Anosmin-1

Overview
NameAnosmin-1
Smed IDSMED30025680
Length (bp)2433
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Anosmin-1 (SMED30025680) t-SNE clustered cells

Violin plots show distribution of expression levels for Anosmin-1 (SMED30025680) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Anosmin-1 (SMED30025680) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Anosmin-1 (SMED30025680) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025680

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30025680SMESG000033070.1 SmedASXL_015029SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025680SMESG000033070.1 dd_Smed_v4_13188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025680SMESG000033070.1 dd_Smed_v4_13188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025680SMESG000033070.1 dd_Smed_v4_13188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025680SMESG000033070.1 dd_Smed_v4_13188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025680SMESG000033070.1 dd_Smed_v4_13188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025680SMESG000033070.1 dd_Smed_v4_13188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025680SMESG000033070.1 dd_Smed_v4_13188_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Anosmin-1 vs. Ensembl Human
Match: ANOS1 (anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211])

HSP 1 Score: 102.449 bits (254), Expect = 9.711e-22
Identity = 126/567 (22.22%), Postives = 225/567 (39.68%), Query Frame = 2
Query:  476 YCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRIN-NGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKH--FPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENY--LTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY----------FTSIGHI------QPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETL 2092
            +C N+  C  C+  C  +    ++ CQ  C+    K    CL  C F++   L K G CP   + S     C   C+ D+ C   G K C S  C  +CQ+ +    GVP  P     +++ F +   S Q ++ W + +NIS   +PV++VVQ R +       ++   W+ +  T+     ++ I P   YQFR+ A + +G +G    +        P  P +P ++    + +N +G ++VT+ W  P + +  + + +Y + W  +       P            +    +E L P   YVV++ ++  +      S     + ++T     K   ++L+  ++   +    +  +    P  +      + QL +K+  K   +         + +RW P AC  ++    T SE     T       ENY  L +L F C Y++ ++   +  K   K     F TP CS                GH+      +P   +A      I+  + +    S   +K  A LY        MT F++TW  +  E    +L
Sbjct:   76 WCQNHKQCSKCLEPCKESGDLRKHQCQSFCEPLFPKKSYECLTSCEFLKYILLVKQGDCPAPEKASGFAAACVESCEVDNEC--SGVKKCCSNGCGHTCQVPKTLYKGVPLKPR----KELRFTEL-QSGQLEVKWSSKFNIS--IEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLANSTVNSDGSVTVTIVWDLPEEPD--IPVHHYKVFWSWMVSSKSLVPTKKKRRKTTDGFQNSVILEKLQPDCDYVVELQAITYWGQTRLKSAKVSLHFTSTHATNNK---EQLVKTRKGGIQTQLPFQRRRPTRPLEVGAPFYQDGQLQVKVYWKKTED----PTVNRYHVRWFPEACAHNR---TTGSEASSGMT------HENYIILQDLSFSCKYKVTVQ--PIRPKSHSKAEAVFFTTPPCSALKGKSHKPVGCLGEAGHVLSKVLAKPENLSASF----IVQDVNITGHFSWKMAK--ANLY------QPMTGFQVTWAEVTTESRQNSL 601          
BLAST of Anosmin-1 vs. Ensembl Celegans
Match: kal-1 (KALlmann syndrome homolog [Source:UniProtKB/TrEMBL;Acc:G5EDX1])

HSP 1 Score: 107.842 bits (268), Expect = 6.580e-24
Identity = 124/546 (22.71%), Postives = 221/546 (40.48%), Query Frame = 2
Query:  347 GSTILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS--QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNI---DDPVLFVVQFR--IDDLDSKLNENINKWRNLVITSKSGAIISG-IEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTR-INNGKISVTLTWQPGDSNSLLQLSNYHISW---------------------------KRVYELNENNPLVTVYD-----VPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYIST----TSVPQQKP----TEDRLIYLKED-----------NSECACGYSNKHFPFVIKNATMIND-QLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQI 1801
            GS   D ++   CQA+CL      ++ +      LK+  +    C  +  C  C   C       + C+K+C   A   +++C   C+++++    KPG CP V+ +S  +CS  C+ D  C  +  KCC S  CS  C         + PIP     R IS  +        + W T  +S     ++  LF+VQ+R  +   +S + E    W+ + + +K  AI+   + P   Y+FR  A S+ G  G    + P  +  + K P  PK +S   ++ + +G  +  + W P  S+  L + NY ISW                           KR  + +++   + + +     V +P+  T   I  L P++ Y+V+I + V   +        + +I T    ++VP+ +      + R+ +  E+            S  A    N   P  ++  T   D +L  ++   +    H   A   F ++ R T C E Q    + +    W  + V D     L  L F C+Y++++
Sbjct:   11 GSVSPDELISTRCQAQCLHLMDQRLQNNMELRKTLKHHII--QLCKEDATCSACSAPCREQFDDIKACKKSCV--ASDDRETCEDSCHYLQRIYQEKPGACPSVSNQSNYECSALCQMDGEC-PETQKCCSS-GCSRQCLKPRSSDIKLLPIP-----RNISVQERKRKRSIIIRWATGRLSKAQQNENANLFLVQWRWGLHADESAMTE----WQTVTVRNKPYAILKHLLSPGRFYEFRTAAVSQEGSLGFSSPSKPFKISKEAKAPPPPKDLSLGASKVVASGLWNQMVHWNPPPSD--LPIKNYQISWASSTKSEADAFEEQMRKKSTLEFAAHEKRSLQSDDDEEFIGIQERDRQSVVVPSHATSSEITGLFPNSVYLVEIHASVDSSDGELHGEKGVVFIRTADSLSAVPEDREPYTGPKARIAHGSEELKIEASLKDLKTSSHAPNRPNSPQPAHLEIQTPFFDTELQTQLNWLNAA--HCTPAKRQFSVKVRKTLCREYQPNHHSDTR---WHDLRVTD-CSALLKGLSFDCDYKVEV 533          
BLAST of Anosmin-1 vs. Ensembl Fly
Match: Kal1 (gene:FBgn0039155 transcript:FBtr0084549)

HSP 1 Score: 50.447 bits (119), Expect = 5.184e-6
Identity = 61/269 (22.68%), Postives = 112/269 (41.64%), Query Frame = 2
Query:  635 KPGVCPKVTQKSQ----CSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGV------PPIPSAPTVRQ-------ISFDKNPDSIQFDLDWKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSV 1390
            + G CPK+ ++S+    C + C+ D  C  +  KCC S     SC        GV      PPIP     R+       +  + +     F ++ +++   +     L   Q++   ++  + ENI         SK   I   + P   Y+ R+ A +  G +G  E + P      PK P SP        + +   +++ L W P  SN  L +  Y I+W  +Y  +    ++T  +        Q+ I+ L+P++SY +++ ++
Sbjct:   94 RAGSCPKIGRQSRARLSCLDNCQYDHEC-PEVQKCCPS-----SCGPMCVEPLGVRNNTQLPPIPKILYFRRSRGHAVDLKIESSLLVYYFHVEVRSHIGRHFAARKLGPWQWQ--KVEKTMEENIGH-------SKHTYIFFHMRPGRWYEVRVAAVNAYGFRGYSEPSDPFPSTGNPKPPKSPNDSKIIGKQFDGRYMTLKLVWCPSKSN--LPVEKYKITWS-LYVNSAKASMIT--NSSYVKDTHQFEIKELLPNSSYYIQVQAI 342          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: anos1a (anosmin 1a [Source:ZFIN;Acc:ZDB-GENE-000201-9])

HSP 1 Score: 97.8265 bits (242), Expect = 1.372e-20
Identity = 124/590 (21.02%), Postives = 249/590 (42.20%), Query Frame = 2
Query:  350 STILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKG--VGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQP---PCTNADLYNPPIIYQLK-VAVKKSANDSKMDAELYWV---SEQRASMTAFRITWGPIIEE 2074
            S+ L ++    C A+CL  +  S R + +  +   N  L   +C ++  C  C+  C ++ +  +  C+  C++   K    C+  C F+R   + K G CP   + S     C   C++D  C  Q  KCC +  C  +CQ  +    G P  P     +++ F++    +  ++ W + +N+S   +PVL V+Q R +       +   +W+ +  TS+    ++ I P   YQFR+ A + +G +G            D  P    S  H+S+ +T   +   SV L+W    ++  + +++Y +SW      +   P        +    T   +++L  + SY V++ +V  +  +   S   I   +T+            +++K  +     G      PF        + QL +++  K      N Y     +++W P  C  ++ ++         + ++ +++  + L+ LQF C Y++ I+ + L  +  ++     F TPSC+    +I    P   PC++  +  P ++ + + +    S     +     WV    +Q   +T +++TW  +I E
Sbjct:   29 SSALGSIFRTRCAARCLSLH--STRIALSPRHFQSNGSL--GWCQSHKQCAKCLEPCKDSWELKDGPCRDLCEHAFPKRHGECVTSCEFLRSVMVVKQGDCPPPERASGFAAACVEGCEEDGECSGQ-KKCCPN-GCGHTCQSPKNLYRGAPLKPR----KELVFEELESGV-LEVRWSSKFNVSA--EPVLNVLQRRWNYGIHPSEDGATEWQVVARTSEERVWLTDIRPGRWYQFRVAAVNVHGTRGYTTPSRHFRSSKDPPPPPAPSDLHVSD-MTFGADHSASVRLSWSI-SADLDIPVNHYKLSWS---SSDHTLPPKLKKRETVNGDSTYAELDDLRENGSYTVELQAVSYWGQVPLKSSKAILQFTTSQTQSDLEPTVSPVFIKPQSDLLDVGT-----PF------YQDGQLQVRVYWKKKDPTVNRY-----RVQWAPEFCSHNRSRTQ--------EKLITQENFAS-LSGLQFSCKYKVIIQPVGLKGRAQVE--STTFYTPSCA----TIQSKSPKPIPCSSVPVVQPKVLVKAENLTAAFSVYLGNVTGLFSWVVAMPQQPQQVTGYQVTWAEVITE 569          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: anos1b (anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13])

HSP 1 Score: 97.0561 bits (240), Expect = 2.381e-20
Identity = 126/549 (22.95%), Postives = 232/549 (42.26%), Query Frame = 2
Query:  359 LDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQ-KNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRIN-NGKISVTLTWQ-PGDSNSLLQLSNYHISWK-RVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTF-RNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMIND-QLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKK 1972
            L+ M    C ++CL  +   I +   +   L+N  ++  +C N+  C  C+  C    +T      K C++H       C+    F+R  ++ K G CP   + S     C   C  D  C   G K C S  C  +CQ       GVP  P     R ISF ++       + W + +N+S   +PVL+V+Q R +       +  + W+ +++T +  +++  I P   YQFR+ A +  G +G    +        P  P +P++       ++ +G +SV + W+ P +S+  L + ++ ++W  R    +  +    V D  +    TQ  ++ L P+  Y  +I ++  + +N   SS  +I + +T+   Q   T        E ++E    +S+     +   A   +D QL +K+  K  ++  +     S+ +RW P  C  +  K        D +T  V+      +T L F C Y++ ++ +A    ++         TP C    + +G  + P   A     P   QLK A+++
Sbjct:   30 LEKMESARCVSRCLTLH---ITQITAAFRHLQNDRVL-GWCENHRRCSQCLQPCKELWETRRALSPKTCEHH------ECVTSAEFLRSLRVQKQGDCPPAQRASGFAAACVESCARDREC--SGVKKCCSNGCGHTCQSPANLFKGVPLKPR----RDISFSEDHQG-HVKVTWMSKFNVS--VEPVLYVLQRRWNHGIHPSEDEASAWQTVLMTMEDRSVLKDIRPHRWYQFRVSAVNSQGTRGFTTPSKHFFSVRDPLPPETPQNARTANQTLHPDGTVSVLVLWETPRESD--LVVHHHKVTWSPRGTPSSSQSRAGRVTDGDV----TQMELQGLQPNTPYTAQIQAISYWGQNRLKSSRAHISFTTTS---QNSATSSN----GEFSNELPVSHSSPSVLRLEAAAPHYHDNQLQVKVFWKSRVQ-ESQKDSSSYILRWYPEVCSHNVTK--------DEKTATVQG-THYVITGLLFACKYRVAVKPVAEQRSEVTT----SVTTPLC---LSLMGRRKKPAACAREERHP---QLKKALRR 526          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: anos1b (anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13])

HSP 1 Score: 97.0561 bits (240), Expect = 2.381e-20
Identity = 126/549 (22.95%), Postives = 232/549 (42.26%), Query Frame = 2
Query:  359 LDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQ-KNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRIN-NGKISVTLTWQ-PGDSNSLLQLSNYHISWK-RVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTF-RNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMIND-QLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKK 1972
            L+ M    C ++CL  +   I +   +   L+N  ++  +C N+  C  C+  C    +T      K C++H       C+    F+R  ++ K G CP   + S     C   C  D  C   G K C S  C  +CQ       GVP  P     R ISF ++       + W + +N+S   +PVL+V+Q R +       +  + W+ +++T +  +++  I P   YQFR+ A +  G +G    +        P  P +P++       ++ +G +SV + W+ P +S+  L + ++ ++W  R    +  +    V D  +    TQ  ++ L P+  Y  +I ++  + +N   SS  +I + +T+   Q   T        E ++E    +S+     +   A   +D QL +K+  K  ++  +     S+ +RW P  C  +  K        D +T  V+      +T L F C Y++ ++ +A    ++         TP C    + +G  + P   A     P   QLK A+++
Sbjct:   30 LEKMESARCVSRCLTLH---ITQITAAFRHLQNDRVL-GWCENHRRCSQCLQPCKELWETRRALSPKTCEHH------ECVTSAEFLRSLRVQKQGDCPPAQRASGFAAACVESCARDREC--SGVKKCCSNGCGHTCQSPANLFKGVPLKPR----RDISFSEDHQG-HVKVTWMSKFNVS--VEPVLYVLQRRWNHGIHPSEDEASAWQTVLMTMEDRSVLKDIRPHRWYQFRVSAVNSQGTRGFTTPSKHFFSVRDPLPPETPQNARTANQTLHPDGTVSVLVLWETPRESD--LVVHHHKVTWSPRGTPSSSQSRAGRVTDGDV----TQMELQGLQPNTPYTAQIQAISYWGQNRLKSSRAHISFTTTS---QNSATSSN----GEFSNELPVSHSSPSVLRLEAAAPHYHDNQLQVKVFWKSRVQ-ESQKDSSSYILRWYPEVCSHNVTK--------DEKTATVQG-THYVITGLLFACKYRVAVKPVAEQRSEVTT----SVTTPLC---LSLMGRRKKPAACAREERHP---QLKKALRR 526          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: ANOS1 (anosmin-1-like [Source:NCBI gene;Acc:100535716])

HSP 1 Score: 93.9745 bits (232), Expect = 4.497e-20
Identity = 84/332 (25.30%), Postives = 145/332 (43.67%), Query Frame = 2
Query:  308 FILISFYGIMSVTGSTILDTMLEPI----CQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVY 1267
             ILI F+   ++      +++   +    C ++CL  +   I  S    ++  N  L+  +C N+  C  C+  C  +    EN CQ  C+    K    CL  C F+R  +  K G CP   + S     C   C  DS C     KCC S  C  +CQ  +    G P  P     + + F ++P S Q +L W + +N+S   +PVL+V+Q R +       ++   WR++   S+   ++S + P   YQFR+ A + +G +G    +        P  P  P  +    ++   +G +S+ + W  P +S+  + + +Y I W   +
Sbjct:    8 IILIMFWSSATLDARKADESLSGSVQRARCASRCLSLHITRI--SAAFRHLQSNGSLV--WCENHKQCSKCLEPCRASWDLKENQCQDLCETQFPKKHYECLTSCEFLRSVQTLKQGDCPAEEKASGFEAACVQSCDSDSDCTSL-KKCC-SNGCGHTCQTPKNVYKGSPLKPR----KDLQFVEHP-SGQLELRWSSRFNVSV--EPVLYVLQRRWNSGIHPTEDHATHWRDIAQVSEERVVLSDVRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSHRDPSPPPCPSALRVVNMSVCADGLLSLRIHWSLPAESD--VPVHHYKIFWSSTH 324          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 104.76 bits (260), Expect = 1.636e-22
Identity = 117/553 (21.16%), Postives = 221/553 (39.96%), Query Frame = 2
Query:  476 YCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY-FTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQ---RASMTAFRITWGPIIEEPIDETL 2092
            +C N+  C  C+  C       +N C   C+    K    CL  C F++     K G CP   + S     C   C  D+ C   G K C S  C  +CQ+ +    GVP  P     ++++FD+ P     D+ W + +NIS   +PV++VVQ R +       ++ + W+ +   +     +S I P   YQFR+ A + +G +G    +        P  P +P ++    +T  N G +SV +TW  P + +  + + +Y + W          P           ++    ++ L  +++Y+V++ ++  +  +   S     Y ST+      P  D++  + +  ++       K    +++       ++QL +K+  K   +   G     + ++W P +C  ++ K          +  V +DH    L  L F C Y++ +       K  +K     F TP CS     +   I  P   A + +  +     ++   +  ++ +     W   +      MT F++TW  +  E    +L
Sbjct:   78 WCQNHKQCSKCLEPCKETWDLRKNNCHNLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAAACVESCDADNEC--SGVKKCCSNGCGHTCQVPKNLYKGVPLKPR----KELTFDE-PQPGHLDIKWSSKFNIS--VEPVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPD--IPVHHYKVFWSWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYWGQVRLKSGKVSLYFSTS------PPMDQISKISKMKTDILAPPQRKRTARMLEIGAPFYQDNQLQVKVYWKKTEDSMLGL----YHVQWFPESCAHNETKGP--------EKAVTQDH-HIVLPALLFSCKYKVTVH--PARPKDHLKAESIFFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQLSKVNLHQPMTGFQVTWAEVTTESRQNSL 598          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 101.679 bits (252), Expect = 1.268e-21
Identity = 118/553 (21.34%), Postives = 222/553 (40.14%), Query Frame = 2
Query:  476 YCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY-FTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQ---RASMTAFRITWGPIIEEPIDETL 2092
            +C N+  C  C+  C       +N C   C+    K    CL  C F++     K G CP   + S     C   C  D+ C   G K C S  C  +CQ+ +    GVP  P     ++++FD+ P     D+ W + +NIS   +PV++VVQ R +       ++ + W+ +   +     +S I P   YQFR+ A + +G +G    +        P  P +P ++    +T  N G +SV +TW  P + +  + + +Y + W          P           ++    ++ L  +++Y+V++ ++  +  +   S     Y S TS P    + D++  + +  ++       K    +++       ++QL +K+  K   +   G     + ++W P +C  ++ K          +  V +DH    L  L F C Y++ +       K  +K     F TP CS     +   I  P   A + +  +     ++   +  ++ +     W   +      MT F++TW  +  E    +L
Sbjct:   25 WCQNHKQCSKCLEPCKETWDLRKNNCHNLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAAACVESCDADNEC--SGVKKCCSNGCGHTCQVPKNLYKGVPLKPR----KELTFDE-PQPGHLDIKWSSKFNIS--VEPVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPD--IPVHHYKVFWSWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYWGQVRLKSGKVSLYFS-TSPPST--SLDQISKISKMKTDILAPPQRKRTARMLEIGAPFYQDNQLQVKVYWKKTEDSMLGL----YHVQWFPESCAHNETKGP--------EKAVTQDH-HIVLPALLFSCKYKVTVH--PARPKDHLKAESIFFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQLSKVNLHQPMTGFQVTWAEVTTESRQNSL 548          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 101.679 bits (252), Expect = 1.431e-21
Identity = 118/553 (21.34%), Postives = 222/553 (40.14%), Query Frame = 2
Query:  476 YCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY-FTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQ---RASMTAFRITWGPIIEEPIDETL 2092
            +C N+  C  C+  C       +N C   C+    K    CL  C F++     K G CP   + S     C   C  D+ C   G K C S  C  +CQ+ +    GVP  P     ++++FD+ P     D+ W + +NIS   +PV++VVQ R +       ++ + W+ +   +     +S I P   YQFR+ A + +G +G    +        P  P +P ++    +T  N G +SV +TW  P + +  + + +Y + W          P           ++    ++ L  +++Y+V++ ++  +  +   S     Y S TS P    + D++  + +  ++       K    +++       ++QL +K+  K   +   G     + ++W P +C  ++ K          +  V +DH    L  L F C Y++ +       K  +K     F TP CS     +   I  P   A + +  +     ++   +  ++ +     W   +      MT F++TW  +  E    +L
Sbjct:   81 WCQNHKQCSKCLEPCKETWDLRKNNCHNLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAAACVESCDADNEC--SGVKKCCSNGCGHTCQVPKNLYKGVPLKPR----KELTFDE-PQPGHLDIKWSSKFNIS--VEPVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPD--IPVHHYKVFWSWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYWGQVRLKSGKVSLYFS-TSPPST--SLDQISKISKMKTDILAPPQRKRTARMLEIGAPFYQDNQLQVKVYWKKTEDSMLGL----YHVQWFPESCAHNETKGP--------EKAVTQDH-HIVLPALLFSCKYKVTVH--PARPKDHLKAESIFFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQLSKVNLHQPMTGFQVTWAEVTTESRQNSL 604          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 99.3673 bits (246), Expect = 6.827e-21
Identity = 117/553 (21.16%), Postives = 221/553 (39.96%), Query Frame = 2
Query:  476 YCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY-FTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQ---RASMTAFRITWGPIIEEPIDETL 2092
            +C N+  C  C+  C       +N C   C+    K    CL  C F++     K G CP   + S     C   C  D+ C   G K C S  C  +CQ+ +    GVP  P     ++++FD+ P     D+ W + +NIS   +PV++VVQ R +       ++ + W+ +   +     +S I P   YQFR+ A + +G +G    +        P  P +P ++    +T  N G +SV +TW  P + +  + + +Y + W          P           ++    ++ L  +++Y+V++ ++  +  +   S     Y S TS P    + D++  + +  ++       K    +++       ++QL +K+  K   +   G     + ++W P +C  ++ K    ++           HI   L  L F C Y++ +       K  +K     F TP CS     +   I  P   A + +  +     ++   +  ++ +     W   +      MT F++TW  +  E    +L
Sbjct:   81 WCQNHKQCSKCLEPCKETWDLRKNNCHNLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAAACVESCDADNEC--SGVKKCCSNGCGHTCQVPKNLYKGVPLKPR----KELTFDE-PQPGHLDIKWSSKFNIS--VEPVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPD--IPVHHYKVFWSWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYWGQVRLKSGKVSLYFS-TSPPST--SLDQISKISKMKTDILAPPQRKRTARMLEIGAPFYQDNQLQVKVYWKKTEDSMLGL----YHVQWFPESCAHNETKGPEKADH----------HI--VLPALLFSCKYKVTVH--PARPKDHLKAESIFFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQLSKVNLHQPMTGFQVTWAEVTTESRQNSL 601          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 98.5969 bits (244), Expect = 1.144e-20
Identity = 115/528 (21.78%), Postives = 208/528 (39.39%), Query Frame = 2
Query:  545 NCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMIND-QLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY-FTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQ---RASMTAFRITWGPIIEEPIDETL 2092
            NC   C+    K    CL  C F++     K G CP   + S     C   C  D+ C   G K C S  C  +CQ+ +    GVP  P     ++++FD+ P     D+ W + +NIS   +PV++VVQ R +       ++ + W+ +   +     +S I P   YQFR+ A + +G +G    +        P  P +P ++    +T  N G +SV +TW  P + +  + + +Y + W          P           ++    ++ L  +++Y+V++ ++  +  +   S     Y STT            ++LK+     A     +    +   A    D QL +K+  K   +   G     + ++W P +C  ++ K          +  V +DH    L  L F C Y++ +       K  +K     F TP CS     +   I  P   A + +  +     ++   +  ++ +     W   +      MT F++TW  +  E    +L
Sbjct:  103 NCHNLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAAACVESCDADNEC--SGVKKCCSNGCGHTCQVPKNLYKGVPLKPR----KELTFDE-PQPGHLDIKWSSKFNIS--VEPVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPD--IPVHHYKVFWSWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYWGQVRLKSGKVSLYFSTTL---------NNVFLKDKTDILAPPQRKRTARMLEIGAPFYQDNQLQVKVYWKKTEDSMLGL----YHVQWFPESCAHNETKGP--------EKAVTQDH-HIVLPALLFSCKYKVTVH--PARPKDHLKAESIFFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQLSKVNLHQPMTGFQVTWAEVTTESRQNSL 595          
BLAST of Anosmin-1 vs. UniProt/SwissProt
Match: sp|P23352|KALM_HUMAN (Anosmin-1 OS=Homo sapiens OX=9606 GN=ANOS1 PE=1 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 4.663e-21
Identity = 126/567 (22.22%), Postives = 225/567 (39.68%), Query Frame = 2
Query:  476 YCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRIN-NGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKH--FPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENY--LTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY----------FTSIGHI------QPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETL 2092
            +C N+  C  C+  C  +    ++ CQ  C+    K    CL  C F++   L K G CP   + S     C   C+ D+ C   G K C S  C  +CQ+ +    GVP  P     +++ F +   S Q ++ W + +NIS   +PV++VVQ R +       ++   W+ +  T+     ++ I P   YQFR+ A + +G +G    +        P  P +P ++    + +N +G ++VT+ W  P + +  + + +Y + W  +       P            +    +E L P   YVV++ ++  +      S     + ++T     K   ++L+  ++   +    +  +    P  +      + QL +K+  K   +         + +RW P AC  ++    T SE     T       ENY  L +L F C Y++ ++   +  K   K     F TP CS                GH+      +P   +A      I+  + +    S   +K  A LY        MT F++TW  +  E    +L
Sbjct:   76 WCQNHKQCSKCLEPCKESGDLRKHQCQSFCEPLFPKKSYECLTSCEFLKYILLVKQGDCPAPEKASGFAAACVESCEVDNEC--SGVKKCCSNGCGHTCQVPKTLYKGVPLKPR----KELRFTEL-QSGQLEVKWSSKFNIS--IEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLANSTVNSDGSVTVTIVWDLPEEPD--IPVHHYKVFWSWMVSSKSLVPTKKKRRKTTDGFQNSVILEKLQPDCDYVVELQAITYWGQTRLKSAKVSLHFTSTHATNNK---EQLVKTRKGGIQTQLPFQRRRPTRPLEVGAPFYQDGQLQVKVYWKKTED----PTVNRYHVRWFPEACAHNR---TTGSEASSGMT------HENYIILQDLSFSCKYKVTVQ--PIRPKSHSKAEAVFFTTPPCSALKGKSHKPVGCLGEAGHVLSKVLAKPENLSASF----IVQDVNITGHFSWKMAK--ANLY------QPMTGFQVTWAEVTTESRQNSL 601          
BLAST of Anosmin-1 vs. UniProt/SwissProt
Match: sp|Q90369|KALM_COTJA (Anosmin-1 OS=Coturnix japonica OX=93934 GN=ANOS1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.167e-17
Identity = 126/561 (22.46%), Postives = 220/561 (39.22%), Query Frame = 2
Query:  473 SYCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYE---LNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--NDQLAIKIKM-KDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENY--LTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKKS--ANDSKMDAELYWVSEQ---RASMTAFRITWGPIIEEPIDETL 2092
            ++C N   C  C+  C  +     N CQ  C+    K    CL  C F++     K G CP   + S     C   C+ DS C   G K C S  C  +CQ+ +    GVP  P     +++ F +   S   ++ W + +NIS   +PV++VVQ R +       ++   W+ +  T+     +S I     YQFR+ A + +G +G    +        P  P +P +I    ++  N+G ++V +TW  P + +  + + +Y + W   Y    +        + D P    +    +E L P+++Y V++ +V  +  I   S     + STT   +    +  +    +   +    +  +     +K  T    ++QL +KI   K GI  +       FQ+     +C  +  K             V +   ENY  L +L F C Y  ++ ++   +K   K     F TP CS  F    H    C   ++   P +      +  S    +  +     W   +      MT F++TW  +  E    +L
Sbjct:   69 AWCQNYKQCSKCLEPCKESWDLKRNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACFESCEADSEC--SGVKKCCSNGCGHTCQVPKNLYKGVPLKPR----KELKFIEL-QSGDLEVKWSSKFNIS--IEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPSNIRIANISANNDGTVNVMITWDLPEEPD--IPVHHYKVFWSWTYSKYVIPAKKKRRKITDGP----QNYVVLEGLQPNSNYNVELQAVTRWGQIRLKSAKVSLHFSTTQDNRNNNEQTSVEKPPKGVVDPYPTFQRRKPTRFLKIGTPFYQDNQLQVKIYWKKSGINMNQ------FQVHSLLESCTHNDTKGLEK---------VTELTYENYMILKDLSFSCKY--KVTVLPAKSKSRFKAESIFFVTPPCST-FKEKTHKHINCAAEEVPVLPKVLAKPENLSASFIVQEGNITGHFSWKISKAVLHQPMTGFQVTWAEVTTESRQNSL 596          
BLAST of Anosmin-1 vs. UniProt/SwissProt
Match: sp|P33005|KALM_CHICK (Anosmin-1 OS=Gallus gallus OX=9031 GN=ANOS1 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.439e-17
Identity = 113/491 (23.01%), Postives = 199/491 (40.53%), Query Frame = 2
Query:  473 SYCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYE---LNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI---------NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENY--LTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKY 1879
            ++C N+  C  C+  C  +    +N CQ  C+    K    CL  C F++     K G CP   + S     C   C+ DS C   G K C S  C  +CQ+ +    GVP  P     +++ F +   S   ++ W + +NIS   +PV++VVQ R +       ++   W+ +  T+     +S I     YQFR+ A + +G +G    +        P  P +P +I    ++  N+G ++V +TW  P + +  + + +Y + W   Y    +        + D P    +    +E L P+++Y V++ +V  +  I   S     + ST         ++R    +    +   G  + +  F  +  T           ++QL +K+  K      N      FQ+     +C+ +  K             V +   ENY  L +L F C Y  ++ ++   +K   K     F TPSCS +
Sbjct:   69 AWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSEC--SGVKKCCSNGCGHTCQVPKNLYKGVPLKPR----KELKFIEL-QSGDLEVKWSSKFNIS--IEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPSNIRIANISANNDGTVNVMITWDLPEEPD--IPVHHYKVFWSWTYSKYVIPAKKKRRKITDGP----QNYVVLEGLQPNSNYNVELQAVTRWGQIRLKSAKVSLHFSTAQ-------DNRNNNEQTSAGKPPKGLVDPYPTFQRRKPTRFLKIGTPFYQDNQLQVKVYWKKTDINMN-----QFQVHSLLESCVHNDTKGLEK---------VTELTYENYMILKDLSFSCKY--KVTVLPAKSKSRFKAESIFFVTPSCSAF 521          
BLAST of Anosmin-1 vs. TrEMBL
Match: G7YFS9 (Anosmin-1 OS=Clonorchis sinensis OX=79923 GN=CLF_106826 PE=4 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 3.896e-62
Identity = 204/782 (26.09%), Postives = 332/782 (42.46%), Query Frame = 2
Query:  308 FILISFYGIMSVTGSTILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNP-YCKGCMIGCSNAAQTAENCQKNCKNHAK--------KFQQSCLFGCNFVRK--TKL---NKPGVCPKVTQKSQ----CSNECKDDSVCFKQGT-KCCKSLYCSFS------------CQMSEYPKFGVPPIPSAPTVRQI--------SFDKNPDSIQFDLDW-KTYNISNIDD--------PVLFVVQFRI----------------DDLDSKL-------NENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENN-PLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLA--IKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMAL---STKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNA-------------DLYNP--PI-------IYQLKVAVKK------SANDSKMDAELYWVSEQRASMTAF-------------------------RITWGPIIEEPIDETLYGKDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQAIDEYSVSEEISIFF 2263
             +L+  +   ++  + ++D + E  C A+C   +  S+   D    + ++P L   +C+N    C  C+  C         C + CK++ K          +Q+CL  C F R+  T+L   N+  + P   +       C   C+ D+ C  +G  KCC +  C+ S            C        GVP +P+ P+V+Q+        S     ++ Q +LDW   YNI+            P +F++Q R+                D  DS +       +   ++WR+LV T+K GA++S + P   YQFRLLA S  G  G GE + PI +  +P  P+SP++++E  +RI+   + VT+ WQP  + + L L  Y I+W+R Y  N  +    T Y+  +P  +T Y IENL P+ SY +++ +V  F      S P   YI+T  +P +    +  I L   N  C C  S    P  I  A     QL   + ++ ++G    N      + I W P  CIE+++     +     +     + ++  LT+L F C+Y++ +   +    +T++  +FW+ CFCTP C       G     CTN               L +P  PI       I Q++    +      SA+ +  DA + W      +  AF                         R+TWGP + EP+ E  Y     P LD  +A SKVV       +L+ L    +Y+V +Q I E +     +IFF
Sbjct:    8 LLLMGHFLCSNLLSADLMDLISEATCAARCFALFSQSLTGQDKLF-LQQHPELTQPHCINQKGACSLCLDVCQWPRAQTVQCNETCKDYIKTAERVNILNAEQTCLDACTFARELYTRLDQFNRGQLAPHCPRPESWPPVCGPHCRTDADCPSKGLHKCCPTTVCAASSNAPANNSWTQICTPGILTSSGVPFVPARPSVKQLDSVIANTSSSQPAQETHQLELDWLNYYNITRAKPNGWGPNLYPAVFLIQLRLFHDPSASITFEDPNQPDARDSNVIDPTLFADRLFDEWRSLVWTTKLGAVLSDLRPGTWYQFRLLAISSAGHGGWGEPSRPIKILTRPIPPSSPRNLTEARSRISESVVDVTIQWQPPLAGN-LPLKKYQITWRRYYGFNGGDRGSFTEYEANVPGDKTIYLIENLEPATSYKIEVKAVSVFEGKELPSHPVSLYITTLPIPDRTVARNN-IQLLSPNETCRCDLSPFQ-PIKIGEAFYEEKQLKALLSLRAENGQLQRNK----QYTIEWGPRVCIETRYSQGQPAYLNHKKIAYGYEVVQLELTHLLFQCHYKVTVSEYSTKQPTTQQRPRFWQACFCTPPCHTVTVRTGPAPINCTNTASFGSMEPMKLTYKLLDPKDPIPKANNFYILQMEQTGHELAPRLTSASSTHYDAMVNWKLSGEGTHNAFETRRRFRALPNHREQEKTDPGVRGIRVTWGPRVYEPVAEESYHNGLKPYLDPERAQSKVVDPRHSSLILRRLQPNTLYIVHVQMISEDTDGPVSTIFF 781          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A4E0RJI8 (Anosmin-1 OS=Fasciola hepatica OX=6192 GN=D915_000736 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 6.629e-60
Identity = 215/808 (26.61%), Postives = 344/808 (42.57%), Query Frame = 2
Query:  308 FILISFYGIMSVTGSTILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNP-YCKGCMIGCSNAAQTAENCQKNCKNHAK--------KFQQSCLFGCNFVR-----KTKLNKPGV---CPKV-TQKSQCSNECKDDSVCFKQGT--KCCKSLYC----------------SFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSI------------QFDLDW---------KTYNISNIDDPVLFVVQFRI-DDLDSKLN--ENIN---------------KWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQ--LSNYHISWKRVYELN-ENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQL--AIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKII-KFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAV-------KKSANDS--KMDAE-----------LYW--------VSEQR----------------ASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQAIDEYSVSEEISIFFK--SHFEKNSKSNTRLLTFFMISLASVVCFY 2350
            F L+   G++S   + ++D + E  C A+C + + +S+   D    + + P L   +C+N    C  C+  C       + CQ++CK            +F+  C   C F R     K KL++  +   CP+V +  + C   C+ D+ C   G+  KCC +  C                S  C +       VP +P  P V+Q+    +P+S             Q +LDW         + +  S    P +F+VQ R+  D  + ++  E+ N               +WRNLV T+K GA++S + P   YQFRLLA S  G  G G+ + PI V  +P+ P SP++++E  TRI    + VT+ WQ   S  ++   L  Y ++W+R Y  + ++    T Y+  +P  +T YTI+NL P+ SY +++ +V  F      S P   Y++T  +P ++   D    +   N  C+C     H    +      N QL   I++ ++   +    Y      I W P  CIESQ  +A        QT+   +     L NL+F C+Y++ I+  +   +    + W  CFCTPSC   F +     P C    ++      QL   V        +SA +S  K D++           L W        V  +R                +S+   R+TWGP I EP+    Y     P LD   A SKVV       +LK L  E +Y+V +Q I ++S     +IFF   S  E N+ ++T    F++     V+  Y
Sbjct:   11 FFLLCSNGLLS--QADLMDMISEASCAARCFRQFTESLDGPDKLF-LQQRPDLTQPHCINQKGECALCLEICQWPRSHTKRCQESCKEFPNPSISQFTIRFEPVCNQICTFARDLYARKEKLDRGELSTYCPRVESWPAVCYPTCQTDNDCLPLGSMQKCCSNSVCPEIKLQPTKSNGNGSQSHICTLGVPAIDAVPLVPGQPAVKQVEIIPDPESASVALQTTVPQQYQVELDWLDYYNRTAAQAFGWSTTYYPAVFLVQLRLFHDPSASVDFFEHANPSSLEPSSIADRLFGEWRNLVWTTKLGAVLSDLTPGTWYQFRLLALSSEGHGGWGQPSWPIRVRTRPEPPMSPRNLTEAKTRIFENNVDVTINWQ---SPKIVTHPLKKYQVTWRRYYGFHGDDRSSFTEYEANVPTDKTTYTIQNLKPATSYKIEVKAVSVFEGKELKSHPISLYLNTIPIPSKQSENDHSFNV---NDTCSC-RDKTHPEITVLRIYHENQQLKATIRVNLESETQRRKQYV-----IDWVPRVCIESQSNTAQDDYVPQRQTVRGSELSMVTLDNLRFQCHYKVIIKPTSDRKESTSHREWFACFCTPSCQSVFLNSNTPPPNCPILGIFETMQPMQLTYTVFPESQTAMESARNSLIKTDSQQISSAKTYNAVLKWAPLPVGVDVESKRSFRALNNVRTSKHTSASSIRGVRVTWGPRIYEPVALEAYQNGLFPHLDPESAQSKVVDPKSSTFILKGLERETLYIVHVQPIGDHSDGPTSTIFFAIPSTAESNAPTSTNCPVFWIAVFCVVMTSY 803          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A0R3W6X8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5986 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 2.383e-51
Identity = 204/831 (24.55%), Postives = 338/831 (40.67%), Query Frame = 2
Query:  314 LISFYGIMSV--------TGST--ILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLN-NPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQ------------SCLFGCNFVRKTKLNK--------PGVCPKVTQ-----KSQCSNECKDDSVCFKQG-TKCCKSLYC---------------------------------SFSCQMSEYPKF---GVPPIPSAPTVRQISFDKNP-DSIQFDLDWKTY-NISNIDD------PVLFVVQFRI-DDLDSKL-------------NENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQK-PTEDRLI--YLKEDNSECACGY----SNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIK-FWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNP--PI--------------------------------IYQLKVAVKKSANDS-KMDAELYW--------------------------VSEQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTF 2314
            ++S +GI+ V        TG T  I D + E IC A+CL ++  S+ E + +  + + P L   +CL+    C  C+  C    Q   +C+ +CK       Q            +CL  C F    + ++        P  CP  T        Q    C  D+ C      KCC+   C                                  F  +++    F   G+PP+PS P+VRQ +  +   D  + +LDW  Y N+S   D      P +F+VQ R+  DL  +               E  ++WR+LV T+K GA++S + P   YQFRL A S  G  G G  +LP+ +   P+   +P++++E   RI + K+ V L W+P    S + +  Y +SWK+   ++ ++  +  Y+  +P     YT+++L P  SY V++ SV       + S P   +I T  VP ++ P   R +  ++K  +++  C +      ++F   +K+ T+                         F + W P  CIE+       +       +   D  +  L NL+F C+Y++QI +   S KK  K   + CFCTPSC++     G     C+ AD+  P  P+                                I+ ++ A K   + S   DA ++W                            E R     +R+ WGP + EPI+  +Y     P LD  +  SKVV   VH  +L++L  + +Y+V++Q I  +  S   ++FF +  + +  + T L TF
Sbjct:    1 MVSSHGILLVILTILELLTGGTADITDMIGEAICAAQCLTNFTLSLDEPERTF-LSQRPDLTEPHCLSKRSNCSLCLEVCRWPRQNISSCESSCKQLEASVLQMLPNSPLEIHRRTCLEACTFSHTNRRDRAAVVSGQLPASCPLPTSWPDGSTCQPHQSCTTDADCGHGSLAKCCRFDACLPEHQPPPPSPSMLYRLARGGGPSTLHRPLPPTGFCMRITNDTAFAYRGMPPVPSRPSVRQTAMAQGEQDVYKLELDWPDYYNLSRSADLPEWIHPAVFLVQVRLFRDLGEQFFGDQSEFGDEIFQEELFSEWRSLVWTTKVGAVLSDLSPGTWYQFRLKAASGAGFGGNGRPSLPVKLMTLPE---APRNLTESNLRIYSNKVEVKLQWEPPAYGS-VPVKFYRVSWKKYAPIDMDDNSLGEYEAKVPKKVLAYTLQDLEPGTSYKVQVTSVAIVDGKEWCSTPVTRFIKTVPVPSKEYPLNGRRMTEFVKNVHADVKCSFIRVTVTQYFGSSVKDTTI-------------------------FHLLWSPHVCIETPNSEVGLTNAPAVINVYTADLSDMDLENLRFQCHYKLQIRMTEGSLKKTSKNSLDLCFCTPSCTEVAVRSGPGPRNCSFADVLVPHRPVDVGYRLFPTEANQRHLIASGGAAISSQSETEPIFPVRNAFKTGVSQSLGFDAIIFWKPHPDMVVDTEGVGRSAKYVNPTVHPFPEARRQSRGYRVIWGPRLVEPIEPDMYSNGIAPQLDPERTESKVVDSKVHNVILRNLEPDTLYIVQVQTIGAHGDSPVNAVFFTTPSKSHCFNPTYLCTF 801          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A1S8WKC7 (Fibronectin type III domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09308 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.795e-50
Identity = 172/637 (27.00%), Postives = 277/637 (43.49%), Query Frame = 2
Query:  584 QQSCLFGCNFVRK--TKLNK--PGV----CPKV-TQKSQCSNECKDDSVCFKQGT-KCCKSLYCSFS------------CQMSEYPKFGVPPIPSAPTVRQI--------SFDKNPDSIQFDLDW-KTYNISNIDD--------PVLFVVQFRI---------------------DDLDSKL--NENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENN-PLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLA--IKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMAL---STKKIIKFWEGCFCTPSCSKY-------------FTSIGHIQPPCTNADLYNP--PI-------IYQ-----LKVAVK-KSANDSKMDAELYWVSEQRASMTAF------------------------RITWGPIIEEPIDETLYGKDFMPLLDAGKA 2134
            +Q+CL  C F R   T+L++   G+    CP+  +    C   C+ D+ C  +G  KCC +  C+              C        GVP +P+ P+V+Q+        S     ++ Q +LDW   YNI++           P +F++Q R+                     + +D  L  +   ++WR+LV T+K GA++S + P   YQFRLLA S  G  G GE + PI +  +P  P+SP++++E  +RI+   + VT+ WQP  + + L L  Y I+W+R Y  N  +    T Y+  +P  +T Y IENL P+ SY +++ +V  F      S P   YI+T  +P +    D  I L   N  C C  S    P  I  A     QL   + ++ ++G    N      + + W P  CIE+++     +     +     + ++  LT+L F C+Y++ +   +    +T++  +FW+ CFCTP C                  S G I+P      L +P  PI       I Q     L++A +  SA+ +  DA + W     ++  AF                        R+TWGP + EP+ E  Y     P LD  +A
Sbjct:  161 EQTCLDTCTFARDLYTRLDQFNRGLLTPHCPRPESWPPVCGPHCRTDADCLSKGLHKCCPTTVCAAPSNAPANNSWTQICTPGILTSSGVPFVPARPSVKQLDSVIANTSSSHPTQETHQLELDWLNYYNITHAKPNGWGPNLYPAVFLIQLRLFHDPSASITFEDPNHPDARGSNVIDPTLFADRLFDEWRSLVWTTKLGAVLSDLRPGTWYQFRLLAISSAGHGGWGEPSRPIKILTRPIPPSSPRNLTEARSRISESVVDVTIQWQPPLAGN-LPLKKYQITWRRYYGFNGGDRGSFTEYEANVPGDKTVYQIENLEPATSYKIEVKAVSVFEGKELPSHPVSLYITTLPIPDRTVARDN-IQLLSPNETCRCDLSPFQ-PIKIGEAFYEEKQLKALLTLRAENGQIQRNK----QYTVEWGPRVCIETRYSQGQPAYLNHKKITYGNEVVQLELTHLLFQCHYKVTVSEYSTKQPTTQQRPRFWQACFCTPPCHTVTVRTGPAPFNCTNTASFGSIEPMKLTYKLLDPKDPIPKANDFYILQMEQTGLELAPRLTSASSTHYDAMVNWKLSGESTHNAFEKPRRFRALPNHREQNTDPGVRGIRVTWGPRVYEPVAEESYHNGLKPYLDPERA 790          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A5K3ELG7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.484e-48
Identity = 200/810 (24.69%), Postives = 336/810 (41.48%), Query Frame = 2
Query:  308 FILISFYGIMSVTGSTILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLN-NPYCKGCMIGCSNAAQTAENCQKNCKNHAKKF------------QQSCLFGCNFVRKTKLNKPGV--------CPKVT---QKSQCSN--ECKDDSVCFKQG-TKCCKSLYC------------------------------------SFSCQMSEYPKF---GVPPIPSAPTVRQISFDKNPDSI-QFDLDWKTY-NIS-NIDDP-----VLFVVQFRI-DDLDSKL-------------NENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPT-EDRLIYLKEDNSECACGYS--NKHFPFVIKNATMINDQLAIKIKM-KDGIEFHNGYAPYS---FQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKII-KFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNP----PIIYQL-------KVAVK------------------------KSANDSKMDAELYW-------VS------------------EQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQAIDEYSVSEEISIFFKS 2269
            F L +  G++S+    I D + E IC A+CL ++  S+ E + +  + + P L   +CL+    C  C+  C  + Q    C+ +C    +              +Q+CL  C F   + + +  V        CP  +   + S C +   C  D+ C      KCC++  C                                     F  Q++    F   GVPP+P  PTVRQ +       + Q +LDW  Y N+S ++D P      +F+VQ R+  DL   L              E  ++WR+LV T+K GA++S + P   YQFRL A S  G  G G  + P+ V   P+   +P++++E  +RI + K+ V L W+     S + +  Y +SWK+      ++  ++ Y+  +P T   YT+++L P   Y V++ +V       +SS+P   +I T  +P +  +   +  +   +   C CG S  N++F   I  A   +  L   + + +  +  H G +      F + W P  CIE+Q             T+         L +L+F C+Y++Q+ +      K+  K  E CFCTPSC++     G     C+ AD+  P     + YQL       +  +K                         S+     DA ++W       VS                  + R     +R+ WGP + EPI+  +Y     P LD  +A SKVV   V+  +L++L  + +Y+V++Q I  +  S   ++FF +
Sbjct:   10 FTLCAILGLLSIGLGDITDMIGEAICAAQCLTNFTQSLDEHERNF-LSQRPELAEPHCLSKRSNCSLCLDVCRWSRQKTTTCESSCGALGESVFKAFPNSPIEIHRQTCLDACTFSYASYIERASVVSGILSASCPLPSSWPEGSGCQHHRRCTTDADCSHTVIAKCCRADACHADGSLGIREHHSSSTLYRLAREGRPPALSRQTPPLGFCMQVTNDTVFAYRGVPPVPGRPTVRQTAMIPGEQEVYQLELDWPDYYNMSKSVDSPEWNSSAVFLVQVRLFRDLSGSLIGENGGLGDEILQEELFSEWRSLVWTTKVGAVLSDLSPGTWYQFRLKAASGAGFGGNGRPSRPVRVVTLPE---APRNLTETNSRIYSKKVEVKLHWESPIYRS-VPIRFYRVSWKKNTLSQVDDSSLSEYEAKVPKTVLTYTLQDLEPGTVYKVQVTAVAVVDGKEWSSLPVTRFIKTIPLPSKGHSYGAQPQFYNSEGRSCQCGDSPENRNF---IHPAFFEDGNLKTHLTIPRHFLAQHFGESVKDTTIFHLLWYPHVCIETQNSKMGLPSTPTMVTVYTATLSSMNLEDLRFQCHYKLQLRIAEEPLPKVPKKSLELCFCTPSCTEVAVKSGPSPRNCSYADILIPHQPVDVGYQLFPTETIQRHPIKSGGVVSSSQSETKPVFSVHNSFKTGSSQQPGFDAIIFWKPHPEMIVSRVPGRYTKYADMAARSPIDARLQSRGYRVIWGPRLVEPIEPGMYSNGIAPQLDPERAESKVVDSKVYNVILRNLEPDTLYIVQVQTIGVHGDSPVNAVFFTT 811          
BLAST of Anosmin-1 vs. Ensembl Cavefish
Match: anos1a (anosmin-1-like [Source:NCBI gene;Acc:103026549])

HSP 1 Score: 94.3597 bits (233), Expect = 1.695e-19
Identity = 135/595 (22.69%), Postives = 241/595 (40.50%), Query Frame = 2
Query:  350 STILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQ----KSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISE-KVTRINNG---KISVTLTW-QPGDSNSLLQLSNYHISWK-RVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITY-SSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPP--CTNADLYNPPIIYQLKVAVKKSANDSK--MDAELYW---VSEQRASMTAFRITWGPIIEE 2074
            S+ L  +    C A+CL  +   I     SH    N  L   +C  +  C  C+  C  + +  +  C++ C++   K    C+  C F+R   + K G CP   +     + C   C++D  C     KCC +  C  +CQ       G P  P     +++ F++ P  +  ++ W + +N+S   +PVL V+Q R +       +   +W+ +  TS+    +S + P   YQFR+ A + +G +G    T P       K+P  P   SE +V  ++ G    +SV ++W  P D +  + + +Y +SW   V     + P        I    T   +E L  + SY +++ +V  +  +   SS   + + +  S PQ  PT    +  K  +     G      PF        + QL +++  K      + Y     ++ W P      +F S   S  ++   ++ +D+  + L  LQF C Y++ I+     +K  ++     F TPSC+      G    P  C       PP +      +  + N  K  +     W   V +    +T +++TW  +  E
Sbjct:   27 SSALGGIFRTRCAARCLSLHSTRIPAITASH-FQSNGSL--GWCQGHKQCAKCLEPCKESWELKDGSCRELCEHTFPKRHGECVTSCEFLRSVMVVKQGECPAPERAAGFAAACVEGCEEDGECSSH-KKCCPN-GCGHTCQSPRNLFRGAPLKPR----KELLFEELPTGV-LEVRWSSKFNVS--AEPVLNVLQRRWNYGIHPSEDGATEWQVVAQTSEERVWLSDVRPGRWYQFRVAAVNVHGTRG---YTTPSRHFRSSKDPAPPPAPSELQVKHLSFGPDRSVSVHVSWAAPADLD--VPVHHYKLSWSWSVSGAELSTPPKLKRRKTINGDSTSAELEGLRENRSYTLELQAVSYWGQLPLKSSKTTLRFTTYRSEPQ--PTVSSSVPQKSQSDVLDVGT-----PF------YQDGQLQVRVYWKKRDPTVSRY-----RVHWFP------EFCSHNGSRIQE--KLITQDNYAS-LPGLQFSCTYKVIIQ--PAGSKGRVQAESTVFYTPSCASL---QGKSPKPILCPGEPATAPPKVLARAENLSAAFNVHKGNVTGLFSWVVAVPQSPQQVTGYQVTWAEVTAE 572          
BLAST of Anosmin-1 vs. Ensembl Cavefish
Match: ANOS1 (anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211])

HSP 1 Score: 82.0333 bits (201), Expect = 1.117e-15
Identity = 113/547 (20.66%), Postives = 213/547 (38.94%), Query Frame = 2
Query:  503 GCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKG--VGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGK---ISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--------NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENY--LTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLK-VAVKKSANDSKMDAELYWV---SEQRASMTAFRITWGPI 2065
             C+  C  +    EN CQ  C+    K    CL  C F+R  +  K G CP   + S     C   C++D+ C     KCC S  C  +CQ+      G P  P     +++ F + P     ++ W + +NIS   +PV++VVQ R +       ++   W+++   ++    +    P   YQFR+ A + +G +G    + T P+           P     KV+ I++GK   ++  L W  P +S+  + + ++ + W          P            ++   +E L+ ++SY V++ +V  +  +   S       ST                + ++S+ +     + FP   + A+M+        + QL +++  K         +     ++W    C  ++      S  +           ENY  L  L F C Y  ++ +  L  K+  +     F TPSCS   T       P T      P ++ + + +    S ++  +    +W     + + ++T F++TW  +
Sbjct:   81 ACLEPCKASWDLKENQCQDLCETLFPKKHYECLTSCEFLRSVESAKQGDCPAPERASGFAAACVESCEEDAECPAH-RKCC-SNGCGHTCQVPRNLYKGAPLKPR----KELVFVEQPAG-PLEVRWSSKFNISV--EPVVYVVQRRWNHGIHPSEDDATPWQDVAQVAEERVQLVDTRPSRWYQFRVAAVNVHGTRGFTAPQQTFPL------DPSPPPSPSGLKVSNISSGKDGFLTARLDWTLPEESD--VPVHHFKVFWSWTVPGKALVPTKKKRRKTTSGAKSSVDLEGLVGNSSYTVELQAVAYWGQVRLKSPKASLQFSTAP--------------ENNHSKISTKLKKEEFPAGKRPASMLEVGTPFYQDGQLQVRVYWKK----RGDSSATRHHVQWTAEHCSHNETSQPEKSVTQ-----------ENYINLPGLLFSCKY--RVSVYTLKNKRRSEDDSTTFITPSCSTLRTK---THKPITCPGEGAPKVLAKPENLTASFSTHEGNVTGNFHWRISHPQPQHTITGFQVTWAEV 576          
BLAST of Anosmin-1 vs. Ensembl Medaka
Match: anos1 (anosmin 1 [Source:NCBI gene;Acc:100049494])

HSP 1 Score: 105.916 bits (263), Expect = 4.034e-23
Identity = 127/591 (21.49%), Postives = 236/591 (39.93%), Query Frame = 2
Query:  383 CQAKCLKSYKDSI----RESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENY--LTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQL--KVAVKKSANDSKMDAELYWVSEQRA---SMTAFRITWGPIIEEPIDETL 2092
            C ++CL  +   I    + S N+ +++        +C N+  C  C+  C  +    EN CQ  C+    K    CL  C F++  +  K G CP   + S     C   C++D  C     K C S  C  +CQ+ +    GVP  P     +++ F ++P S Q ++ W + +NIS   +PVL+VVQ R +       ++  +W+ +  T++    ++       YQFR+ A + +G +G    +        P  P S  ++    ++  ++G ++  L W  P + +  + + +Y + W          P        I   +    +E L  ++SY V++ ++  +  +   S  +  + +T    Q   +   ++  K+D +        K     ++  T    + QL +++  K         +   + ++W P  C  ++ +    S  +           ENY  L  L F C Y++ ++L  L +K+  K     F TPSC+    S  H   PC        P +      +    S  D  +     W   + A    +T F++TW  I  E    +L
Sbjct:   44 CASRCLSLHITRISAFFKHSQNNGSLV--------WCQNHKQCSKCLEPCKESWDLKENQCQDLCEPLFPKKHYECLTSCEFLKSVEGVKQGDCPAPEKASGFAAACVESCEEDGEC--SAVKKCCSNGCGHTCQLPKNLYKGVPLKPR----KELVFLEHP-SGQLEIHWSSKFNIS--VEPVLYVVQRRWNYGIHPSEDDATEWQTVAQTAEERIQLADTRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSRDPAAPPSAANLHVTNMSLADDGLVTARLNWTLPHEPD--IPIHHYKVFWSWTVPTKSMVPSKKKQRKTINGAQNWLDLEGLQQNSSYSVELQAITYWGQVRLKSPKSSLHFTTN---QNNESAKSMLKSKKDATSPVGSTLAKRPSGALEVGTPFYQDGQLQVRVYWKK----RGDPSVSRYHVQWMPEYCNHNETRGPEKSVTQ-----------ENYINLPGLLFSCKYKVTVQL--LKSKRRSKDESTTFLTPSCAT-IRSKTHKHIPCPGEGAAGHPKVLAKPENLTASFSIKDGNITGSFLWGMSRVAPHHRITGFQVTWAEINTESRQNSL 594          
BLAST of Anosmin-1 vs. Ensembl Medaka
Match: anos1 (anosmin 1 [Source:NCBI gene;Acc:100049494])

HSP 1 Score: 105.531 bits (262), Expect = 4.848e-23
Identity = 127/591 (21.49%), Postives = 236/591 (39.93%), Query Frame = 2
Query:  383 CQAKCLKSYKDSI----RESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAEN-CQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKS----QCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKT-YNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHIS-EKVTRINNGKISVTLTWQ-PGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMI--NDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENY--LTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQL--KVAVKKSANDSKMDAELYWVSEQRA---SMTAFRITWGPIIEEPIDETL 2092
            C ++CL  +   I    + S N+ +++        +C N+  C  C+  C  +    EN CQ  C+    K    CL  C F++  +  K G CP   + S     C   C++D  C     K C S  C  +CQ+ +    GVP  P     +++ F ++P S Q ++ W + +NIS   +PVL+VVQ R +       ++  +W+ +  T++    ++       YQFR+ A + +G +G    +        P  P S  ++    ++  ++G ++  L W  P + +  + + +Y + W          P        I   +    +E L  ++SY V++ ++  +  +   S  +  + +T    Q   +   ++  K+D +        K     ++  T    + QL +++  K         +   + ++W P  C  ++ +    S  +           ENY  L  L F C Y++ ++L  L +K+  K     F TPSC+    S  H   PC        P +      +    S  D  +     W   + A    +T F++TW  I  E    +L
Sbjct:   44 CASRCLSLHITRISAFFKHSQNNGSLV--------WCQNHKQCSKCLEPCKESWDLKENQCQDLCEPLFPKKHYECLTSCEFLKSVEGVKQGDCPAPEKASGFAAACVESCEEDGEC--SAVKKCCSNGCGHTCQLPKNLYKGVPLKPR----KELVFLEHP-SGQLEIHWSSKFNIS--VEPVLYVVQRRWNYGIHPSEDDATEWQTVAQTAEERIQLADTRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSRDPAAPPSAANLHVTNMSLADDGLVTARLNWTLPHEPD--IPIHHYKVFWSWTVPTKSMVPSKKKQRKTINGAQNWLDLEGLQQNSSYSVELQAITYWGQVRLKSPKSSLHFTTN---QNNESAKSMLKSKKDATSPVGSTLAKRPSGALEVGTPFYQDGQLQVRVYWKK----RGDPSVSRYHVQWMPEYCNHNETRGPEKSVTQ-----------ENYINLPGLLFSCKYKVTVQL--LKSKRRSKDESTTFLTPSCAT-IRSKTHKHIPCPGEGAAGHPKVLAKPENLTASFSIKDGNITGSFLWGMSRVAPHHRITGFQVTWAEINTESRQNSL 594          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000033070.1 (SMESG000033070.1)

HSP 1 Score: 1405.96 bits (3638), Expect = 0.000e+0
Identity = 695/697 (99.71%), Postives = 696/697 (99.86%), Query Frame = 2
Query:  266 MIIRKLKMKNFIENFILISFYGIMSVTGSTILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTFFMISLASVVCFYHI 2356
            MIIRKLKMKNFIENFILISFYGIMSVTGSTILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQ IVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTN+DLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKALSKVVHYSVHKSVLKDLHSEKIYLVKLQAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTFFMISLASVVCFYHI
Sbjct:    1 MIIRKLKMKNFIENFILISFYGIMSVTGSTILDTMLEPICQAKCLKSYKDSIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQIIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNSDLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKALSKVVHYSVHKSVLKDLHSEKIYLVKLQAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTFFMISLASVVCFYHI 697          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000033070.1 (SMESG000033070.1)

HSP 1 Score: 1306.2 bits (3379), Expect = 0.000e+0
Identity = 644/646 (99.69%), Postives = 645/646 (99.85%), Query Frame = 2
Query:  419 IRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTFFMISLASVVCFYHI 2356
            IRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQ IVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTN+DLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKALSKVVHYSVHKSVLKDLHSEKIYLVKLQAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTFFMISLASVVCFYHI
Sbjct:   46 IRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRINNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQIIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCTNSDLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPIIEEPIDETLYGKDFMPLLDAGKALSKVVHYSVHKSVLKDLHSEKIYLVKLQAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTFFMISLASVVCFYHI 691          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000069895.1 (SMESG000069895.1)

HSP 1 Score: 185.267 bits (469), Expect = 3.005e-49
Identity = 165/619 (26.66%), Postives = 291/619 (47.01%), Query Frame = 2
Query:  533 QTAENCQKNCKN-------HAKKFQQSCLFGCNFVRKTKLNKPGVCPKV-----TQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDD--PVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVG--EMTLPIVVDYQPKNPNSPKHISEKVTRI-NNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENN----PLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFR-NITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKH--FPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFW-----EGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYW-------VSEQRASMTAFRITWGPIIEEPIDETLYG--KDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQ----AIDEYSVSEEISIFF 2263
            ++ + C K CK             +  CL GC F+++T     G CP        ++  C ++CK D  CF    KCCK + CS  C    Y    +P +P+     Q+   K P+S   + +W +   + I++  P+ F++Q R+           +KW+ L+ITS+SGA ++  +    YQFRL A S +G +G G      P +V+ +P NP S K +SE +TR+ + GKISVT+ W   D   +  +S Y + W   Y   +++      +T +   +P  +T Y +E+L P+ +Y V++++ V +  +    S P+  ++ST S+   +  E      +   + C      +H      + N    N + ++ IK+ D  +  + Y     ++ + P  CI+    +  S +    +TI  K+++ + + NL F+C Y +QIE+++L + K          EG FC PSC+   +S     P C +   Y   I  Q +    K  N +    EL W       V  +    + +RITWGP + EPI +++Y      +P++D+ K+  KV++   +  +L +L    +Y+VK Q     +D   +  ++SI +
Sbjct:   31 ESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCK-IGCSNICVEPIYND-SIPELPA-----QLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVE-RPSNPASVKGLSELLTRVYSTGKISVTIRWLKSD-EYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSMLRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLY-----RVSFTPKICIDP-LDNQMSEQHRSTRTIESKNNVIS-IENLYFNCQYYIQIEIISLKSFKKHHLLKPIQIEGYFCVPSCTNIASSEASEPPKCAD---YLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQLLVTLLDGLELESDMSIHY 630          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000069895.1 (SMESG000069895.1)

HSP 1 Score: 184.882 bits (468), Expect = 5.362e-49
Identity = 165/619 (26.66%), Postives = 292/619 (47.17%), Query Frame = 2
Query:  533 QTAENCQKNCKN-------HAKKFQQSCLFGCNFVRKTKLNKPGVCPKV-----TQKSQCSNECKDDSVCFKQGTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDD--PVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPI--VVDYQPKNPNSPKHISEKVTRI-NNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENN----PLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFR-NITYSSVPNIYYISTTSVPQQKPTEDRLIYLKEDNSECACGYSNKH--FPFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLTNLQFHCNYQMQIELMALSTKKIIKFW-----EGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYW-------VSEQRASMTAFRITWGPIIEEPIDETLYG--KDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQ----AIDEYSVSEEISIFF 2263
            ++ + C K CK             +  CL GC F+++T     G CP        ++  C ++CK D  CF    KCCK + CS  C    Y    +P +P+     Q+   K P+S   + +W +   + I++  P+ F++Q R+           +KW+ L+ITS+SGA ++  +    YQFRL A S +G +G G  + P   +V+ +P NP S K +SE +TR+ + GKISVT+ W   D   +  +S Y + W   Y   +++      +T +   +P  +T Y +E+L P+ +Y V++++ V +  +    S P+  ++ST S+   +  E      +   + C      +H      + N    N + ++ IK+ D  +  + Y     ++ + P  CI+    +  S +    +TI  K+++ + + NL F+C Y +QIE+++L + K          EG FC PSC+   +S     P C +   Y   I  Q +    K  N +    EL W       V  +    + +RITWGP + EPI +++Y      +P++D+ K+  KV++   +  +L +L    +Y+VK Q     +D   +  ++SI +
Sbjct:   53 ESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCK-IGCSNICVEPIYND-SIPELPA-----QLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVE-RPSNPASVKGLSELLTRVYSTGKISVTIRWLKSD-EYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSMLRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLY-----RVSFTPKICIDP-LDNQMSEQHRSTRTIESKNNVIS-IENLYFNCQYYIQIEIISLKSFKKHHLLKPIQIEGYFCVPSCTNIASSEASEPPKCAD---YLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQLLVTLLDGLELESDMSIHY 652          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000010608.1 (SMESG000010608.1)

HSP 1 Score: 152.14 bits (383), Expect = 8.018e-38
Identity = 167/706 (23.65%), Postives = 302/706 (42.78%), Query Frame = 2
Query:  383 CQAKCLKSYKDSIRESDNSHN---VLKNPF-LIHSYC--LNNPYCKGCMIGCSNAAQTAENCQKNCKNHAKKFQQSCLFGCNFVRKTKLNKPGVCP-KVTQKSQCSNECKDDSVCFKQG--TKCCKSLYCSFSCQMSEY-PKFGVPPIPSAPTVRQISFDKNPDSIQFDLDWKTYNISNIDDP---VLFVVQFRI---DDLDSKLNENINKWRNLVITSKSGAIISGIEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTRIN-NGKISVTLTW-QPGDSNSLLQLSNYHISWKRVYELNENN----PLVTVYDVPIPATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQKPTEDRLI-----YLKEDNSECACGYSNKHF----PFVIKNATMINDQLAIKIKMKDGIEFHNGYAPYSFQIRWRPTACIESQFKSATSSEFE----DWQTIVVKDHIENYLTN-----LQFHCNYQMQIELMAL--STKKIIK---------FWEGCFCTPSCSKYFTSIGHIQPPCTNADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASM-----TAFRITWGPIIEEPIDETLY----GKDFMPLLDAGKAXXXXXXXXXXXXXXXDLHSEKIYLVKLQAIDEYSVSEEIS----IFFKSH----FEKNSKSN 2296
            C  KCL+   +S +  +       +  +P  +I   C   N  +   C  GC  +  +     K+C N  +     CL GC F+        G CP K         EC  D  C  +G   KCC     +  C + ++ PK G  P    PT+ +       D   F++ WK Y+ ++  +P   +L+V+Q R     D ++    N   W+ L+IT + G  +  ++P   YQFR+ + ++ G  G    + P+ +   P +P  P+++++   RI  NGKI++ + W +P   +  + ++ Y ISW R +   + +      +T +   +P  +  Y IE L+   +Y V++ ++  + +    S PN  +++T  +P ++   +RL+      L  D   C  G  +       P+  KN+  I+            +   N      ++I + P  CI+++  S   ++ +    D   I  +  I   L N     LQF C Y +Q++ + +  S +KI K             CFCTPSC K  +   +        +  NP +    K+  ++S  + +    ++W   +++ +       FR+ WGP I++ +D         +  +P +D  +A +KV+  +V    L++L     Y+V++QAI      E+IS    I   +H    F K S SN
Sbjct:   61 CYHKCLQMQANSSQPGNQMQQDSTIAHSPASVIEQQCKKFNQEFTTSCTTGCEYSGSSGLG-GKDCSNQCQPNSSGCLEGCQFLNTAIKMSLGNCPEKFEIDKLLDRECHLDQQCMIEGDVRKCC-----NLRCVVPQFHPKIG--PSLWPPTIME-----GKDGSSFEMTWK-YDDTSFSEPMLPILYVLQVRTYFNRDFETTKASN---WKTLLITFREGVNLQDLQPGMWYQFRVASVTKYGTNGFKSFSPPVKLAKTPASPGVPRNLTDGAWRIRANGKINIRVHWMEPAAFD--IPVTEYKISWVRDHGFTQPDGQSLEALTDFVQTVPGNQRSYDIEGLVADKTYKVQVRAICKWGSAALISTPNTIFLTTPQLPVRE--SERLVSKDSSSLSGDQCSCVDGPQDGRIKISEPYYHKNSLKID------------LFITNSKKNLVYKISYAPNVCIDTESSSLFVNDLQPSPSDINEIYRERGITAALPNATLGPLQFSCRYTLQVQPLRIRPSKRKIKKDVNLDDEQFVLTFCFCTPSCLKLISQPQYQSTNLRCLNRANPILEPPNKILFQRSHKNPE-SFLVFWEYTEKSDILLLPNVRFRVIWGPSIDDHVDRKFMQPGINQLLLPRIDMSQAETKVLKENVSSIWLENLKKNTFYIVQVQAIFYQQEMEQISKTKLIILSTHKDPSFPKLSVSN 732          
The following BLAST results are available for this feature:
BLAST of Anosmin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ANOS19.711e-2222.22anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211][more]
back to top
BLAST of Anosmin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kal-16.580e-2422.71KALlmann syndrome homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Anosmin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Kal15.184e-622.68gene:FBgn0039155 transcript:FBtr0084549[more]
back to top
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
anos1a1.372e-2021.02anosmin 1a [Source:ZFIN;Acc:ZDB-GENE-000201-9][more]
anos1b2.381e-2022.95anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13][more]
anos1b2.381e-2022.95anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13][more]
ANOS14.497e-2025.30anosmin-1-like [Source:NCBI gene;Acc:100535716][more]
back to top
BLAST of Anosmin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc41.636e-2221.16proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc41.268e-2121.34proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc41.431e-2121.34proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc46.827e-2121.16proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc41.144e-2021.78proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
back to top
BLAST of Anosmin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P23352|KALM_HUMAN4.663e-2122.22Anosmin-1 OS=Homo sapiens OX=9606 GN=ANOS1 PE=1 SV... [more]
sp|Q90369|KALM_COTJA1.167e-1722.46Anosmin-1 OS=Coturnix japonica OX=93934 GN=ANOS1 P... [more]
sp|P33005|KALM_CHICK4.439e-1723.01Anosmin-1 OS=Gallus gallus OX=9031 GN=ANOS1 PE=2 S... [more]
back to top
BLAST of Anosmin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YFS93.896e-6226.09Anosmin-1 OS=Clonorchis sinensis OX=79923 GN=CLF_1... [more]
A0A4E0RJI86.629e-6026.61Anosmin-1 OS=Fasciola hepatica OX=6192 GN=D915_000... [more]
A0A0R3W6X82.383e-5124.55Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A1S8WKC71.795e-5027.00Fibronectin type III domain protein (Fragment) OS=... [more]
A0A5K3ELG71.484e-4824.69Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Anosmin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
anos1a1.695e-1922.69anosmin-1-like [Source:NCBI gene;Acc:103026549][more]
ANOS11.117e-1520.66anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211][more]
back to top
BLAST of Anosmin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
anos14.034e-2321.49anosmin 1 [Source:NCBI gene;Acc:100049494][more]
anos14.848e-2321.49anosmin 1 [Source:NCBI gene;Acc:100049494][more]
back to top
BLAST of Anosmin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033070.10.000e+099.71SMESG000033070.1[more]
SMESG000033070.10.000e+099.69SMESG000033070.1[more]
SMESG000069895.13.005e-4926.66SMESG000069895.1[more]
SMESG000069895.15.362e-4926.66SMESG000069895.1[more]
SMESG000010608.18.018e-3823.65SMESG000010608.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025680 ID=SMED30025680|Name=Anosmin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2433bp
CGTTTTATTTGTATGCAAGGTTTCTAATTCGCTGATTGCATTATTGTATA
CACACACGTCTGTTAGTCGGTGCAACAGTTAGGCCTCTATGTGTGTGTGT
GTATGCAAGCTTAAATGAAGTTTTATTATCACTTGTTTTGATTATTTTTC
AGAAATTGCCTACTCGAATATTATTCGATTGCCGTAATCACTGATTCTAT
TGGACACAAACTATTTGATTTTGTTTTTCCTCAAAAGTTTGCTTTTAAAA
CTCGATTTCATTCAAATGATTATTCGAAAATTGAAAATGAAGAATTTTAT
TGAAAATTTTATTCTCATTTCATTTTATGGAATTATGTCCGTGACTGGGA
GCACAATTCTTGACACGATGCTAGAACCGATTTGTCAAGCGAAATGTTTG
AAGTCCTACAAAGATTCGATTAGAGAGTCAGACAATTCACATAATGTACT
CAAAAATCCATTTCTTATTCATTCATACTGCCTAAACAATCCGTATTGCA
AAGGGTGTATGATCGGTTGCAGTAACGCAGCGCAAACGGCGGAAAACTGT
CAGAAAAATTGTAAGAATCACGCAAAAAAATTCCAACAGTCGTGTTTGTT
TGGGTGCAATTTTGTCAGAAAAACCAAGCTCAACAAGCCAGGGGTTTGTC
CAAAAGTAACTCAAAAATCTCAATGTTCCAATGAATGTAAAGATGATTCT
GTTTGTTTTAAACAAGGCACAAAGTGCTGCAAAAGTCTTTATTGCAGTTT
TAGTTGCCAGATGTCTGAATATCCGAAATTTGGTGTACCTCCAATTCCTT
CTGCACCGACGGTCCGGCAAATCAGTTTTGACAAAAATCCTGATTCCATT
CAATTCGATCTTGACTGGAAGACTTATAACATTTCCAATATCGATGATCC
GGTATTGTTTGTTGTACAATTTCGAATAGACGATCTCGATAGTAAACTAA
ATGAAAATATTAATAAATGGCGCAATCTCGTTATAACATCAAAATCCGGT
GCAATAATATCTGGAATTGAACCCGAACCGTCCTATCAATTTCGGTTGTT
GGCTTTCTCTGAAAACGGAATCAAGGGAGTCGGCGAAATGACATTACCAA
TAGTTGTTGACTATCAGCCGAAGAATCCCAATTCTCCCAAGCATATTTCG
GAAAAGGTCACTCGAATTAATAACGGCAAAATTTCCGTGACTTTAACTTG
GCAACCCGGAGATTCCAACAGCCTCCTGCAGTTATCTAACTATCACATCA
GTTGGAAGAGAGTCTATGAATTGAATGAAAATAATCCACTAGTAACTGTC
TATGACGTTCCGATTCCAGCAACTGAAACTCAATACACAATAGAAAATTT
AATACCGTCCGCTTCCTACGTGGTAAAGATTGTCTCTGTCGTTACTTTCA
GAAATATAACGTACAGCAGCGTGCCCAACATCTACTACATCTCTACGACT
TCGGTGCCGCAACAGAAACCGACTGAAGACAGGCTAATTTATTTAAAGGA
AGATAATTCTGAATGCGCTTGCGGATATTCCAATAAACATTTCCCATTTG
TGATAAAGAATGCCACAATGATTAATGATCAGTTGGCAATAAAAATCAAA
ATGAAAGATGGAATAGAGTTTCACAATGGTTATGCTCCATATTCTTTTCA
AATTCGTTGGCGTCCAACAGCGTGCATTGAGTCCCAGTTCAAAAGTGCCA
CAAGTTCGGAGTTCGAAGATTGGCAAACAATTGTAGTCAAAGATCATATT
GAAAATTATTTGACTAATCTTCAATTCCATTGCAATTATCAAATGCAAAT
TGAATTAATGGCATTGTCAACCAAAAAAATCATCAAATTTTGGGAGGGCT
GCTTTTGTACGCCAAGCTGTAGCAAATATTTTACTTCCATTGGTCACATT
CAACCGCCATGTACAAATGCAGATTTGTACAATCCTCCGATTATATATCA
ACTAAAGGTAGCAGTGAAAAAATCTGCAAATGACTCTAAAATGGATGCCG
AGCTGTATTGGGTGTCGGAACAGAGAGCCTCTATGACTGCATTTAGAATT
ACTTGGGGACCAATTATTGAGGAACCAATAGATGAGACATTATATGGTAA
AGATTTTATGCCACTTTTGGATGCTGGCAAAGCGCTTTCAAAAGTCGTTC
ATTATTCAGTTCATAAATCCGTTTTGAAGGATTTACATTCGGAGAAAATA
TATTTGGTCAAATTGCAAGCGATAGACGAGTACAGCGTCAGTGAAGAAAT
TTCAATATTTTTCAAAAGTCATTTTGAAAAGAATTCCAAATCTAATACAA
GATTATTAACATTTTTCATGATTAGTTTAGCCTCAGTCGTGTGTTTTTAT
CATATCTGAATGTGCATATTTTTTCACTTCAAATTCCACCTGTCTTTCTT
GTTTAAAGGTTTCATAAAAAACAGTAATTATTT
back to top

protein sequence of SMED30025680-orf-1

>SMED30025680-orf-1 ID=SMED30025680-orf-1|Name=SMED30025680-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=698bp
MIIRKLKMKNFIENFILISFYGIMSVTGSTILDTMLEPICQAKCLKSYKD
SIRESDNSHNVLKNPFLIHSYCLNNPYCKGCMIGCSNAAQTAENCQKNCK
NHAKKFQQSCLFGCNFVRKTKLNKPGVCPKVTQKSQCSNECKDDSVCFKQ
GTKCCKSLYCSFSCQMSEYPKFGVPPIPSAPTVRQISFDKNPDSIQFDLD
WKTYNISNIDDPVLFVVQFRIDDLDSKLNENINKWRNLVITSKSGAIISG
IEPEPSYQFRLLAFSENGIKGVGEMTLPIVVDYQPKNPNSPKHISEKVTR
INNGKISVTLTWQPGDSNSLLQLSNYHISWKRVYELNENNPLVTVYDVPI
PATETQYTIENLIPSASYVVKIVSVVTFRNITYSSVPNIYYISTTSVPQQ
KPTEDRLIYLKEDNSECACGYSNKHFPFVIKNATMINDQLAIKIKMKDGI
EFHNGYAPYSFQIRWRPTACIESQFKSATSSEFEDWQTIVVKDHIENYLT
NLQFHCNYQMQIELMALSTKKIIKFWEGCFCTPSCSKYFTSIGHIQPPCT
NADLYNPPIIYQLKVAVKKSANDSKMDAELYWVSEQRASMTAFRITWGPI
IEEPIDETLYGKDFMPLLDAGKALSKVVHYSVHKSVLKDLHSEKIYLVKL
QAIDEYSVSEEISIFFKSHFEKNSKSNTRLLTFFMISLASVVCFYHI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR042447Anosmin-1
IPR036116FN3_sf
IPR003961FN3_dom
IPR013783Ig-like_fold
IPR008197WAP_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030414peptidase inhibitor activity
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 288..382
e-value: 0.013
score: 24.7
coord: 576..659
e-value: 130.0
score: 1.7
coord: 178..270
e-value: 11.0
score: 11.2
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 298..375
e-value: 1.8E-6
score: 28.2
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 177..286
score: 8.127
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 290..397
score: 13.215
IPR003961Fibronectin type IIICDDcd00063FN3coord: 288..375
e-value: 2.28196E-7
score: 47.1059
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 286..386
e-value: 3.1E-8
score: 35.6
IPR042447Anosmin-1PANTHERPTHR14131KALLMANN SYNDROME 1 PROTEINcoord: 70..602
IPR008197WAP-type 'four-disulfide core' domainPROSITEPS51390WAPcoord: 121..168
score: 12.096
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 178..378
NoneNo IPR availableTMHMMTMhelixcoord: 12..34