSLXXXXXXXXXXXXXXXXXXXXXXXISESELNKLSKWEASVGNXXXXXXXXXXXXXAMYSELEYSSLVPQISHLNRHCESRDESPPSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK 2939
            MPHMNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFMSNYSGYMNGSSNPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIAAAAAAHFYSLPSTSQLHEAWNCDVLSSQQQQSLLGSHNHDNNNTTKSTPNSSSNRLSFSVSSIADSDKSNSSRILTDSRSAADFPGNNSVLHSGMPLSPSMFAAAAVAAAQAAAFSSSNSSPDVSSLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQGKYHNYGPTMHQKTTADDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAKRRKKRKLLNSSMLNSRDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWCKPCRRKKKCVRFIYNTTDDSLAELVQTINPDSTKQENRMRHARIDSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDANSSFRSFSLLNHSSNNSSNIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSLSAAATAATSAAATAAAASAAAAAISESELNKLSKWEASVGNPQSITTISTPPTPAMYSELEYSSLVPQISHLNRHCESRDESPPSADNEKSNKKPKKSNNDDEDEDDDDKSNNNIHGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK
Sbjct:    1 MPHMNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFMSNYSGYMNGSSNPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIAAAAAAHFYSLPSTSQLHEAWNCDVLSSQQQQSLLGSHNHDNNNTTKSTPNSSSNRLSFSVSSIADSDKSNSSRILTDSRSAADFPGNNSVLHSGMPLSPSMFAAAAVAAAQAAAFSSSNSSPDVSSLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQGKYHNYGPTMHQKTTADDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAKRRKKRKLLNSSMLNSRDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWCKPCRRKKKCVRFIYNTTDDSLAELVQTINPDSTKQENRMRHARIDSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDANSSFRSFSLLNHSSNNSSNIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSLSAAATAATSAAATAAAASAAAAAISESELNKLSKWEASVGNPQSITTISTPPTPAMYSELEYSSLVPQISHLNRHCESRDESPPSADNEKSNKKPKKSNNDDEDEDDDDKSNNNIHGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK 965          
BLAST of Transcription factor 7-like 1 vs. TrEMBL
Match: A0A4Z2DJT3 (Lymphoid enhancer-binding factor 1 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_000138 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.927e-43
Identity = 109/193 (56.48%), Postives = 129/193 (66.84%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAXXXXXXXXXXXXXXXXXDGFLSMNMMPMNHYGPNNSGY--GDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLW 1796
            K+ HIKKPLNAFMLFMK+MRPKVQEECTLKESAAINQILGKKWHELSRE Q KYYELARKEKELH QL+PGWSARDNYA H++R+KKRKL  ++  +       M+      +G N+SG+        D   + SN +  SR   + +LM N T                 +T+ S+ KKCRARFGLEHQN W
Sbjct:  763 KRVHIKKPLNAFMLFMKDMRPKVQEECTLKESAAINQILGKKWHELSREKQAKYYELARKEKELHHQLFPGWSARDNYAIHSRRKKKRKLAAAAAQSK------MHSTSSKTFG-NSSGHHLSSESGGDFGNSDSNEERSSR---LPLLMANTT-----------------STDISSAKKCRARFGLEHQNRW 928          

HSP 2 Score: 69.707 bits (169), Expect = 4.009e-8
Identity = 39/74 (52.70%), Postives = 48/74 (64.86%), Query Frame = 3
Query:   72 DLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGE----EKTPLEFDIYN-KQYAASMFKVPFST-DPRF 275
            ++  TDEVKVYKDEG+E+EQ+KS+ENL EDKVGLV EGE    +K    F   +   Y  S F +PF T  P F
Sbjct:    2 EVACTDEVKVYKDEGEEDEQKKSSENLTEDKVGLVIEGEGQCAQKGSFNFGFLSLDDYYHSFFPLPFVTGSPSF 75          
BLAST of Transcription factor 7-like 1 vs. TrEMBL
Match: A0A183SW48 (HMG box domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS8446 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.942e-43
Identity = 105/220 (47.73%), Postives = 134/220 (60.91%), Query Frame = 3
Query: 1137 NSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAXXXXXXXXXXXXXXXXXDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLW 1796
            NSS    + L   R  ++   S     + K+ HIKKPLNAFMLFMKEMRPK+QEECTLKESAAINQILGKKWHELS+ +Q+KYYE+ARKEKE+H+QL+PGWSARDNYA H+KR++KRKL  ++   +    ++     +N  GP    Y                     + +D L  N  G     +S+  + A     +  NPKKCRARFGLE Q+ W
Sbjct:  119 NSSALQSRALAQYRREINMENSA---GTTKRVHIKKPLNAFMLFMKEMRPKIQEECTLKESAAINQILGKKWHELSKPEQSKYYEMARKEKEIHRQLFPGWSARDNYAIHSKRKRKRKLAAAAAAAAAAAAVN----SVNRRGPGGEIY---------------------DGLDGL--NSAGNYFQNSSLNSVVAVAAAVDLGNPKKCRARFGLEQQSRW 308          
BLAST of Transcription factor 7-like 1 vs. TrEMBL
Match: A0A183LKJ8 (HMG box domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS4323 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 2.741e-42
Identity = 107/204 (52.45%), Postives = 129/204 (63.24%), Query Frame = 3
Query: 1197 GSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAXXXXXXXXXXXXXXXXXDGFLSMNMMPMN---HYGPNNSG-YGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLW 1796
             S ++ +S K+ HIKKPLNAFMLFMK+MRPKVQEECTLKESAAINQILGKKWHELSRE Q KYYELARKEKELH QL+PGWSARDNYA H++R+KKRKL  ++ +       +      N   H    + G +G+    + RTNR +   G+ N                            +T+ S+ KKCRARFGLEHQN W
Sbjct:  608 NSTSNTNSTKRVHIKKPLNAFMLFMKDMRPKVQEECTLKESAAINQILGKKWHELSREKQAKYYELARKEKELHHQLFPGWSARDNYAIHSRRKKKRKLAAAAAVAQTKIHSTSGKTLGNTGIHLSSESGGDFGNSDSNEERTNRLSVLVGNAN----------------------------STDISSAKKCRARFGLEHQNRW 783          
BLAST of Transcription factor 7-like 1 vs. TrEMBL
Match: A0A0L8IAY8 (HMG box domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22023772mg PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.880e-42
Identity = 97/191 (50.79%), Postives = 111/191 (58.12%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAXXXXXXXXXXXXXXXXXDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLW 1796
            KKPHIKKPLNAFMLFMKEMRPKV  ECTLKESAAINQILG+KWH L R +Q KYYE+ARKEKELH QLYPGWSARDNYASH K++K+++                N +  +      S  GD +  + RT  S            I+ C                        SNPKKCRARFGL+ QN W
Sbjct:  111 KKPHIKKPLNAFMLFMKEMRPKVVAECTLKESAAINQILGRKWHALDRAEQAKYYEMARKEKELHMQLYPGWSARDNYASHTKKKKRKRETTGEDEAKARLPWYFNDVTTDSITAEGSSGGDSYQWE-RTRPS------------IIEC------------------------SNPKKCRARFGLDQQNQW 264          
BLAST of Transcription factor 7-like 1 vs. Ensembl Cavefish
Match: lef1 (lymphoid enhancer binding factor 1 [Source:NCBI gene;Acc:103033630])

HSP 1 Score: 146.747 bits (369), Expect = 7.116e-38
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  264 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 343          
BLAST of Transcription factor 7-like 1 vs. Ensembl Cavefish
Match: lef1 (lymphoid enhancer binding factor 1 [Source:NCBI gene;Acc:103033630])

HSP 1 Score: 146.747 bits (369), Expect = 1.096e-37
Identity = 65/80 (81.25%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PK+PHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  264 PKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 343          
BLAST of Transcription factor 7-like 1 vs. Ensembl Cavefish
Match: tcf7l1b (transcription factor 7-like 1-B [Source:NCBI gene;Acc:103022374])

HSP 1 Score: 150.214 bits (378), Expect = 1.296e-37
Identity = 66/78 (84.62%), Postives = 72/78 (92.31%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNY 1457
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY
Sbjct:  323 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNY 400          
BLAST of Transcription factor 7-like 1 vs. Ensembl Cavefish
Match: tcf7l1b (transcription factor 7-like 1-B [Source:NCBI gene;Acc:103022374])

HSP 1 Score: 150.214 bits (378), Expect = 2.124e-37
Identity = 66/78 (84.62%), Postives = 72/78 (92.31%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNY 1457
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY
Sbjct:  323 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNY 400          
BLAST of Transcription factor 7-like 1 vs. Ensembl Cavefish
Match: tcf7l2 (transcription factor 7 like 2 [Source:NCBI gene;Acc:103031257])

HSP 1 Score: 146.747 bits (369), Expect = 7.823e-37
Identity = 65/78 (83.33%), Postives = 72/78 (92.31%), Query Frame = 3
Query: 1230 PHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYAS 1463
            PHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNYA+
Sbjct:  350 PHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYAA 427          
BLAST of Transcription factor 7-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004973.1 (pep scaffold:Pmarinus_7.0:GL479925:4219:8952:-1 gene:ENSPMAG00000004519.1 transcript:ENSPMAT00000004973.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 7.547e-19
Identity = 34/42 (80.95%), Postives = 39/42 (92.86%), Query Frame = 3
Query: 1332 QILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNY 1457
            QILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY
Sbjct:    1 QILGRRWHALSREEQAKYYELARKERQLHSQLYPGWSARDNY 42          
BLAST of Transcription factor 7-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008165.1 (pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 gene:ENSPMAG00000007384.1 transcript:ENSPMAT00000008165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 4.384e-11
Identity = 27/74 (36.49%), Postives = 49/74 (66.22%), Query Frame = 3
Query: 1227 KPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSAR 1448
            +PHIK+P+NAFM++ K+ R K+ +      +++I++ILG +W  +S +++  YYE   +  +LH + YPG+  R
Sbjct:   58 EPHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKAMSSQEKQPYYEEQARLSKLHLERYPGYKYR 131          
BLAST of Transcription factor 7-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006684.1 (pep scaffold:Pmarinus_7.0:GL477399:28105:35473:-1 gene:ENSPMAG00000006026.1 transcript:ENSPMAT00000006684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.091e-7
Identity = 25/72 (34.72%), Postives = 45/72 (62.50%), Query Frame = 3
Query: 1227 KPHIKKPLNAFMLFMKEMRPKV-QEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGW 1439
            +PHIK+P+NAFM++ K+ R K+ Q    +K +  I++  G +W  +S +++  YYE   +  +LH + YP +
Sbjct:   58 EPHIKRPMNAFMVWAKDERRKILQAFPDMKHTLQISECPGSRWKSMSNQEKQPYYEEQARLSKLHLEKYPDY 129          
BLAST of Transcription factor 7-like 1 vs. Ensembl Sea Lamprey
Match: sox10 (SRY-box transcription factor 10 [Source:ZFIN;Acc:ZDB-GENE-011207-1])

HSP 1 Score: 49.6766 bits (117), Expect = 2.092e-6
Identity = 21/70 (30.00%), Postives = 44/70 (62.86%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYP 1433
            +KPH+K+P+NAFM++ +  R K+ ++     +A +++ LGK W  L+  ++  + E A + +  H++ +P
Sbjct:  108 EKPHVKRPMNAFMVWAQAARRKLSDQYPQLHNAELSKTLGKLWRLLNEGEKRPFVEEAERLRMQHKKDHP 177          
BLAST of Transcription factor 7-like 1 vs. Ensembl Yeast
Match: ROX1 (Heme-dependent repressor of hypoxic genes; mediates aerobic transcriptional repression of hypoxia induced genes such as COX5b and CYC7; repressor function regulated through decreased promoter occupancy in response to oxidative stress; contains an HMG domain that is responsible for DNA bending activity; involved in the hyperosmotic stress resistance [Source:SGD;Acc:S000006269])

HSP 1 Score: 48.1358 bits (113), Expect = 4.969e-6
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 3
Query: 1230 PHIKKPLNAFMLFMKEMRPKVQEECT-----LKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSAR 1448
            P I +P NAF+LF +     + +E T     +  ++ I++I+G KW  L  ED+  +  LA KEK  H++ YP +  +
Sbjct:    8 PKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYK 85          
BLAST of Transcription factor 7-like 1 vs. Ensembl Nematostella
Match: EDO32618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ9])

HSP 1 Score: 140.584 bits (353), Expect = 2.577e-39
Identity = 63/78 (80.77%), Postives = 68/78 (87.18%), Query Frame = 3
Query: 1233 HIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASH 1466
            HIKKPLNAFML+MK+MRPKV  ECTLKESAAINQILGKKWH L R +Q KYYE+ARKE+ LH QLYPGWSARDNYA  
Sbjct:   11 HIKKPLNAFMLYMKDMRPKVVAECTLKESAAINQILGKKWHALDRSEQAKYYEMARKERALHLQLYPGWSARDNYAQQ 88          
BLAST of Transcription factor 7-like 1 vs. Ensembl Nematostella
Match: EDO47688 (Predicted protein; Sox family protein 2 [Source:UniProtKB/TrEMBL;Acc:Q3S383])

HSP 1 Score: 56.9954 bits (136), Expect = 7.623e-9
Identity = 23/69 (33.33%), Postives = 49/69 (71.01%), Query Frame = 3
Query: 1233 HIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGW 1439
            HIK+P+NA+M++ ++ R ++ EEC    ++ I++ LG +W+ L+ +++  Y E A++ +ELH++ +P +
Sbjct:    7 HIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSLTLDEKQPYVEEAKRLRELHKKDHPDY 75          
BLAST of Transcription factor 7-like 1 vs. Ensembl Nematostella
Match: EDO43746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ2])

HSP 1 Score: 50.8322 bits (120), Expect = 4.226e-8
Identity = 24/68 (35.29%), Postives = 44/68 (64.71%), Query Frame = 3
Query: 1236 IKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGW 1439
            +K+P+N+FM++ K MR K  EE     +A I+++LGK W+EL+ +D+  + E A + +  H + +P +
Sbjct:    1 VKRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAERLRIRHMKEHPNY 68          
BLAST of Transcription factor 7-like 1 vs. Ensembl Nematostella
Match: EDO38755 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC09])

HSP 1 Score: 49.6766 bits (117), Expect = 1.058e-7
Identity = 24/70 (34.29%), Postives = 46/70 (65.71%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYP 1433
            KK H+K+P+N FM++ +E R ++ +E     +A ++++LG  W +LS E++  Y E A+   E+H++ +P
Sbjct:    4 KKTHVKRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAKHLTEMHKEKHP 73          
BLAST of Transcription factor 7-like 1 vs. Ensembl Nematostella
Match: EDO33516 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRZ8])

HSP 1 Score: 49.6766 bits (117), Expect = 1.282e-7
Identity = 26/66 (39.39%), Postives = 43/66 (65.15%), Query Frame = 3
Query: 1236 IKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYP 1433
            IK+PLNAF+L+ K+ R  +  E     +  I++ LG +W +L+ E++  Y+E A+K KE H++ YP
Sbjct:    6 IKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAKKLKEEHKERYP 71          
BLAST of Transcription factor 7-like 1 vs. Ensembl Medaka
Match: lef1 (lymphoid enhancer binding factor 1 [Source:NCBI gene;Acc:101167344])

HSP 1 Score: 148.288 bits (373), Expect = 2.502e-38
Identity = 66/80 (82.50%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PKKPHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  265 PKKPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 344          
BLAST of Transcription factor 7-like 1 vs. Ensembl Medaka
Match: lef1 (lymphoid enhancer binding factor 1 [Source:NCBI gene;Acc:101167344])

HSP 1 Score: 148.288 bits (373), Expect = 3.066e-38
Identity = 66/80 (82.50%), Postives = 72/80 (90.00%), Query Frame = 3
Query: 1221 PKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            PKKPHIKKPLNAFML+MKEMR  V  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  259 PKKPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG 338          
BLAST of Transcription factor 7-like 1 vs. Ensembl Medaka
Match: tcf7l1 (transcription factor 7 like 1 [Source:NCBI gene;Acc:100820729])

HSP 1 Score: 149.828 bits (377), Expect = 1.714e-37
Identity = 66/79 (83.54%), Postives = 72/79 (91.14%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  324 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYV 402          
BLAST of Transcription factor 7-like 1 vs. Ensembl Medaka
Match: tcf7l1 (transcription factor 7 like 1 [Source:NCBI gene;Acc:100820729])

HSP 1 Score: 149.443 bits (376), Expect = 2.683e-37
Identity = 66/79 (83.54%), Postives = 72/79 (91.14%), Query Frame = 3
Query: 1224 KKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            KKPHIKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH LSRE+Q KYYELARKE++LH QLYPGWSARDNY 
Sbjct:  326 KKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPGWSARDNYG 404          
BLAST of Transcription factor 7-like 1 vs. Ensembl Medaka
Match: tcf7 (transcription factor 7 [Source:NCBI gene;Acc:101162309])

HSP 1 Score: 144.05 bits (362), Expect = 9.210e-37
Identity = 66/92 (71.74%), Postives = 74/92 (80.43%), Query Frame = 3
Query: 1185 VDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            V Q+        PKKP IKKPLNAFML+MKEMR KV  ECTLKESAAINQILG++WH L+RE+Q KYYELARKE++LH QLYP WSARDNY 
Sbjct:  266 VKQQVETKREKEPKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALTREEQAKYYELARKERQLHMQLYPTWSARDNYG 357          
BLAST of Transcription factor 7-like 1 vs. Planmine SMEST
Match: SMESG000017328.1 (SMESG000017328.1)

HSP 1 Score: 1461.82 bits (3783), Expect = 0.000e+0
Identity = 931/965 (96.48%), Postives = 940/965 (97.41%), Query Frame = 3
Query:   45 MPHMNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFXXXXXXXXXXXXXPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIXXXXXXHFYSLPSTSQLHEAWNCDVXXXXXXXXXXGSHNHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRILTDSRSAADFPGNNSVLHSGMPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQGKYHNYGPTMHQKTTADDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAXXXXXXXXXXXXXXXXXDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWXXXXXXXXXXXXFIYNTTDDSLAELVQTINPDSTKQENRMRHARIDSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDAXXXXXXXXXXXXXXXXXXXIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSLXXXXXXXXXXXXXXXXXXXXXXXISESELNKLSKWEASVGNXXXXXXXXXXXXXAMYSELEYSSLVPQISHLNRHCESRDESPPSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK 2939
            MPHMNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFMSNYSGYMNGSSNPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIAAAAAAHFYSLPSTSQLHEAWNCDVLSSQQQQSLLGSHNHDNNNTTKSTPNSS+NRLSFSVSSIADSDKSNSSRILTDSRSAADFPGNNSVLHSGMPLSPSMFAAAAVAAAQAAAFSSSNSSPDVSSLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQ                DDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAKRRKKRKLLNSSMLNSRDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWCKPCRRKKKCVRFIYNTTDDSLAELVQTINPD+TKQENRMRHAR+DSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDANSSFRSFSLLNHSSNNSSNIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSL  +A A  + +A A AA+A+AAAISESELNKLSKWEASVGNPQSITTISTPPTPAMYSELEYSSLVPQISHLNRHCESRDESPPSADNEKSNKK KKSNNDDEDEDDDDKSNNN+HGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK
Sbjct:    1 MPHMNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFMSNYSGYMNGSSNPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIAAAAAAHFYSLPSTSQLHEAWNCDVLSSQQQQSLLGSHNHDNNNTTKSTPNSSANRLSFSVSSIADSDKSNSSRILTDSRSAADFPGNNSVLHSGMPLSPSMFAAAAVAAAQAAAFSSSNSSPDVSSLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQ----------------DDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAKRRKKRKLLNSSMLNSRDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWCKPCRRKKKCVRFIYNTTDDSLAELVQTINPDATKQENRMRHARLDSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDANSSFRSFSLLNHSSNNSSNIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSL--SAAATAATSAAATAAAASAAAISESELNKLSKWEASVGNPQSITTISTPPTPAMYSELEYSSLVPQISHLNRHCESRDESPPSADNEKSNKKLKKSNNDDEDEDDDDKSNNNLHGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK 947          
BLAST of Transcription factor 7-like 1 vs. Planmine SMEST
Match: SMESG000017328.1 (SMESG000017328.1)

HSP 1 Score: 1455.66 bits (3767), Expect = 0.000e+0
Identity = 928/962 (96.47%), Postives = 937/962 (97.40%), Query Frame = 3
Query:   54 MNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFXXXXXXXXXXXXXPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIXXXXXXHFYSLPSTSQLHEAWNCDVXXXXXXXXXXGSHNHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRILTDSRSAADFPGNNSVLHSGMPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQGKYHNYGPTMHQKTTADDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAXXXXXXXXXXXXXXXXXDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWXXXXXXXXXXXXFIYNTTDDSLAELVQTINPDSTKQENRMRHARIDSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDAXXXXXXXXXXXXXXXXXXXIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSLXXXXXXXXXXXXXXXXXXXXXXXISESELNKLSKWEASVGNXXXXXXXXXXXXXAMYSELEYSSLVPQISHLNRHCESRDESPPSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK 2939
            MNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFMSNYSGYMNGSSNPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIAAAAAAHFYSLPSTSQLHEAWNCDVLSSQQQQSLLGSHNHDNNNTTKSTPNSS+NRLSFSVSSIADSDKSNSSRILTDSRSAADFPGNNSVLHSGMPLSPSMFAAAAVAAAQAAAFSSSNSSPDVSSLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQ                DDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAKRRKKRKLLNSSMLNSRDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWCKPCRRKKKCVRFIYNTTDDSLAELVQTINPD+TKQENRMRHAR+DSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDANSSFRSFSLLNHSSNNSSNIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSL  +A A  + +A A AA+A+AAAISESELNKLSKWEASVGNPQSITTISTPPTPAMYSELEYSSLVPQISHLNRHCESRDESPPSADNEKSNKK KKSNNDDEDEDDDDKSNNN+HGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK
Sbjct:    1 MNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEKTPLEFDIYNKQYAASMFKVPFSTDPRFANYFMSNYSGYMNGSSNPSTFMGNKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIAAAAAAHFYSLPSTSQLHEAWNCDVLSSQQQQSLLGSHNHDNNNTTKSTPNSSANRLSFSVSSIADSDKSNSSRILTDSRSAADFPGNNSVLHSGMPLSPSMFAAAAVAAAQAAAFSSSNSSPDVSSLHKAAAAHLRFLSSLHYQKQQHSPASNGLNMVSCYSNPDLVSSRNVNQ----------------DDRKTYTESLVPDRYHQSSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYASHAKRRKKRKLLNSSMLNSRDGFLSMNMMPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPNGASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWCKPCRRKKKCVRFIYNTTDDSLAELVQTINPDATKQENRMRHARLDSSYLNKSPPLQNNRHMSSPGMEHIDEIGSYHIDANSSFRSFSLLNHSSNNSSNIDHRKSPNFDYFSHPKKHLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSNHSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSNEYVAVSKSSL--SAAATAATSAAATAAAASAAAISESELNKLSKWEASVGNPQSITTISTPPTPAMYSELEYSSLVPQISHLNRHCESRDESPPSADNEKSNKKLKKSNNDDEDEDDDDKSNNNLHGKIKQEHDEFRDPSDSSQHYSESVASEPLRLSTLTPLVK 944          
BLAST of Transcription factor 7-like 1 vs. Planmine SMEST
Match: SMESG000009225.1 (SMESG000009225.1)

HSP 1 Score: 159.073 bits (401), Expect = 2.244e-41
Identity = 86/152 (56.58%), Postives = 94/152 (61.84%), Query Frame = 3
Query: 1089 HQSSDSIRHVSGFP------------GDNSSIEPRKTLYSSRNSVDQRGSVTSP----------------DSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            HQ+S    H  GFP            G N +  P  T YS  +S    G V  P                +  KKPHIKKPLNAFMLFMKEMR KV  ECTLKESAAINQILG++WH L+REDQ KYYE+ARKEKELH QLYPGWSARDNYA
Sbjct:   91 HQNSVQNSHFYGFPEVPGNPMSGIHNGQNLTGIPFST-YSGASSFRNSGFVNDPSRTSMALKLGLANENAEKTKKPHIKKPLNAFMLFMKEMRAKVVAECTLKESAAINQILGRRWHALTREDQAKYYEMARKEKELHHQLYPGWSARDNYA 241          
BLAST of Transcription factor 7-like 1 vs. Planmine SMEST
Match: SMESG000009225.1 (SMESG000009225.1)

HSP 1 Score: 159.073 bits (401), Expect = 2.245e-41
Identity = 86/152 (56.58%), Postives = 94/152 (61.84%), Query Frame = 3
Query: 1089 HQSSDSIRHVSGFP------------GDNSSIEPRKTLYSSRNSVDQRGSVTSP----------------DSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            HQ+S    H  GFP            G N +  P  T YS  +S    G V  P                +  KKPHIKKPLNAFMLFMKEMR KV  ECTLKESAAINQILG++WH L+REDQ KYYE+ARKEKELH QLYPGWSARDNYA
Sbjct:   89 HQNSVQNSHFYGFPEVPGNPMSGIHNGQNLTGIPFST-YSGASSFRNSGFVNDPSRTSMALKLGLANENAEKTKKPHIKKPLNAFMLFMKEMRAKVVAECTLKESAAINQILGRRWHALTREDQAKYYEMARKEKELHHQLYPGWSARDNYA 239          
BLAST of Transcription factor 7-like 1 vs. Planmine SMEST
Match: SMESG000009225.1 (SMESG000009225.1)

HSP 1 Score: 159.073 bits (401), Expect = 2.633e-41
Identity = 86/152 (56.58%), Postives = 94/152 (61.84%), Query Frame = 3
Query: 1089 HQSSDSIRHVSGFP------------GDNSSIEPRKTLYSSRNSVDQRGSVTSP----------------DSPKKPHIKKPLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYELARKEKELHQQLYPGWSARDNYA 1460
            HQ+S    H  GFP            G N +  P  T YS  +S    G V  P                +  KKPHIKKPLNAFMLFMKEMR KV  ECTLKESAAINQILG++WH L+REDQ KYYE+ARKEKELH QLYPGWSARDNYA
Sbjct:   88 HQNSVQNSHFYGFPEVPGNPMSGIHNGQNLTGIPFST-YSGASSFRNSGFVNDPSRTSMALKLGLANENAEKTKKPHIKKPLNAFMLFMKEMRAKVVAECTLKESAAINQILGRRWHALTREDQAKYYEMARKEKELHHQLYPGWSARDNYA 238          
The following BLAST results are available for this feature:
BLAST of Transcription factor 7-like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCF74.772e-3983.33transcription factor 7 [Source:HGNC Symbol;Acc:HGN... [more]
TCF75.331e-3983.33transcription factor 7 [Source:HGNC Symbol;Acc:HGN... [more]
LEF11.142e-3881.25lymphoid enhancer binding factor 1 [Source:HGNC Sy... [more]
LEF18.344e-3881.25lymphoid enhancer binding factor 1 [Source:HGNC Sy... [more]
TCF78.916e-3883.33transcription factor 7 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pop-17.570e-2358.02pep chromosome:WBcel235:I:2823254:2830311:-1 gene:... [more]
gei-33.711e-1136.62GEX Interacting protein [Source:UniProtKB/TrEMBL;... [more]
gei-36.617e-1136.62GEX Interacting protein [Source:UniProtKB/TrEMBL;... [more]
egl-138.525e-731.31Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-138.525e-731.31Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pan3.335e-3681.01gene:FBgn0085432 transcript:FBtr0334301[more]
pan3.599e-3681.01gene:FBgn0085432 transcript:FBtr0089161[more]
pan3.599e-3681.01gene:FBgn0085432 transcript:FBtr0089159[more]
pan3.599e-3681.01gene:FBgn0085432 transcript:FBtr0089162[more]
pan3.599e-3681.01gene:FBgn0085432 transcript:FBtr0309803[more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lef12.881e-4080.25lymphoid enhancer-binding factor 1 [Source:ZFIN;Ac... [more]
tcf71.482e-3880.25transcription factor 7 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
tcf7l1b2.890e-3881.71transcription factor 7 like 1b [Source:NCBI gene;A... [more]
tcf7l1a2.954e-3883.54transcription factor 7 like 1a [Source:NCBI gene;A... [more]
tcf74.656e-3880.25transcription factor 7 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lef19.886e-3881.25lymphoid enhancer binding factor 1 [Source:NCBI ge... [more]
lef11.013e-3780.25lymphoid enhancer binding factor 1 [Source:NCBI ge... [more]
tcf72.235e-3782.50transcription factor 7 [Source:NCBI gene;Acc:39506... [more]
tcf73.208e-3782.50transcription factor 7 [Source:NCBI gene;Acc:39506... [more]
tcf74.261e-3782.50transcription factor 7 [Source:NCBI gene;Acc:39506... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lef11.453e-3881.25lymphoid enhancer binding factor 1 [Source:MGI Sym... [more]
Tcf72.790e-3882.28transcription factor 7, T cell specific [Source:MG... [more]
Lef15.085e-3881.25lymphoid enhancer binding factor 1 [Source:MGI Sym... [more]
Lef17.699e-3881.25lymphoid enhancer binding factor 1 [Source:MGI Sym... [more]
Lef19.879e-3881.25lymphoid enhancer binding factor 1 [Source:MGI Sym... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QXN1|LEF1_RAT6.530e-3781.25Lymphoid enhancer-binding factor 1 OS=Rattus norve... [more]
sp|P27782|LEF1_MOUSE6.910e-3781.25Lymphoid enhancer-binding factor 1 OS=Mus musculus... [more]
sp|Q9UJU2|LEF1_HUMAN7.686e-3781.25Lymphoid enhancer-binding factor 1 OS=Homo sapiens... [more]
sp|Q9YHE8|T7L1A_DANRE2.737e-3683.54Transcription factor 7-like 1-A OS=Danio rerio OX=... [more]
sp|Q800Q5|T7L1B_DANRE6.330e-3680.49Transcription factor 7-like 1-B OS=Danio rerio OX=... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A291LM020.000e+0100.00TCF-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A4Z2DJT31.927e-4356.48Lymphoid enhancer-binding factor 1 (Fragment) OS=S... [more]
A0A183SW481.942e-4347.73HMG box domain-containing protein OS=Schistocephal... [more]
A0A183LKJ82.741e-4252.45HMG box domain-containing protein OS=Schistosoma m... [more]
A0A0L8IAY82.880e-4250.79HMG box domain-containing protein (Fragment) OS=Oc... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lef17.116e-3881.25lymphoid enhancer binding factor 1 [Source:NCBI ge... [more]
lef11.096e-3781.25lymphoid enhancer binding factor 1 [Source:NCBI ge... [more]
tcf7l1b1.296e-3784.62transcription factor 7-like 1-B [Source:NCBI gene;... [more]
tcf7l1b2.124e-3784.62transcription factor 7-like 1-B [Source:NCBI gene;... [more]
tcf7l27.823e-3783.33transcription factor 7 like 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004973.17.547e-1980.95pep scaffold:Pmarinus_7.0:GL479925:4219:8952:-1 ge... [more]
ENSPMAT00000008165.14.384e-1136.49pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 ... [more]
ENSPMAT00000006684.11.091e-734.72pep scaffold:Pmarinus_7.0:GL477399:28105:35473:-1 ... [more]
sox102.092e-630.00SRY-box transcription factor 10 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ROX14.969e-633.33Heme-dependent repressor of hypoxic genes; mediate... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326182.577e-3980.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476887.623e-933.33Predicted protein; Sox family protein 2 [Source:U... [more]
EDO437464.226e-835.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387551.058e-734.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335161.282e-739.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lef12.502e-3882.50lymphoid enhancer binding factor 1 [Source:NCBI ge... [more]
lef13.066e-3882.50lymphoid enhancer binding factor 1 [Source:NCBI ge... [more]
tcf7l11.714e-3783.54transcription factor 7 like 1 [Source:NCBI gene;Ac... [more]
tcf7l12.683e-3783.54transcription factor 7 like 1 [Source:NCBI gene;Ac... [more]
tcf79.210e-3771.74transcription factor 7 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Transcription factor 7-like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017328.10.000e+096.48SMESG000017328.1[more]
SMESG000017328.10.000e+096.47SMESG000017328.1[more]
SMESG000009225.12.244e-4156.58SMESG000009225.1[more]
SMESG000009225.12.245e-4156.58SMESG000009225.1[more]
SMESG000009225.12.633e-4156.58SMESG000009225.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025683 ID=SMED30025683|Name=Transcription factor 7-like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3078bp
GGCGGATTTTTTATTTATTTATTATTTTCTAATTTTGTTAGGTGATGCCA
CACATGAATTCGTCAAGTGATGATTTAACTTTCACTGACGAAGTAAAGGT
ATATAAAGATGAGGGTGATGAAGAAGAGCAAGAAAAGTCAGCTGAGAATC
TAAAAGAAGATAAAGTGGGTTTAGTTAACGAAGGCGAAGAAAAAACTCCT
TTGGAGTTTGATATTTATAACAAACAATATGCAGCTTCAATGTTCAAAGT
GCCATTTTCAACTGATCCAAGATTTGCGAATTATTTCATGTCAAATTATT
CAGGCTACATGAATGGTAGTTCAAATCCTTCAACATTTATGGGTAATAAA
ATGCCTCTAATGTCTTCATCTGTACAAAATCCATTTAATTTTATTCCATT
TCCAATTCACGACCCATTTGCTCAAAATATTGCTAGTCCACGTTATTTAT
TACCAGATCCTAAAAGAATTGCTGCAGCAGCAGCTGCGCATTTCTATTCA
TTACCATCCACCTCACAATTACATGAAGCGTGGAACTGTGACGTGCTCTC
TTCTCAGCAGCAGCAGTCTCTACTTGGTTCACACAACCACGATAACAATA
ATACCACAAAATCCACACCGAATTCAAGCTCCAACAGATTATCTTTCTCT
GTTTCTTCGATTGCTGATAGTGATAAAAGCAATTCCTCTAGGATATTAAC
CGATTCAAGATCAGCAGCTGATTTCCCCGGCAACAATTCTGTCCTTCATT
CTGGAATGCCTCTTTCTCCAAGTATGTTTGCGGCAGCTGCTGTTGCCGCA
GCGCAGGCAGCAGCATTTAGCAGTTCCAACTCAAGTCCTGACGTCAGTTC
ATTACATAAAGCAGCTGCTGCCCATTTACGGTTTTTGTCATCCCTCCATT
ATCAGAAGCAACAACACTCGCCAGCTAGTAATGGACTCAATATGGTCAGT
TGTTACTCAAATCCGGATCTCGTGTCGTCTCGTAATGTAAATCAAGGTAA
ATATCACAACTACGGTCCTACTATGCATCAGAAAACTACCGCAGATGATA
GAAAAACCTATACAGAATCTCTAGTCCCAGATCGCTATCATCAGTCGTCT
GATTCAATCCGGCACGTTTCAGGGTTCCCGGGAGACAACTCTAGCATTGA
ACCTCGGAAAACCTTGTATTCGAGCAGGAATTCAGTGGATCAGCGAGGAT
CAGTCACTTCTCCAGATTCACCAAAAAAGCCTCACATTAAGAAACCCCTT
AATGCATTTATGCTTTTTATGAAAGAAATGAGACCAAAAGTTCAAGAAGA
GTGTACACTGAAGGAATCTGCTGCAATTAATCAAATTTTAGGTAAAAAAT
GGCATGAGTTGTCTCGGGAAGATCAAACTAAATATTATGAGTTAGCGAGA
AAAGAAAAAGAACTTCATCAACAATTATATCCCGGATGGTCAGCTAGAGA
TAATTATGCTTCCCATGCTAAAAGAAGGAAAAAGAGGAAATTACTCAATT
CATCTATGCTAAATTCAAGAGATGGTTTTTTGTCAATGAATATGATGCCT
ATGAATCACTATGGTCCAAACAATTCCGGTTATGGGGATCGGCATCCTTG
TGATATGCGCACAAATCGTTCCAATACCGATTCTGGTAGCAGGAACAATT
CCATGGACATTCTAATGTGCAATGAAACCGGTCGACGTCCGAATGGTGCC
TCAATTCAAGGTATGCACGCATCTGGACCAACAACAAATGGTAGCAATCC
AAAAAAGTGCCGAGCACGTTTCGGATTGGAGCATCAAAATCTATGGTGTA
AACCTTGCAGACGAAAAAAGAAATGTGTTAGGTTTATTTACAATACGACA
GATGATAGTTTGGCAGAATTAGTGCAAACAATCAATCCAGACTCTACCAA
GCAGGAAAACCGAATGCGCCATGCTCGAATAGATAGTTCATATTTGAACA
AGTCGCCGCCATTGCAAAACAATCGACATATGTCATCACCTGGAATGGAA
CACATAGATGAAATTGGTTCTTATCACATTGATGCAAACAGTTCTTTCCG
TTCATTTTCATTATTGAACCATTCATCAAATAATTCTTCGAATATCGACC
ATAGAAAATCTCCCAATTTCGATTACTTCAGTCATCCCAAAAAGCACCTA
CGATTGGATAATGGTGATAAGAAGTTCAATCGTAAGCGTCATATTTCCGT
GAGTTCCATAGAGAATGACGATCAAACCGCCAGTCGCAGTCCACCAAGTT
CAGCAGAAAACAAAGACAAATTGATCAACAGATCAGTTTCTAATCATTCA
ATCGAATACCATCTCAATTCGAAATTTGAATCCAGCCAAAATAACAGCAA
TCCTAACTGTCAACTGTCGTCTGACATGATCGGGTTCGAGTTTTCTAATA
ACAGCCACGGTAATTCTTTTGCACTGGACAAAGTCTTATCTAACGAGTAC
GTTGCTGTTTCCAAATCATCATTATCAGCAGCAGCAACAGCGGCAACATC
AGCAGCAGCAACAGCAGCAGCAGCATCAGCAGCAGCAGCAGCAATCTCGG
AATCAGAATTAAACAAATTGTCAAAATGGGAAGCCTCAGTGGGAAATCCT
CAGTCGATAACAACAATTTCAACCCCTCCAACTCCCGCCATGTATTCTGA
ACTCGAATATTCATCGTTAGTTCCGCAAATATCTCACTTGAATCGTCACT
GTGAAAGTCGGGATGAATCTCCTCCATCTGCAGACAATGAAAAGTCAAAT
AAAAAACCGAAAAAATCCAACAATGATGATGAAGATGAAGATGATGATGA
TAAGTCCAATAACAATATACATGGCAAAATCAAACAGGAACATGACGAAT
TTCGAGATCCATCTGACAGTTCCCAGCATTATTCAGAATCTGTTGCTTCA
GAACCCCTTCGTTTATCGACCTTAACACCTTTGGTGAAATAATTAAAACG
CTTTTCTTCCTGATCGAATTCTCATGAATGAAAATATTCACCGTAATTAT
TCTGTTCTTGGAACTGACTCTCACTCATTACTATTCGAGTTGGTGGATTA
TCTCTCTCTCTCTCTCTAAATATTATAA
back to top

protein sequence of SMED30025683-orf-1

>SMED30025683-orf-1 ID=SMED30025683-orf-1|Name=SMED30025683-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=966bp
MPHMNSSSDDLTFTDEVKVYKDEGDEEEQEKSAENLKEDKVGLVNEGEEK
TPLEFDIYNKQYAASMFKVPFSTDPRFANYFMSNYSGYMNGSSNPSTFMG
NKMPLMSSSVQNPFNFIPFPIHDPFAQNIASPRYLLPDPKRIAAAAAAHF
YSLPSTSQLHEAWNCDVLSSQQQQSLLGSHNHDNNNTTKSTPNSSSNRLS
FSVSSIADSDKSNSSRILTDSRSAADFPGNNSVLHSGMPLSPSMFAAAAV
AAAQAAAFSSSNSSPDVSSLHKAAAAHLRFLSSLHYQKQQHSPASNGLNM
VSCYSNPDLVSSRNVNQGKYHNYGPTMHQKTTADDRKTYTESLVPDRYHQ
SSDSIRHVSGFPGDNSSIEPRKTLYSSRNSVDQRGSVTSPDSPKKPHIKK
PLNAFMLFMKEMRPKVQEECTLKESAAINQILGKKWHELSREDQTKYYEL
ARKEKELHQQLYPGWSARDNYASHAKRRKKRKLLNSSMLNSRDGFLSMNM
MPMNHYGPNNSGYGDRHPCDMRTNRSNTDSGSRNNSMDILMCNETGRRPN
GASIQGMHASGPTTNGSNPKKCRARFGLEHQNLWCKPCRRKKKCVRFIYN
TTDDSLAELVQTINPDSTKQENRMRHARIDSSYLNKSPPLQNNRHMSSPG
MEHIDEIGSYHIDANSSFRSFSLLNHSSNNSSNIDHRKSPNFDYFSHPKK
HLRLDNGDKKFNRKRHISVSSIENDDQTASRSPPSSAENKDKLINRSVSN
HSIEYHLNSKFESSQNNSNPNCQLSSDMIGFEFSNNSHGNSFALDKVLSN
EYVAVSKSSLSAAATAATSAAATAAAASAAAAAISESELNKLSKWEASVG
NPQSITTISTPPTPAMYSELEYSSLVPQISHLNRHCESRDESPPSADNEK
SNKKPKKSNNDDEDEDDDDKSNNNIHGKIKQEHDEFRDPSDSSQHYSESV
ASEPLRLSTLTPLVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005667transcription factor complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007275multicellular organism development
GO:0060070canonical Wnt signaling pathway
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0008013beta-catenin binding
GO:0008134transcription factor binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000036eye
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR024940TCF/LEF
IPR009071HMG_box_dom
IPR027397Catenin_binding_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 26..46
NoneNo IPR availableSMARTSM01366c_clamp_2coord: 569..599
e-value: 2.9E-16
score: 70.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 722..744
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..45
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..390
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 918..940
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 14..45
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..398
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 717..744
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 881..963
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 881..909
NoneNo IPR availablePANTHERPTHR10373:SF38PROTEIN PANGOLIN, ISOFORM Jcoord: 8..686
NoneNo IPR availableCDDcd01388SOX-TCF_HMG-boxcoord: 397..468
e-value: 2.97943E-34
score: 123.562
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 397..467
e-value: 1.0E-21
score: 88.2
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 398..465
e-value: 2.2E-20
score: 72.9
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 398..466
score: 15.941
IPR027397Catenin binding domain superfamilyGENE3DG3DSA:4.10.900.10coord: 1..53
e-value: 3.0E-5
score: 25.5
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 396..482
e-value: 1.0E-23
score: 85.5
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 397..476
IPR024940Transcription factor TCF/LEFPANTHERPTHR10373TRANSCRIPTION FACTOR 7 FAMILY MEMBERcoord: 8..686