LIM domain protein

Overview
NameLIM domain protein
Smed IDSMED30025676
Length (bp)1457
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM domain protein (SMED30025676) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM domain protein (SMED30025676) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM domain protein (SMED30025676) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM domain protein (SMED30025676) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025676

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30025676SMESG000066408.1 dd_Smed_v4_3339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025676SMESG000066408.1 dd_Smed_v4_3339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025676SMESG000066408.1 dd_Smed_v4_3339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM domain protein vs. Ensembl Human
Match: PDLIM5 (PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:17468])

HSP 1 Score: 102.834 bits (255), Expect = 5.000e-24
Identity = 63/228 (27.63%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  630 STKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYKR*YFCSILC 1313
            ST   K+P        +    ++++S   +    P+ S     Q Q   +D+     +   +  +  +C  C   I+G ++ A  K +    F C+ C   +    F+E K G LYC   +E   AP C +C + I+ + I AL + WH  CF+C  C K I    FH+  ED +   YCE DY   +   C GC+  I++ D +L+     +H  C    + CS+ C
Sbjct:   29 STGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANS--ALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEK-GALYCELCYEKFFAPECGRCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVFHL--EDGEP--YCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTC----FVCSVCC 245          
BLAST of LIM domain protein vs. Ensembl Human
Match: PDLIM7 (PDZ and LIM domain 7 [Source:HGNC Symbol;Acc:HGNC:22958])

HSP 1 Score: 103.219 bits (256), Expect = 3.033e-23
Identity = 52/158 (32.91%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  810 NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +++ K  +C  C   I+G Y+ A    Y    F CS C K ++   F E K G ++C   ++   AP C KC K I  + + AL   WH  CF C  C   I    F+++E     V YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  240 SNNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEK-GAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEE----GVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCF 392          

HSP 2 Score: 62.7734 bits (151), Expect = 5.722e-10
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL 362
            M++FK+ L        WGF +QGGKDF  PLS+ R+TP   + + G+ V D ++ I+  ++ +LTH +A  +I+     L L
Sbjct:    1 MDSFKVVL---EGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERLSL 79          

HSP 3 Score: 53.9138 bits (128), Expect = 3.463e-7
Identity = 32/106 (30.19%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK +I G  + A    +  + F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  307 CAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFY-MEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKD 411          
BLAST of LIM domain protein vs. Ensembl Human
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 105.145 bits (261), Expect = 3.088e-23
Identity = 53/153 (34.64%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  828 AICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSI-PQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             +C  CK  I G  + A  K +   HF C+ C + I    F E ++G  YC +D+ N  +PRC+ C+  I+++ + AL + WHP+ F C  C     P+G FH  E+D +   YC KDY + +  KC GC  AI   + Y+      +H EC+
Sbjct:  846 GVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFE-RDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEG-FH--EKDGKA--YCRKDYFDMFAPKCGGCARAI--LENYISALNTLWHPECF 990          

HSP 2 Score: 85.1149 bits (209), Expect = 9.912e-17
Identity = 44/131 (33.59%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C+ C   I    + A ++ +   HF C+ C     G +    K+G  YC +D+ +  AP+C  C+++I+E  I AL   WHP+CF+C  C      G F   E D Q   YCE  Y E     C GC+  I
Sbjct:  907 CYYCNGPILDKVVTALDRTWHPEHFFCAQCGA-FFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFF--EHDGQP--YCEVHYHERRGSLCSGCQKPI 1032          

HSP 3 Score: 51.2174 bits (121), Expect = 3.953e-6
Identity = 35/113 (30.97%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCE 1172
            C  C   I  +YI A N ++    F C  C  P     F E  +G  YC   +       C  C K I  + I A+ K +HP+ F+C  C K + +G F  KE++++   YC+
Sbjct:  966 CGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFE-HDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YCQ 1073          
BLAST of LIM domain protein vs. Ensembl Human
Match: PDLIM7 (PDZ and LIM domain 7 [Source:HGNC Symbol;Acc:HGNC:22958])

HSP 1 Score: 103.605 bits (257), Expect = 3.519e-23
Identity = 52/158 (32.91%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  810 NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +++ K  +C  C   I+G Y+ A    Y    F CS C K ++   F E K G ++C   ++   AP C KC K I  + + AL   WH  CF C  C   I    F+++E     V YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  274 SNNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEK-GAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEE----GVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCF 426          

HSP 2 Score: 63.1586 bits (152), Expect = 4.886e-10
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL 362
            M++FK+ L        WGF +QGGKDF  PLS+ R+TP   + + G+ V D ++ I+  ++ +LTH +A  +I+     L L
Sbjct:    1 MDSFKVVL---EGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERLSL 79          

HSP 3 Score: 53.9138 bits (128), Expect = 4.402e-7
Identity = 32/106 (30.19%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK +I G  + A    +  + F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  341 CAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFY-MEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKD 445          
BLAST of LIM domain protein vs. Ensembl Human
Match: PDLIM5 (PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:17468])

HSP 1 Score: 103.605 bits (257), Expect = 4.162e-23
Identity = 63/228 (27.63%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  630 STKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYKR*YFCSILC 1313
            ST   K+P        +    ++++S   +    P+ S     Q Q   +D+     +   +  +  +C  C   I+G ++ A  K +    F C+ C   +    F+E K G LYC   +E   AP C +C + I+ + I AL + WH  CF+C  C K I    FH+  ED +   YCE DY   +   C GC+  I++ D +L+     +H  C    + CS+ C
Sbjct:  245 STGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANS--ALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEK-GALYCELCYEKFFAPECGRCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVFHL--EDGEP--YCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTC----FVCSVCC 461          

HSP 2 Score: 53.9138 bits (128), Expect = 4.337e-7
Identity = 25/85 (29.41%), Postives = 48/85 (56.47%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQN----LNVLLE 359
            M N+ + L        WGF +QGGKDF  PL++  +     + +  +R+ D+++ I+ I+++ +TH +A  +I+     LN+ L+
Sbjct:    1 MSNYSVSLV---GPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNMTLQ 82          

HSP 3 Score: 50.0618 bits (118), Expect = 7.275e-6
Identity = 33/107 (30.84%), Postives = 50/107 (46.73%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIM--ALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            C  C+ +I G  I A  + +  + F C  C KPI+   F   ++G  YC  D+       C  C   I    +   ALG  WH  CF+C+ C +S+ +GQ    ++D
Sbjct:  370 CGRCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVF-HLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESL-EGQTFFSKKD 474          
BLAST of LIM domain protein vs. Ensembl Celegans
Match: alp-1 (ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:G5EFG1])

HSP 1 Score: 125.176 bits (313), Expect = 3.761e-30
Identity = 64/199 (32.16%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  699 TSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDS--KMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            T+++ + Q+N  +   G F       R +  L    T   +  +   C  CK +I+G+++ A  K +C  HF C  S C + +    F+E ++G  +C   FE H+APRC KCSK II   + AL K WHP CF C HC K      F+++    Q + YCE+D+   +  KC  C+  I++ D++++   N +H  C+
Sbjct: 1211 TTTETRPQQNTGAPRAGDF-------RGTGHLTTTTTTQQNGGRAPFCESCKQQIRGAFVLATGKSWCPEHFVCANSSCRRRLLECGFVE-EDGQKFCESCFEQHIAPRCNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFGNSAFYLE----QGLPYCEQDWNALFTTKCVSCRYPIEAGDRWVEALGNAFHSNCF 1397          
BLAST of LIM domain protein vs. Ensembl Celegans
Match: alp-1 (ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:G5EFG1])

HSP 1 Score: 124.405 bits (311), Expect = 4.161e-30
Identity = 64/199 (32.16%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  699 TSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKT--NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            T+++ + Q+N  +   G F       R +  L    T   +  +   C  CK +I+G+++ A  K +C  HF C  S C + +    F+E ++G  +C   FE H+APRC KCSK II   + AL K WHP CF C HC K      F+++    Q + YCE+D+   +  KC  C+  I++ D++++   N +H  C+
Sbjct:  432 TTTETRPQQNTGAPRAGDF-------RGTGHLTTTTTTQQNGGRAPFCESCKQQIRGAFVLATGKSWCPEHFVCANSSCRRRLLECGFVE-EDGQKFCESCFEQHIAPRCNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFGNSAFYLE----QGLPYCEQDWNALFTTKCVSCRYPIEAGDRWVEALGNAFHSNCF 618          
BLAST of LIM domain protein vs. Ensembl Celegans
Match: alp-1 (ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:G5EFG1])

HSP 1 Score: 124.405 bits (311), Expect = 4.860e-30
Identity = 64/199 (32.16%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  699 TSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKT--NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            T+++ + Q+N  +   G F       R +  L    T   +  +   C  CK +I+G+++ A  K +C  HF C  S C + +    F+E ++G  +C   FE H+APRC KCSK II   + AL K WHP CF C HC K      F+++    Q + YCE+D+   +  KC  C+  I++ D++++   N +H  C+
Sbjct:  558 TTTETRPQQNTGAPRAGDF-------RGTGHLTTTTTTQQNGGRAPFCESCKQQIRGAFVLATGKSWCPEHFVCANSSCRRRLLECGFVE-EDGQKFCESCFEQHIAPRCNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFGNSAFYLE----QGLPYCEQDWNALFTTKCVSCRYPIEAGDRWVEALGNAFHSNCF 744          
BLAST of LIM domain protein vs. Ensembl Celegans
Match: alp-1 (ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:G5EFG1])

HSP 1 Score: 124.02 bits (310), Expect = 5.576e-30
Identity = 64/199 (32.16%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  699 TSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKT--NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            T+++ + Q+N  +   G F       R +  L    T   +  +   C  CK +I+G+++ A  K +C  HF C  S C + +    F+E ++G  +C   FE H+APRC KCSK II   + AL K WHP CF C HC K      F+++    Q + YCE+D+   +  KC  C+  I++ D++++   N +H  C+
Sbjct:  471 TTTETRPQQNTGAPRAGDF-------RGTGHLTTTTTTQQNGGRAPFCESCKQQIRGAFVLATGKSWCPEHFVCANSSCRRRLLECGFVE-EDGQKFCESCFEQHIAPRCNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFGNSAFYLE----QGLPYCEQDWNALFTTKCVSCRYPIEAGDRWVEALGNAFHSNCF 657          
BLAST of LIM domain protein vs. Ensembl Celegans
Match: Y1A5A.1 (pep chromosome:WBcel235:III:3985565:3986809:-1 gene:WBGene00012379.1 transcript:Y1A5A.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y1A5A.1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.147e-16
Identity = 32/105 (30.48%), Postives = 62/105 (59.05%), Query Frame = 3
Query:  831 ICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            +C  C   I    + A N+++  +HF CS C +PIK T   +  +   YC++ F     P+C  C +++++  ++AL + WHP+CF C+ C++ +P G+F++ ++
Sbjct:   66 LCGHCHQSIGSEALVAMNRLWHPDHFTCSSCKRPIKQT--FQAADNHAYCVQCFAQKYNPKCAGCMETLVDTCLLALDRHWHPRCFTCSSCNRPLPNGEFYLVDD 168          
BLAST of LIM domain protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0310086)

HSP 1 Score: 124.02 bits (310), Expect = 8.467e-30
Identity = 60/195 (30.77%), Postives = 101/195 (51.79%), Query Frame = 3
Query:  705 SDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            S+  N      KS G F       R  + ++ +      ++ +C  C  +I+G +I A  +I+C +HF C    C +P++   F+E K G LYC   FE ++AP C KC+  I    + A+GK +HP+CF C  C K      F +++ +     YCE D+ E +  KCF C   +++ D++++   +NYH +C+
Sbjct:  681 SNVDNSPGAGGKSAGAFGATSAPKR-GRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK-GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGN----AYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQCF 869          

HSP 2 Score: 60.4622 bits (145), Expect = 2.516e-9
Identity = 30/83 (36.14%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  126 FKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQA--ILQIQNLNVLLELKR 368
             +I+L+R + +  WGF +QGG DF  PL V +V   S+S++ GL+  D ++KIND+    L H+ A  I+     N ++ ++R
Sbjct:    7 LQIKLSRFD-AQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of LIM domain protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0329916)

HSP 1 Score: 124.02 bits (310), Expect = 9.330e-30
Identity = 60/196 (30.61%), Postives = 102/196 (52.04%), Query Frame = 3
Query:  702 SSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +S+  N      KS G F       R  + ++ +      ++ +C  C  +I+G +I A  +I+C +HF C    C +P++   F+E K G LYC   FE ++AP C KC+  I    + A+GK +HP+CF C  C K      F +++ +     YCE D+ E +  KCF C   +++ D++++   +NYH +C+
Sbjct:  738 NSNVDNSPGAGGKSAGAFGATSAPKR-GRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK-GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGN----AYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQCF 927          

HSP 2 Score: 60.4622 bits (145), Expect = 2.728e-9
Identity = 30/83 (36.14%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  126 FKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQA--ILQIQNLNVLLELKR 368
             +I+L+R + +  WGF +QGG DF  PL V +V   S+S++ GL+  D ++KIND+    L H+ A  I+     N ++ ++R
Sbjct:    7 LQIKLSRFD-AQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of LIM domain protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0329914)

HSP 1 Score: 123.635 bits (309), Expect = 9.334e-30
Identity = 59/191 (30.89%), Postives = 100/191 (52.36%), Query Frame = 3
Query:  717 NQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             Q+    KS G F       R  + ++ +      ++ +C  C  +I+G +I A  +I+C +HF C    C +P++   F+E K G LYC   FE ++AP C KC+  I    + A+GK +HP+CF C  C K      F +++ +     YCE D+ E +  KCF C   +++ D++++   +NYH +C+
Sbjct:  439 GQQGAGGKSAGAFGATSAPKR-GRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK-GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGN----AYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQCF 623          

HSP 2 Score: 60.077 bits (144), Expect = 2.802e-9
Identity = 30/83 (36.14%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  126 FKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQA--ILQIQNLNVLLELKR 368
             +I+L+R + +  WGF +QGG DF  PL V +V   S+S++ GL+  D ++KIND+    L H+ A  I+     N ++ ++R
Sbjct:    7 LQIKLSRFD-AQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of LIM domain protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0310087)

HSP 1 Score: 124.405 bits (311), Expect = 9.466e-30
Identity = 60/195 (30.77%), Postives = 101/195 (51.79%), Query Frame = 3
Query:  705 SDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            S+  N      KS G F       R  + ++ +      ++ +C  C  +I+G +I A  +I+C +HF C    C +P++   F+E K G LYC   FE ++AP C KC+  I    + A+GK +HP+CF C  C K      F +++ +     YCE D+ E +  KCF C   +++ D++++   +NYH +C+
Sbjct: 1102 SNVDNSPGAGGKSAGAFGATSAPKR-GRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK-GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGN----AYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQCF 1290          

HSP 2 Score: 60.077 bits (144), Expect = 3.580e-9
Identity = 30/83 (36.14%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  126 FKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQA--ILQIQNLNVLLELKR 368
             +I+L+R + +  WGF +QGG DF  PL V +V   S+S++ GL+  D ++KIND+    L H+ A  I+     N ++ ++R
Sbjct:    7 LQIKLSRFD-AQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of LIM domain protein vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0329915)

HSP 1 Score: 123.635 bits (309), Expect = 9.807e-30
Identity = 60/196 (30.61%), Postives = 102/196 (52.04%), Query Frame = 3
Query:  702 SSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +S+  N      KS G F       R  + ++ +      ++ +C  C  +I+G +I A  +I+C +HF C    C +P++   F+E K G LYC   FE ++AP C KC+  I    + A+GK +HP+CF C  C K      F +++ +     YCE D+ E +  KCF C   +++ D++++   +NYH +C+
Sbjct:  499 NSNVDNSPGAGGKSAGAFGATSAPKR-GRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK-GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGN----AYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQCF 688          

HSP 2 Score: 60.077 bits (144), Expect = 2.835e-9
Identity = 30/83 (36.14%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  126 FKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQA--ILQIQNLNVLLELKR 368
             +I+L+R + +  WGF +QGG DF  PL V +V   S+S++ GL+  D ++KIND+    L H+ A  I+     N ++ ++R
Sbjct:    7 LQIKLSRFD-AQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQR 88          
BLAST of LIM domain protein vs. Ensembl Zebrafish
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:393813])

HSP 1 Score: 127.487 bits (319), Expect = 6.834e-32
Identity = 103/397 (25.94%), Postives = 168/397 (42.32%), Query Frame = 3
Query:  132 IELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSE--TLTHQQAILQIQNLNVLLELKRLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFV--PQTKPIVLPSKTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDS----KDLIIQ-----KTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            I    LN    WGF +QGGKDF  PL+V R+TP   + + G+ V D ++ I D ++E  T    Q  ++    ++ L L R                S     S   S +IN++  P      S  A   I          +  P     V P      +K   K+  +      K P  S        +     +D+ +    P KS     Q+ + ++ +    +  I+Q       +S +   +C  C   I+G Y+ A  + +    F C  C + +    F E K G++YC + ++N  +P C KC K I  + + AL   +H QCFLC  C   I    F+++E +     YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:    3 IYCVTLNGPAPWGFRLQGGKDFNTPLTVSRLTPGGKAAQAGVGVGDWVVSIFDANAEEMTHVEAQNKIRAATDSLKLTLSRYTHTTGFAKKDSLTSSSSQPKYSFAPSTAINKMARPFSASPGSGSAGPVIKPVSYALKPALSSPHNGHGVAPCPVTVKSKPADKH--DAVQAPAKAPVSSGPACRPPWVTDPGFADRYH----PDKSSTVVTQHTQPLQPTPMQNRSSILQAAQQSPAHSSAATPLCAACSKIIRGRYVVALGRSWHPEEFMCCQCKRLLDEGGFFEEK-GSIYCSKCYDNRYSPNCAKCKKIITGEIMHALKMTYHVQCFLCAACKLPIRNQAFYMEEGEP----YCERDYEKMFGTKCHGCDFKIDAGDRFLEALGYSWHDTCF 388          

HSP 2 Score: 52.373 bits (124), Expect = 6.970e-7
Identity = 33/106 (31.13%), Postives = 48/106 (45.28%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK  I G  + A    Y    F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  303 CAKCKKIITGEIMHALKMTYHVQCFLCAACKLPIRNQAFY-MEEGEPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGYSWHDTCFVCAICQINLEGKTFYSKKD 407          
BLAST of LIM domain protein vs. Ensembl Zebrafish
Match: pdlim5b (PDZ and LIM domain 5b [Source:ZFIN;Acc:ZDB-GENE-040426-908])

HSP 1 Score: 119.398 bits (298), Expect = 2.640e-28
Identity = 59/176 (33.52%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  765 QEEMRDSKDLIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            Q   RD  + ++Q+     + ++  +C  C   I+G ++ A  K +  + F CS C   +    F+E + G++YC+  +E  +AP CF+C K II + I AL + WH  CFLC  C + I    FH+  ED Q   YCEKDY   +   C GC   I++ DK+L+     +H  C+
Sbjct:  426 QPHPRDQDESVVQRAEHMPAGTRTPMCAHCNTVIRGPFLVAMGKSWHKDEFTCSHCRSSLADVGFVEER-GSVYCVLCYEEFLAPTCFQCHKKIIGEVINALKQTWHVNCFLCASCKQPIGNNTFHL--EDGQP--YCEKDYYSLFGTGCHGCDFPIEAGDKFLEALGFTWHDTCF 596          

HSP 2 Score: 55.4546 bits (132), Expect = 9.450e-8
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  159 TTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLL 356
            + WGF +QGGKDF  PL++ ++T    + K  + V D+++ I+ I +E +TH +A  +I+    NLN+ L
Sbjct:   13 SPWGFRLQGGKDFSMPLTISKLTDGGKAAKAKISVGDVVLSIDGIHTERMTHLEAQNKIKACSGNLNLSL 82          

HSP 3 Score: 54.6842 bits (130), Expect = 2.083e-7
Identity = 34/107 (31.78%), Postives = 52/107 (48.60%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            CF C  +I G  I A  + +  N F C+ C +PI G      ++G  YC +D+ +     C  C   I   ++ + ALG  WH  CF+C  C  S+ +GQ    ++D
Sbjct:  511 CFQCHKKIIGEVINALKQTWHVNCFLCASCKQPI-GNNTFHLEDGQPYCEKDYYSLFGTGCHGCDFPIEAGDKFLEALGFTWHDTCFVCAVCSTSL-EGQTFFSKKD 615          
BLAST of LIM domain protein vs. Ensembl Zebrafish
Match: pdlim5b (PDZ and LIM domain 5b [Source:ZFIN;Acc:ZDB-GENE-040426-908])

HSP 1 Score: 119.398 bits (298), Expect = 2.640e-28
Identity = 59/176 (33.52%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  765 QEEMRDSKDLIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            Q   RD  + ++Q+     + ++  +C  C   I+G ++ A  K +  + F CS C   +    F+E + G++YC+  +E  +AP CF+C K II + I AL + WH  CFLC  C + I    FH+  ED Q   YCEKDY   +   C GC   I++ DK+L+     +H  C+
Sbjct:  426 QPHPRDQDESVVQRAEHMPAGTRTPMCAHCNTVIRGPFLVAMGKSWHKDEFTCSHCRSSLADVGFVEER-GSVYCVLCYEEFLAPTCFQCHKKIIGEVINALKQTWHVNCFLCASCKQPIGNNTFHL--EDGQP--YCEKDYYSLFGTGCHGCDFPIEAGDKFLEALGFTWHDTCF 596          

HSP 2 Score: 55.4546 bits (132), Expect = 9.450e-8
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  159 TTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLL 356
            + WGF +QGGKDF  PL++ ++T    + K  + V D+++ I+ I +E +TH +A  +I+    NLN+ L
Sbjct:   13 SPWGFRLQGGKDFSMPLTISKLTDGGKAAKAKISVGDVVLSIDGIHTERMTHLEAQNKIKACSGNLNLSL 82          

HSP 3 Score: 54.6842 bits (130), Expect = 2.083e-7
Identity = 34/107 (31.78%), Postives = 52/107 (48.60%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            CF C  +I G  I A  + +  N F C+ C +PI G      ++G  YC +D+ +     C  C   I   ++ + ALG  WH  CF+C  C  S+ +GQ    ++D
Sbjct:  511 CFQCHKKIIGEVINALKQTWHVNCFLCASCKQPI-GNNTFHLEDGQPYCEKDYYSLFGTGCHGCDFPIEAGDKFLEALGFTWHDTCFVCAVCSTSL-EGQTFFSKKD 615          
BLAST of LIM domain protein vs. Ensembl Zebrafish
Match: pdlim5a (PDZ and LIM domain 5a [Source:NCBI gene;Acc:436927])

HSP 1 Score: 103.99 bits (258), Expect = 2.327e-23
Identity = 56/188 (29.79%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  735 SKSLGKFLQNQEEMRDSKD--LIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            S  LG  L         KD   ++Q+     + ++  +C  C   I+G ++ A  K +    F C+ CS  +    F+E ++G++YC   +E   AP C +C   I+ + I AL + WH  CFLC  C + I    FH+  ED +   YCE+D+   +   C GC   I++ DK+L+     +H  C+
Sbjct:  337 STPLGPALDRPMPRPHPKDEASLVQRAEHIPAGTRTPMCAHCDMVIRGPFLVAMGKSWHPEEFTCAHCSVSLSELGFVE-EQGSVYCQHCYEEFFAPTCSRCHHKILGEVINALKQTWHVYCFLCASCQQPIRNDTFHL--EDGEP--YCERDFYSLFGTGCRGCDFPIEAGDKFLEALGGTWHDTCF 519          

HSP 2 Score: 50.0618 bits (118), Expect = 4.579e-6
Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  147 LNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLE 359
            L     WGF +QGGKDF  PLS+ R+T    + K G+ V DL++ I+ IS++ + H +A  +I+     LN+ L+
Sbjct:    9 LQGPAPWGFRLQGGKDFNMPLSISRLTDAGKAAKAGVAVGDLVLSIDGISTDGMNHLEAQNKIKASSDKLNLSLQ 83          

HSP 3 Score: 50.0618 bits (118), Expect = 5.171e-6
Identity = 32/100 (32.00%), Postives = 47/100 (47.00%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQ 1127
            C  C  +I G  I A  + +    F C+ C +PI+   F   ++G  YC  DF +     C  C   I   ++ + ALG  WH  CF+C  C  S+ +GQ
Sbjct:  434 CSRCHHKILGEVINALKQTWHVYCFLCASCQQPIRNDTF-HLEDGEPYCERDFYSLFGTGCRGCDFPIEAGDKFLEALGGTWHDTCFVCTVCSVSL-EGQ 531          
BLAST of LIM domain protein vs. Ensembl Zebrafish
Match: pdlim5a (PDZ and LIM domain 5a [Source:NCBI gene;Acc:436927])

HSP 1 Score: 103.99 bits (258), Expect = 2.327e-23
Identity = 56/188 (29.79%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  735 SKSLGKFLQNQEEMRDSKD--LIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            S  LG  L         KD   ++Q+     + ++  +C  C   I+G ++ A  K +    F C+ CS  +    F+E ++G++YC   +E   AP C +C   I+ + I AL + WH  CFLC  C + I    FH+  ED +   YCE+D+   +   C GC   I++ DK+L+     +H  C+
Sbjct:  337 STPLGPALDRPMPRPHPKDEASLVQRAEHIPAGTRTPMCAHCDMVIRGPFLVAMGKSWHPEEFTCAHCSVSLSELGFVE-EQGSVYCQHCYEEFFAPTCSRCHHKILGEVINALKQTWHVYCFLCASCQQPIRNDTFHL--EDGEP--YCERDFYSLFGTGCRGCDFPIEAGDKFLEALGGTWHDTCF 519          

HSP 2 Score: 50.0618 bits (118), Expect = 4.579e-6
Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  147 LNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLE 359
            L     WGF +QGGKDF  PLS+ R+T    + K G+ V DL++ I+ IS++ + H +A  +I+     LN+ L+
Sbjct:    9 LQGPAPWGFRLQGGKDFNMPLSISRLTDAGKAAKAGVAVGDLVLSIDGISTDGMNHLEAQNKIKASSDKLNLSLQ 83          

HSP 3 Score: 50.0618 bits (118), Expect = 5.171e-6
Identity = 32/100 (32.00%), Postives = 47/100 (47.00%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQ 1127
            C  C  +I G  I A  + +    F C+ C +PI+   F   ++G  YC  DF +     C  C   I   ++ + ALG  WH  CF+C  C  S+ +GQ
Sbjct:  434 CSRCHHKILGEVINALKQTWHVYCFLCASCQQPIRNDTF-HLEDGEPYCERDFYSLFGTGCRGCDFPIEAGDKFLEALGGTWHDTCFVCTVCSVSL-EGQ 531          
BLAST of LIM domain protein vs. Ensembl Xenopus
Match: arhgef40 (Rho guanine nucleotide exchange factor 40 [Source:Xenbase;Acc:XB-GENE-6050452])

HSP 1 Score: 139.428 bits (350), Expect = 4.237e-36
Identity = 114/398 (28.64%), Postives = 178/398 (44.72%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLELKRLPRFESELXXXXXVIDSGNFSNSCRVS--ASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIVLPSKTFESAKTDQKYSNNTSTKADKTPELSLK---TDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            ME +K+ L        WGF +QGGKDF  PLS+ R+TP   ++  G+ V D L++I   S+ ++TH +A  +I+     L ++L    +   ES+           NF+ S  ++  A       PPP+ +     +  + Y PPP +    QT    L + T  S  TD        +     P  +      D     K  T   K  Q   P+ +         + R+S     Q  +S  K  +C  C   I+G ++ A  + Y    F CS C K ++   F E K G+++C   ++   AP C KC K I  + + AL   WH  CF C +C   I    F++  ED +   YCEKDY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:    1 MEEYKVTL---EGPAPWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKLGLVLSRYGVHTPESQGRKY-------NFAPSTALNKIARPFGTGTPPPDNSRPGQLTKPVAYNPPPTSYTTSQTAQGQLQNGTCSSDTTDHPIPPAPPSGPAARPPWTTDPTFADRYAPDKTTTVMTKHTQPATPTPA---------QSRNSILQAAQVPSSGDKTPVCCQCNKIIRGRFLLALGRYYHPEEFTCSQCHKVLEEGGFFEEK-GSIFCPRCYDARFAPNCAKCKKKITGEIMHALKMTWHVPCFTCAYCKTPIRNRAFYM--EDGKP--YCEKDYEQMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF 374          

HSP 2 Score: 55.0694 bits (131), Expect = 1.364e-7
Identity = 33/113 (29.20%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  816 DSKMAI-CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            D++ A  C  CK +I G  + A    +    F C++C  PI+   F   ++G  YC +D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  282 DARFAPNCAKCKKKITGEIMHALKMTWHVPCFTCAYCKTPIRNRAFY-MEDGKPYCEKDYEQMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQMNLEGKTFYSKKD 393          
BLAST of LIM domain protein vs. Ensembl Xenopus
Match: arhgef40 (Rho guanine nucleotide exchange factor 40 [Source:Xenbase;Acc:XB-GENE-6050452])

HSP 1 Score: 138.658 bits (348), Expect = 4.711e-35
Identity = 108/406 (26.60%), Postives = 175/406 (43.10%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIVLPSKTFESAKTDQ-KYSNNTSTKADKTPELSLKTDNIELLKK---------LTSSDKKNQENVPSKSLGKFLQNQE-------EMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            ME +K+ L        WGF +QGGKDF  PLS+ R+TP   ++  G+ V D L++I   S+ ++TH +A  +I+  +  L L  L RF   +     V    +       + S        P    +    NS       P A+ P       P  ++ +++T Q +  N   ++   T      TD+                T+         P K+     ++ +       + R+S     Q  +S  K  +C  C   I+G ++ A  + Y    F CS C K ++   F E K G+++C   ++   AP C KC K I  + + AL   WH  CF C +C   I    F++  ED +   YCEKDY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  101 MEEYKVTL---EGPAPWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKLGLV-LSRFAVGVNQAKGVHTPESQGRKYNFAPSTALNKIARPFGTGTPPPDNSRPGQLTKPVAYNP-------PPTSYTTSQTAQGQLQNGQESRTAFTVSGKDTTDHPIPPAPPSGPAARPPWTTDPTFADRYAPDKTTTVMTKHTQPATPTPAQSRNSILQAAQVPSSGDKTPVCCQCNKIIRGRFLLALGRYYHPEEFTCSQCHKVLEEGGFFEEK-GSIFCPRCYDARFAPNCAKCKKKITGEIMHALKMTWHVPCFTCAYCKTPIRNRAFYM--EDGKP--YCEKDYEQMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF 490          

HSP 2 Score: 55.4546 bits (132), Expect = 1.405e-7
Identity = 33/113 (29.20%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  816 DSKMAI-CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            D++ A  C  CK +I G  + A    +    F C++C  PI+   F   ++G  YC +D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  398 DARFAPNCAKCKKKITGEIMHALKMTWHVPCFTCAYCKTPIRNRAFY-MEDGKPYCEKDYEQMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQMNLEGKTFYSKKD 509          
BLAST of LIM domain protein vs. Ensembl Xenopus
Match: spryd3 (SPRY domain containing 3 [Source:Xenbase;Acc:XB-GENE-5957038])

HSP 1 Score: 105.531 bits (262), Expect = 9.930e-24
Identity = 63/251 (25.10%), Postives = 112/251 (44.62%), Query Frame = 3
Query:  549 VPQTKPIVLPSKTFESAKTDQKYSNNTSTKADK------TPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             P   P+  P++ +  A   Q+ SN      D        P  S  T   ++L K  +       + PS +     Q+  ++        ++  + S+  +C  C   I+G ++ A  + +    F C+ C   +    F+E ++G +YC   +E   AP C +C+  I+ + + AL + WH  CF+C  C K      FH+  ED +   YCEKDY   +  KC GC   +++ DK+++   + +H  C+
Sbjct:  220 APAPGPVQPPAQIY--APPTQEPSNRPPWVTDDNFSQKFAPGKSTSTVTKQILPK-AAPLPPTPISAPSYTPQPVGQSPSQVPRGLIQRAERFPASSRTPLCASCNSIIRGPFLVAMGRSWHPEEFNCAHCKTSLADVSFVEEQKG-VYCERCYEQFFAPTCARCNTKIMGEVMHALRQTWHTTCFVCAACRKPFGNSLFHM--EDGEP--YCEKDYVALFSTKCHGCDFPVEAGDKFIEALGHTWHDTCF 462          

HSP 2 Score: 62.003 bits (149), Expect = 1.269e-9
Identity = 28/80 (35.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query:  147 LNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLELKRLP 374
            L+    WGF +QGGKDF  PL++ RVTP S + +  +   DL++ I+ ++++ +TH +A  +I+    NL + L+  + P
Sbjct:    7 LSGPGPWGFRLQGGKDFNMPLTISRVTPGSKAAQSSVNQGDLVVAIDGVNTDGMTHLEAQNKIKSASYNLGLTLQKSKRP 86          

HSP 3 Score: 54.299 bits (129), Expect = 2.775e-7
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  C  +I G  + A  + + +  F C+ C KP  G      ++G  YC +D+    + +C  C   +   ++ I ALG  WH  CF+C  CH ++    F+ K++
Sbjct:  377 CARCNTKIMGEVMHALRQTWHTTCFVCAACRKPF-GNSLFHMEDGEPYCEKDYVALFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKD 481          
BLAST of LIM domain protein vs. Ensembl Xenopus
Match: spryd3 (SPRY domain containing 3 [Source:Xenbase;Acc:XB-GENE-5957038])

HSP 1 Score: 105.531 bits (262), Expect = 1.434e-23
Identity = 63/251 (25.10%), Postives = 112/251 (44.62%), Query Frame = 3
Query:  549 VPQTKPIVLPSKTFESAKTDQKYSNNTSTKADK------TPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             P   P+  P++ +  A   Q+ SN      D        P  S  T   ++L K  +       + PS +     Q+  ++        ++  + S+  +C  C   I+G ++ A  + +    F C+ C   +    F+E ++G +YC   +E   AP C +C+  I+ + + AL + WH  CF+C  C K      FH+  ED +   YCEKDY   +  KC GC   +++ DK+++   + +H  C+
Sbjct:  310 APAPGPVQPPAQIY--APPTQEPSNRPPWVTDDNFSQKFAPGKSTSTVTKQILPK-AAPLPPTPISAPSYTPQPVGQSPSQVPRGLIQRAERFPASSRTPLCASCNSIIRGPFLVAMGRSWHPEEFNCAHCKTSLADVSFVEEQKG-VYCERCYEQFFAPTCARCNTKIMGEVMHALRQTWHTTCFVCAACRKPFGNSLFHM--EDGEP--YCEKDYVALFSTKCHGCDFPVEAGDKFIEALGHTWHDTCF 552          

HSP 2 Score: 62.003 bits (149), Expect = 1.139e-9
Identity = 28/80 (35.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query:  147 LNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLELKRLP 374
            L+    WGF +QGGKDF  PL++ RVTP S + +  +   DL++ I+ ++++ +TH +A  +I+    NL + L+  + P
Sbjct:    7 LSGPGPWGFRLQGGKDFNMPLTISRVTPGSKAAQSSVNQGDLVVAIDGVNTDGMTHLEAQNKIKSASYNLGLTLQKSKRP 86          

HSP 3 Score: 55.4546 bits (132), Expect = 1.669e-7
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  C  +I G  + A  + + +  F C+ C KP  G      ++G  YC +D+    + +C  C   +   ++ I ALG  WH  CF+C  CH ++    F+ K++
Sbjct:  467 CARCNTKIMGEVMHALRQTWHTTCFVCAACRKPF-GNSLFHMEDGEPYCEKDYVALFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKD 571          
BLAST of LIM domain protein vs. Ensembl Xenopus
Match: PDLIM5 (PDZ and LIM domain 5 [Source:NCBI gene;Acc:548530])

HSP 1 Score: 104.76 bits (260), Expect = 2.057e-23
Identity = 54/181 (29.83%), Postives = 91/181 (50.28%), Query Frame = 3
Query:  780 DSKDLIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYKR*YFCSILC 1313
            + +D ++Q+     + ++  +C +C   I+G ++ A  K +    F C+ C   +    F+E K G LYC   +E   AP C +C + I+ + I AL + WH  CF+C  C   I    FH+  ED +   YCE DY   +   C GC+  I++ D++L+   + +H  C    + C+I C
Sbjct:  375 EDQDTLVQRAEHIPAGTRTPMCAICNKVIRGPFLLALGKSWHPEEFNCAHCKSSMAEMGFVEEK-GGLYCEICYEKLFAPECARCQRKILGEVINALKQTWHVSCFVCVACQTPIRNSVFHL--EDGEP--YCETDYYSLFGTICHGCEFPIEAGDRFLEALGHTWHNTC----FVCTICC 546          

HSP 2 Score: 55.8398 bits (133), Expect = 1.227e-7
Identity = 26/85 (30.59%), Postives = 50/85 (58.82%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLE 359
            M N+ + L        WGF +QGGKDF  PL++ R++    + +  + + D+++ I+ IS++ +TH +A  +I+    +LN+ L+
Sbjct:    1 MSNYSVSLV---GPAPWGFRLQGGKDFNMPLTISRLSDGGKASQAHIGIGDVVLTIDGISTDGMTHLEAQNKIKACTGSLNLTLQ 82          
BLAST of LIM domain protein vs. Ensembl Mouse
Match: Pxn (paxillin [Source:MGI Symbol;Acc:MGI:108295])

HSP 1 Score: 103.219 bits (256), Expect = 8.785e-23
Identity = 52/153 (33.99%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  828 AICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSI-PQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             +C  CK  I G  + A  K +   HF C+ C + I    F E ++G  YC +D+ +  +PRC+ C+  I+++ + AL + WHP+ F C  C     P+G FH  E+D +   YC KDY + +  KC GC  AI   + Y+      +H EC+
Sbjct:  827 GVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFE-RDGQPYCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEG-FH--EKDGKA--YCRKDYFDMFAPKCGGCARAI--LENYISALNTLWHPECF 971          

HSP 2 Score: 85.5001 bits (210), Expect = 5.371e-17
Identity = 44/131 (33.59%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C+ C   I    + A ++ +   HF C+ C     G +    K+G  YC +D+ +  AP+C  C+++I+E  I AL   WHP+CF+C  C      G F   E D Q   YCE  Y E     C GC+  I
Sbjct:  888 CYYCNGPILDKVVTALDRTWHPEHFFCAQCGA-FFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFF--EHDGQP--YCEVHYHERRGSLCSGCQKPI 1013          

HSP 3 Score: 51.6026 bits (122), Expect = 2.315e-6
Identity = 35/113 (30.97%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCE 1172
            C  C   I  +YI A N ++    F C  C  P     F E  +G  YC   +       C  C K I  + I A+ K +HP+ F+C  C K + +G F  KE++++   YC+
Sbjct:  947 CGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFE-HDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YCQ 1054          
BLAST of LIM domain protein vs. Ensembl Mouse
Match: Pdlim7 (PDZ and LIM domain 7 [Source:MGI Symbol;Acc:MGI:1914649])

HSP 1 Score: 101.679 bits (252), Expect = 1.070e-22
Identity = 51/158 (32.28%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  810 NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +++ K  +C  C   I+G Y+ A    Y    F CS C K ++   F E K G ++C   ++   AP C KC K I  + + AL   WH  CF C  C   I    F+++E       YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  274 SNNGKTPVCHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEK-GAIFCPSCYDVRYAPNCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEE----GAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF 426          

HSP 2 Score: 62.7734 bits (151), Expect = 4.816e-10
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL 362
            M++FK+ L        WGF +QGGKDF  PLS+ R+TP   + + G+ V D ++ I+  ++ +LTH +A  +I+     L L
Sbjct:    1 MDSFKVVL---EGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLNIDGENAGSLTHIEAQNKIRACGERLSL 79          

HSP 3 Score: 54.299 bits (129), Expect = 2.244e-7
Identity = 32/106 (30.19%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK +I G  + A    +  + F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  341 CAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFY-MEEGAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKD 445          
BLAST of LIM domain protein vs. Ensembl Mouse
Match: Pdlim7 (PDZ and LIM domain 7 [Source:MGI Symbol;Acc:MGI:1914649])

HSP 1 Score: 101.679 bits (252), Expect = 1.070e-22
Identity = 51/158 (32.28%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  810 NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +++ K  +C  C   I+G Y+ A    Y    F CS C K ++   F E K G ++C   ++   AP C KC K I  + + AL   WH  CF C  C   I    F+++E       YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  274 SNNGKTPVCHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEK-GAIFCPSCYDVRYAPNCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEE----GAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF 426          

HSP 2 Score: 62.7734 bits (151), Expect = 4.816e-10
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL 362
            M++FK+ L        WGF +QGGKDF  PLS+ R+TP   + + G+ V D ++ I+  ++ +LTH +A  +I+     L L
Sbjct:    1 MDSFKVVL---EGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLNIDGENAGSLTHIEAQNKIRACGERLSL 79          

HSP 3 Score: 54.299 bits (129), Expect = 2.244e-7
Identity = 32/106 (30.19%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK +I G  + A    +  + F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  341 CAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFY-MEEGAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKD 445          
BLAST of LIM domain protein vs. Ensembl Mouse
Match: Pxn (paxillin [Source:MGI Symbol;Acc:MGI:108295])

HSP 1 Score: 100.523 bits (249), Expect = 1.832e-22
Identity = 65/245 (26.53%), Postives = 106/245 (43.27%), Query Frame = 3
Query:  564 PIVLPSKTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTS----SDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTN-SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            P  +P+ T    +        +S +  +    S   +  EL+  L+     +  K   + P   L K     + M  S    + K   +     +C  CK  I G  + A  K +   HF C+ C + I    F E ++G  YC +D+ +  +PRC+ C+  I+++ + AL + WHP+ F C  C        FH  E+D +   YC KDY + +  KC GC  AI   + Y+      +H EC+
Sbjct:   96 PSPVPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKFMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFE-RDGQPYCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFH--EKDGKA--YCRKDYFDMFAPKCGGCARAI--LENYISALNTLWHPECF 333          

HSP 2 Score: 82.8037 bits (203), Expect = 1.407e-16
Identity = 44/131 (33.59%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C+ C   I    + A ++ +   HF C+ C     G +    K+G  YC +D+ +  AP+C  C+++I+E  I AL   WHP+CF+C  C      G F   E D Q   YCE  Y E     C GC+  I
Sbjct:  250 CYYCNGPILDKVVTALDRTWHPEHFFCAQCGA-FFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFF--EHDGQP--YCEVHYHERRGSLCSGCQKPI 375          

HSP 3 Score: 51.6026 bits (122), Expect = 1.533e-6
Identity = 35/120 (29.17%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFY 1193
            C  C   I  +YI A N ++    F C  C  P     F E  +G  YC   +       C  C K I  + I A+ K +HP+ F+C  C K + +G F  KE++++   YC+  + + +
Sbjct:  309 CGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFE-HDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YCQSCFVKLF 423          
BLAST of LIM domain protein vs. Ensembl Mouse
Match: Pxn (paxillin [Source:MGI Symbol;Acc:MGI:108295])

HSP 1 Score: 100.908 bits (250), Expect = 3.314e-22
Identity = 50/152 (32.89%), Postives = 77/152 (50.66%), Query Frame = 3
Query:  828 AICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             +C  CK  I G  + A  K +   HF C+ C + I    F E ++G  YC +D+ +  +PRC+ C+  I+++ + AL + WHP+ F C  C        FH  E+D +   YC KDY + +  KC GC  AI   + Y+      +H EC+
Sbjct:  356 GVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFE-RDGQPYCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFH--EKDGKA--YCRKDYFDMFAPKCGGCARAI--LENYISALNTLWHPECF 500          

HSP 2 Score: 83.9593 bits (206), Expect = 1.068e-16
Identity = 44/131 (33.59%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C+ C   I    + A ++ +   HF C+ C     G +    K+G  YC +D+ +  AP+C  C+++I+E  I AL   WHP+CF+C  C      G F   E D Q   YCE  Y E     C GC+  I
Sbjct:  417 CYYCNGPILDKVVTALDRTWHPEHFFCAQCGA-FFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFF--EHDGQP--YCEVHYHERRGSLCSGCQKPI 542          

HSP 3 Score: 51.6026 bits (122), Expect = 1.866e-6
Identity = 35/113 (30.97%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCE 1172
            C  C   I  +YI A N ++    F C  C  P     F E  +G  YC   +       C  C K I  + I A+ K +HP+ F+C  C K + +G F  KE++++   YC+
Sbjct:  476 CGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFE-HDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YCQ 583          
BLAST of LIM domain protein vs. UniProt/SwissProt
Match: sp|Q679P3|PDLI7_CHICK (PDZ and LIM domain protein 7 OS=Gallus gallus OX=9031 GN=PDLIM7 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.655e-37
Identity = 109/402 (27.11%), Postives = 177/402 (44.03%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELXXXX------XVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIVLPSKTFESA-KTDQKYSNNTSTKADKT---PELSLKTDNIELL---KKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            ME++K+    LN    WGF +QGGKDF  PLS+ R+TP   + + G+ V D ++ I+  S+ T+TH +A  +I+     L L  L R ++ L  P             NF+ S  ++ +        P      + +  + Y P  P         + +P  +  +A KT+   +  T          P  ++     E     K  T   K +Q   P+      +QN+  +  +     Q   S  +  +C+ C   I+G Y+ A    Y    F C  C K +    F E K G+++C + ++   AP C KC K I  + + AL   WH QCF C  C   I    F+++E       YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:    1 MESYKV---MLNGPAPWGFRLQGGKDFSMPLSISRLTPGGKAAQAGVGVGDWVLYIDGESTGTMTHIEAQNRIRACGDRLCLT-LSRAQNHLGKPQKDSLPCSEPPKYNFAPSTALNKTARPFGASSPPNPRPGLVTKPVTYVPLAPACTPQHNGQVSVPDPSPGAAMKTEPGLAPRTPAATPGPTSRPPWAVDPSFAERYAPDKTSTVLSKHSQPATPTP-----MQNRSSIVQAAQ---QAPESPGRTPLCYKCNKIIRGRYLVALGHYYHPEEFTCCQCRKVLDEGGFFEEK-GSIFCPKCYDTRYAPSCAKCKKKITGEVMHALKMTWHVQCFTCAACKTPIRNRAFYMEEGQP----YCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF 385          

HSP 2 Score: 53.1434 bits (126), Expect = 3.490e-6
Identity = 34/113 (30.09%), Postives = 53/113 (46.90%), Query Frame = 3
Query:  816 DSKMAI-CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            D++ A  C  CK +I G  + A    +    F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  293 DTRYAPSCAKCKKKITGEVMHALKMTWHVQCFTCAACKTPIRNRAFY-MEEGQPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQTNLEGKTFYSKKD 404          
BLAST of LIM domain protein vs. UniProt/SwissProt
Match: sp|Q6INU3|PDLI7_XENLA (PDZ and LIM domain protein 7 OS=Xenopus laevis OX=8355 GN=pdlim7 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.370e-37
Identity = 107/399 (26.82%), Postives = 173/399 (43.36%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIV---LPSKTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQE-------EMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            ME +K+ L   +    WGF +QGGKDF  PLS+ R+TP   S+  G+ V D L++I   S+ ++TH +A  +I+  +  L L  L RF      P  V    +       + S        P  + +    NS       P A+ P         +P    ++ +  +  SN +       P     +    +    T+         P K+     ++ +       + R+S     Q  +S  K  +C  C   I+G ++ A  + Y    F CS C K ++   F E K G+++C   ++   AP C KC K I  + + AL   WH  CF C +C   I    F++  ED +   YCEKDY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:    1 MEEYKVTL---DGPAPWGFRLQGGKDFNMPLSISRLTPGGKSELAGVNVGDWLLQIEGDSTASMTHIEAQNKIRASSNKLGLV-LSRFAVGANHPKGVHTPESQGRKYNFAPSTALNKIARPFGSGTPPPDNSRPVQVTKPVAYNPPPTSYPSSQMPQGQLQNGQKSRTVSNVSGKDTTDHPIPPAPSTGPAVRPPWTTDPTFADRYAPDKTTTVMTKHTQPATPTPAQSRNSILQAAQVPSSGDKTPVCSQCNKIIRGRFLLALGRYYHPEEFTCSQCHKVLEEGGFFEEK-GSIFCPCCYDARFAPNCAKCKKKITGEIMHALKMTWHVPCFTCAYCKTPIRNRAFYM--EDGKP--YCEKDYEQMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF 390          

HSP 2 Score: 54.299 bits (129), Expect = 1.318e-6
Identity = 33/113 (29.20%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  816 DSKMAI-CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            D++ A  C  CK +I G  + A    +    F C++C  PI+   F   ++G  YC +D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  298 DARFAPNCAKCKKKITGEIMHALKMTWHVPCFTCAYCKTPIRNRAFY-MEDGKPYCEKDYEQMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKD 409          
BLAST of LIM domain protein vs. UniProt/SwissProt
Match: sp|A1ZA47|ZASP_DROME (PDZ and LIM domain protein Zasp OS=Drosophila melanogaster OX=7227 GN=Zasp52 PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 1.400e-27
Identity = 60/196 (30.61%), Postives = 102/196 (52.04%), Query Frame = 3
Query:  702 SSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCC--SFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +S+  N      KS G F       R  + ++ +      ++ +C  C  +I+G +I A  +I+C +HF C    C +P++   F+E K G LYC   FE ++AP C KC+  I    + A+GK +HP+CF C  C K      F +++ +     YCE D+ E +  KCF C   +++ D++++   +NYH +C+
Sbjct: 1977 NSNVDNSPGAGGKSAGAFGATSAPKR-GRGILNKAAGPGVRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK-GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGN----AYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQCF 2166          

HSP 2 Score: 56.6102 bits (135), Expect = 4.144e-7
Identity = 27/66 (40.91%), Postives = 42/66 (63.64%), Query Frame = 3
Query:  126 FKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQA 323
             +I+L+R + +  WGF +QGG DF  PL V +V   S+S++ GL+  D ++KIND+    L H+ A
Sbjct:    7 LQIKLSRFD-AQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDVFNLRHKDA 71          
BLAST of LIM domain protein vs. UniProt/SwissProt
Match: sp|Q3SX40|PDLI7_BOVIN (PDZ and LIM domain protein 7 OS=Bos taurus OX=9913 GN=PDLIM7 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.265e-22
Identity = 52/157 (33.12%), Postives = 78/157 (49.68%), Query Frame = 3
Query:  813 SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            S+ K  +C  C   I+G Y+ A  + Y    F CS C K ++   F E K G ++C   ++   AP C KC K I  + + AL   WH  CF C  C   I    F+++E       YCE DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  242 SNGKTPVCHQCHKVIRGRYLVALGRAYHPEEFVCSQCGKVLEEGGFFEEK-GAIFCPPCYDVRYAPSCAKCKKKITGEVMHALKTTWHVHCFTCAACKAPIRNRAFYMEE----GAPYCEPDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF 393          

HSP 2 Score: 62.3882 bits (150), Expect = 4.367e-9
Identity = 30/82 (36.59%), Postives = 47/82 (57.32%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL 362
            M++FK+ L        WGF +QGGKDF  PLS+ R+TP   + + G+ V D ++ I+  ++  LTH +A  +I+     L L
Sbjct:    1 MDSFKVVL---EGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGGLTHIEAQNKIRACGERLSL 79          

HSP 3 Score: 54.299 bits (129), Expect = 1.540e-6
Identity = 32/106 (30.19%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK +I G  + A    +  + F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  308 CAKCKKKITGEVMHALKTTWHVHCFTCAACKAPIRNRAFY-MEEGAPYCEPDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKD 412          
BLAST of LIM domain protein vs. UniProt/SwissProt
Match: sp|Q9NR12|PDLI7_HUMAN (PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.690e-22
Identity = 52/158 (32.91%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  810 NSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +++ K  +C  C   I+G Y+ A    Y    F CS C K ++   F E K G ++C   ++   AP C KC K I  + + AL   WH  CF C  C   I    F+++E     V YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  274 SNNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEK-GAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEE----GVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCF 426          

HSP 2 Score: 63.1586 bits (152), Expect = 2.346e-9
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL 362
            M++FK+ L        WGF +QGGKDF  PLS+ R+TP   + + G+ V D ++ I+  ++ +LTH +A  +I+     L L
Sbjct:    1 MDSFKVVL---EGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERLSL 79          

HSP 3 Score: 53.9138 bits (128), Expect = 2.114e-6
Identity = 32/106 (30.19%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK +I G  + A    +  + F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  C  ++    F+ K++
Sbjct:  341 CAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFY-MEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKD 445          
BLAST of LIM domain protein vs. TrEMBL
Match: R7UEP6 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_163591 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 8.665e-47
Identity = 112/404 (27.72%), Postives = 193/404 (47.77%), Query Frame = 3
Query:  123 NFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIVLPSKTFESAKTDQKYSNNTSTK----ADKTPEL--------SLKTDNIELLKKLT---SSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSF--CSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +    L R + ST WGF + GGKDFGCPLS+ +V PNS++ + GL+  D ++KI D  ++ + H++A   I +    LEL  L R              G  S +  V A     P PP    +     NS     P  T  V   K    P   +         ++ TS      ++ +P +        S    ++     ++   S+  K Q ++P+      +  + E R+     +      +++ +C  C   I+G ++ A +K +C NHF C+   C +P+    F+E + G L+C  D+  + AP C KC  +II +++      +H QCF+C+HC  +I +G++H   +DN+  IYC KD+ + ++ KC+GC+  I+  D++++    N+H EC+
Sbjct:    5 SLSARLDRTDSSTPWGFRMHGGKDFGCPLSIQKVNPNSLAQQCGLQTGDAIVKIGDSPTDGMMHREAQQTIVSCGNHLELA-LQR------------GGGRPSATSHVQAPSYPTPAPPQNNYAPQPPQNSFAASAPSSTLPVAVNKQYNTPINMYSVNNVMDTLAHQTSGVNIGISEPSPSVPWQKSSGGSAPPSHVPQTVGVSVGGSAAGKWQPSIPTGPRNMKVGKRGEARN-----MPAAGGGTRVPMCATCNISIRGPFVSALDKTWCPNHFVCANPQCRQPLIDVGFVE-EAGQLFCENDYRMYFAPHCGKCGDAIIGERVSTQIGHYHAQCFVCSHCGGAISEGRYHT--QDNK--IYCLKDWGQLFQTKCYGCEFPIEPGDRWVEALNENWHSECF 385          
BLAST of LIM domain protein vs. TrEMBL
Match: C1LG63 (PDZ and LIM domain protein OS=Schistosoma japonicum OX=6182 GN=EWB00_008747 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.947e-41
Identity = 116/401 (28.93%), Postives = 192/401 (47.88%), Query Frame = 3
Query:  123 NFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELXXXXXVIDSG--NFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIVLPSKTFESAKTDQKYSNNTST-------KADKT-PELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKM----AICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +F I ++R + ++ WGF I+GG+DF  PL +  VT   ++D  GLR    ++ I    ++ +THQQA+  I      LEL+              V D+G  N+S+S  V      +      +  +                 +  T PI+    +  +  T + YS+N+ T       + D+T P  +L+ D   L   L +    N  N P       + N +    S + ++++    SK      IC+VC+ +I G +I+ N++ +C NHF C  C + +    F E + G LYC +DFE  VA +C KC   +I +   AL + WHP CF+C+ CHK +    FH+ E+DN+  + CE+ +K+ +E +C  CK  I   D+++Q     YH +C+
Sbjct:    2 SFFIRISRPDPASPWGFRIRGGRDFKEPLYISSVTHGGLADISGLRTGMHVLSIGRDPTDKMTHQQALQAIIRCCNDLELE--------------VYDNGSHNYSDSTPVHKMNMFVTQSSLSIELNKPREPPRPQTNISKVVHI-GTSPIISRPHS-PNGTTIRSYSSNSPTVHGRVLAEKDRTLPVYTLQKDIRPLHSPLNNQYTYNAINQP-------MPNIQIGTKSDNPLLKRGTRRSKNFRINPICYVCQQQIHGPFIDTNDRCFCPNHFICDLCHQQLNEDSFAE-QNGKLYCEKDFEQFVAYKCAKCYLPVIGKITKALNQTWHPYCFICHQCHKPL-DDLFHV-EDDNR--VLCEEHWKQLHETECAKCKQPISEIDRFIQACGKQYHAKCF 374          
BLAST of LIM domain protein vs. TrEMBL
Match: A0A2H1C470 (LIM domain protein OS=Fasciola hepatica OX=6192 GN=D915_007308 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 7.857e-41
Identity = 110/398 (27.64%), Postives = 189/398 (47.49%), Query Frame = 3
Query:  132 IELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPR-----FESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXX---TAFVPQTKPIVLPS-KTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKL--TSSDKKNQENVPSKSLGKFLQNQEE---MRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            + +TR + S TWGF IQGG+DFG  L +  VTP  ++++ G++  D ++ I   S+ ++THQQA   +      LE++ +P       +SE+ P    I + +  ++    A               +  S++  Y         ++ PQ  P   PS +  +  +  Q  S N +    + P  S + + + L   L   S DK       + + G  L N      ++  K   IQ  N+  +  IC  CK  I G +++A +  +C  HF C  C  P+K   F E ++G  YC +DF  +VA +C KC   II     AL K WHP CF+C +C + + + +FH+++ D    + CE+ +++ +  +C  CK +I   D++++     YH +C+
Sbjct:    5 VNITRPDPSITWGFRIQGGRDFGQQLRIASVTPGGLAERYGIQAGDQVVTIGGDSTVSMTHQQAQQAVIRCCNELEIEVVPSSHVHSTKSEVTPHNEWIQTASVPHAYAPKAQSTVNINLHKPNPIGHSPSDAAGYRANSGYSLDSYAPQ--PYKPPSARQLDRIEPTQTPSLNETVSFTR-PTYSSQPNTVPLRSGLYKPSVDK-------NLTTGGALHNPSSSGLLQGMKAATIQPQNT-RRRPICHYCKSPILGPFVDAVDYCFCPEHFLCFTCRVPLKDRYFAE-EDGKFYCQDDFMQNVASKCAKCGSPIIGIITKALDKSWHPHCFVCCYCKRPL-RDKFHVEDADQ---VLCEEHWQQLHLTECAKCKQSISEIDRFIEAFGKQYHAKCF 386          
BLAST of LIM domain protein vs. TrEMBL
Match: A0A183AWW4 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS11449 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 9.840e-40
Identity = 110/402 (27.36%), Postives = 188/402 (46.77%), Query Frame = 3
Query:  129 KIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELK-----RLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQ-----TKPIVLPSKTFESAKTDQKYSNNTSTKADKT------PELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYK 1286
            KI+++R +  T WGF IQGG+DFG  L +  VTP  ++++ G++  D ++ I    + ++THQQA   +      LE++      +P  E E+ P    + +   S S     + + +     + N    AS+           + PQ     T     PS++  +    +  S N  T  +KT      P L     N       T+S  ++  ++P+  +             K   IQ  N+  +  IC  CK  I+G +++A +  +C  HF C  C  P+    F E ++G  YC +DF  HVA RC KC   +I + I AL K WHP CF+C +C + + + +FH+ E+ NQ  + CE+ +++ +  +C  CK  I   D++++     +H  C++
Sbjct:    4 KIDISRPDPGTPWGFRIQGGRDFGQQLRIASVTPGGLAERNGIQAGDQVVTIGGDPASSMTHQQAQQAVIRCCNQLEMEVVASSHVPEPEPEIKPYSSWVSTIGNSYSKATPKTQSTVNINLHKPNPIGGASHGTLNDWNDLDNYAPQPYGRPTSKQTGPSESVYAPVLYETISYNKPTVTEKTSTNPVRPALYRPQANKSPTTTTTTSYPRS--SIPTTGM-------------KSATIQPQNTQ-RHPICHYCKSPIQGPFVDAVDYCFCPEHFFCFTCRVPLNDRYFAE-EDGKFYCHDDFVKHVASRCAKCGSPVIGKIIKALDKSWHPYCFVCCYCKRPL-EDKFHV-EDANQ--VLCEEHWQQLHLTECAKCKQPISEIDRFIEAIGKQFHAGCFR 384          
BLAST of LIM domain protein vs. TrEMBL
Match: A0A2T7Q0Q3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01883 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 6.659e-39
Identity = 113/423 (26.71%), Postives = 184/423 (43.50%), Query Frame = 3
Query:  126 FKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQA----ILQIQNLNVLLE-------------------------LKRLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIVLPSKTFE----SAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSK--MAICFVCKDRIKGSYIEANNKIYCSNHFCCSF--CSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             + +L R   ST WGF +QGGKDF  PL++ +V P S++ K GL+  D+++KI +IS++ L H++A    I     L++LL+                         L+  P   S+          G    S   SA     P    +  +   ++ SI      P A     KP+  P+ T++    +  T QK +   ST        +             S  +     V  K  G   +         D ++    + S+  + +C  C   I+G ++ A    +C +HF C+   C   +    F+E + G LYC  D+E ++AP C KC+ +II + + AL   WHP+CF+C  C   I   QFH++E       YCEKD+   ++  C GC   I+  D++++    N+H EC+
Sbjct:    6 LEAKLERTESSTPWGFRMQGGKDFSSPLTIQKVNPGSLASKCGLQQGDIILKIGNISTDILRHKEAQESIIASGNRLDLLLQRGGAPATSIVQNYETFSAPSYNANALQNQPPTPSQQTFNAAPRPFGGSVQSAPTSAPTPFKPSYGKDDLAQRTSNLSISPGSGAPPAPQFNPKPVAAPASTYQKPAAAPSTYQKPAAAPSTYQKPA--AAPAAKPWTPAAPAPSGPRPFDSGVAPKPTGVGAKRGR----LGDAVVSNPVAGSQNRIPVCSSCGSPIRGPFVTAVGNCWCPDHFVCANPQCGIKLIDIGFVE-EGGFLYCERDYERYLAPHCKKCNAAIIGECVNALQSTWHPECFICAQCKLPIGGTQFHVEEGKP----YCEKDWGAMFQTMCAGCDFPIEPGDRWVEALGKNFHSECF 417          
BLAST of LIM domain protein vs. Ensembl Cavefish
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:103043607])

HSP 1 Score: 103.99 bits (258), Expect = 1.257e-23
Identity = 48/169 (28.40%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  786 KDLIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +D ++Q+     + ++  +C  C   I+G ++ A  K +    F C+ C   +    F+E + G++YC   +E ++AP C +C + ++ + I AL + WH  CFLC  C + I    FH+++     + YCE+DY   +   C GC   I++ DK+L+     +H  C+
Sbjct:  269 QDSLVQRAEHIPAGTRTPMCGHCNQVIRGPFLVAMGKSWHPEEFNCAHCHCSMADLGFVEER-GSVYCENCYEQYLAPTCCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTFHLED----GLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCF 432          

HSP 2 Score: 59.3066 bits (142), Expect = 4.973e-9
Identity = 30/80 (37.50%), Postives = 51/80 (63.75%), Query Frame = 3
Query:  159 TTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLELKR-LPRFE 383
            + WGF +QGGKDF  PL+V R+T    + K  + V D+++ I+ IS++++TH +A  +I+    NLN+ L+    +P+ E
Sbjct:   13 SPWGFRLQGGKDFSMPLTVSRLTDGGKAAKAKISVGDVVLSIDGISTDSMTHLEAQNKIKACTGNLNLNLQRPSAVPKVE 92          

HSP 3 Score: 50.8322 bits (120), Expect = 2.101e-6
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            C  C+ ++ G  I A  + +  + F C+ C +PI+   F   ++G  YC  D+       C  C   I   ++ + ALG  WH  CF+C+ C+ S+ +GQ    ++D
Sbjct:  347 CCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTF-HLEDGLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCFVCSVCNTSL-EGQTFFSKKD 451          
BLAST of LIM domain protein vs. Ensembl Cavefish
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:103043607])

HSP 1 Score: 104.375 bits (259), Expect = 2.025e-23
Identity = 48/169 (28.40%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  786 KDLIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +D ++Q+     + ++  +C  C   I+G ++ A  K +    F C+ C   +    F+E + G++YC   +E ++AP C +C + ++ + I AL + WH  CFLC  C + I    FH+++     + YCE+DY   +   C GC   I++ DK+L+     +H  C+
Sbjct:  449 QDSLVQRAEHIPAGTRTPMCGHCNQVIRGPFLVAMGKSWHPEEFNCAHCHCSMADLGFVEER-GSVYCENCYEQYLAPTCCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTFHLED----GLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCF 612          

HSP 2 Score: 59.3066 bits (142), Expect = 5.425e-9
Identity = 30/80 (37.50%), Postives = 51/80 (63.75%), Query Frame = 3
Query:  159 TTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLELKR-LPRFE 383
            + WGF +QGGKDF  PL+V R+T    + K  + V D+++ I+ IS++++TH +A  +I+    NLN+ L+    +P+ E
Sbjct:   13 SPWGFRLQGGKDFSMPLTVSRLTDGGKAAKAKISVGDVVLSIDGISTDSMTHLEAQNKIKACTGNLNLNLQRPSAVPKVE 92          

HSP 3 Score: 50.8322 bits (120), Expect = 2.368e-6
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            C  C+ ++ G  I A  + +  + F C+ C +PI+   F   ++G  YC  D+       C  C   I   ++ + ALG  WH  CF+C+ C+ S+ +GQ    ++D
Sbjct:  527 CCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTF-HLEDGLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCFVCSVCNTSL-EGQTFFSKKD 631          
BLAST of LIM domain protein vs. Ensembl Cavefish
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:103043607])

HSP 1 Score: 104.375 bits (259), Expect = 2.219e-23
Identity = 48/169 (28.40%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  786 KDLIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +D ++Q+     + ++  +C  C   I+G ++ A  K +    F C+ C   +    F+E + G++YC   +E ++AP C +C + ++ + I AL + WH  CFLC  C + I    FH+++     + YCE+DY   +   C GC   I++ DK+L+     +H  C+
Sbjct:  454 QDSLVQRAEHIPAGTRTPMCGHCNQVIRGPFLVAMGKSWHPEEFNCAHCHCSMADLGFVEER-GSVYCENCYEQYLAPTCCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTFHLED----GLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCF 617          

HSP 2 Score: 59.3066 bits (142), Expect = 5.400e-9
Identity = 30/80 (37.50%), Postives = 51/80 (63.75%), Query Frame = 3
Query:  159 TTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLELKR-LPRFE 383
            + WGF +QGGKDF  PL+V R+T    + K  + V D+++ I+ IS++++TH +A  +I+    NLN+ L+    +P+ E
Sbjct:   13 SPWGFRLQGGKDFSMPLTVSRLTDGGKAAKAKISVGDVVLSIDGISTDSMTHLEAQNKIKACTGNLNLNLQRPSAVPKVE 92          

HSP 3 Score: 50.8322 bits (120), Expect = 2.569e-6
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            C  C+ ++ G  I A  + +  + F C+ C +PI+   F   ++G  YC  D+       C  C   I   ++ + ALG  WH  CF+C+ C+ S+ +GQ    ++D
Sbjct:  532 CCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTF-HLEDGLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCFVCSVCNTSL-EGQTFFSKKD 636          
BLAST of LIM domain protein vs. Ensembl Cavefish
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:103043607])

HSP 1 Score: 104.375 bits (259), Expect = 2.462e-23
Identity = 48/169 (28.40%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  786 KDLIIQKTN---SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            +D ++Q+     + ++  +C  C   I+G ++ A  K +    F C+ C   +    F+E + G++YC   +E ++AP C +C + ++ + I AL + WH  CFLC  C + I    FH+++     + YCE+DY   +   C GC   I++ DK+L+     +H  C+
Sbjct:  461 QDSLVQRAEHIPAGTRTPMCGHCNQVIRGPFLVAMGKSWHPEEFNCAHCHCSMADLGFVEER-GSVYCENCYEQYLAPTCCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTFHLED----GLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCF 624          

HSP 2 Score: 59.3066 bits (142), Expect = 5.671e-9
Identity = 30/80 (37.50%), Postives = 51/80 (63.75%), Query Frame = 3
Query:  159 TTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQ----NLNVLLELKR-LPRFE 383
            + WGF +QGGKDF  PL+V R+T    + K  + V D+++ I+ IS++++TH +A  +I+    NLN+ L+    +P+ E
Sbjct:   13 SPWGFRLQGGKDFSMPLTVSRLTDGGKAAKAKISVGDVVLSIDGISTDSMTHLEAQNKIKACTGNLNLNLQRPSAVPKVE 92          

HSP 3 Score: 50.8322 bits (120), Expect = 2.789e-6
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            C  C+ ++ G  I A  + +  + F C+ C +PI+   F   ++G  YC  D+       C  C   I   ++ + ALG  WH  CF+C+ C+ S+ +GQ    ++D
Sbjct:  539 CCRCQQKVLGEVINALKQTWHVHCFLCTSCQQPIRNNTF-HLEDGLAYCERDYYALFGTSCHGCDFPIEAGDKFLEALGFTWHDTCFVCSVCNTSL-EGQTFFSKKD 643          
BLAST of LIM domain protein vs. Ensembl Cavefish
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:103047884])

HSP 1 Score: 100.523 bits (249), Expect = 2.061e-22
Identity = 51/157 (32.48%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  813 SDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            S  +  +C  C   I+G Y+ A  + +    F C  C   +    F E K G++YC + ++N  AP C KC K I  + + AL   +H QCFLC  C   I    F+++E +     YCE+DY++ +  KC GC   ID+ D++L+    ++H  C+
Sbjct:  295 STGRTPLCGACNKIIRGRYVVALGRSWHPEEFTCCQCRVMLDEGGFFEEK-GSVYCTKCYDNRYAPNCDKCKKKITGEIMHALKMTYHVQCFLCAACKTPIRNQAFYMEEGEP----YCERDYEKMFGTKCHGCDFKIDAGDRFLEALGYSWHDTCF 446          

HSP 2 Score: 57.3806 bits (137), Expect = 1.818e-8
Identity = 34/106 (32.08%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  CK +I G  + A    Y    F C+ C  PI+   F   +EG  YC  D+E     +C  C   I   ++ + ALG  WH  CF+C  CH ++    F+ K++
Sbjct:  361 CDKCKKKITGEIMHALKMTYHVQCFLCAACKTPIRNQAFY-MEEGEPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGYSWHDTCFVCALCHINLEGKTFYSKKD 465          
BLAST of LIM domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 1.054e-23
Identity = 51/161 (31.68%), Postives = 82/161 (50.93%), Query Frame = 3
Query:  801 QKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            Q      +  +C  C   I+G ++ A  K +    F C+ C   +  T F+E ++G +YC   +E + AP C KC K I+ + + AL + WH  CF+C  C K      FH+  ED +   YCEKDY   +  KC GC   +++ DK+++   + +H  C+
Sbjct:  408 QHCQPSQRTPMCGQCNQIIRGPFLVALGKSWHPAEFNCAQCHTTLTETGFVE-EQGNVYCETCYEKYFAPDCAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPFGNSLFHM--EDGEP--YCEKDYVVLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCF 563          

HSP 2 Score: 62.3882 bits (150), Expect = 1.220e-10
Identity = 28/86 (32.56%), Postives = 53/86 (61.63%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNL--NVLLELKR 368
            M N+ + L   +    WGF +QGGKDF  PL++ R++P S + +  +   D++++I+   ++++TH +A  +I+N   N+ L L+R
Sbjct:    1 MSNYAVTL---HGPAPWGFRLQGGKDFNMPLTISRISPGSKAAQATVVPGDVVLQIDGTPTDSMTHLEAQTKIKNSVGNLRLTLQR 83          

HSP 3 Score: 55.4546 bits (132), Expect = 1.724e-8
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  C+ +I G  + A  + + +  F C+ C KP  G      ++G  YC +D+    + +C  C   +   ++ I ALG  WH  CF+C  CH ++    F+ K++
Sbjct:  478 CAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPF-GNSLFHMEDGEPYCEKDYVVLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKD 582          
BLAST of LIM domain protein vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 92.8189 bits (229), Expect = 2.349e-20
Identity = 58/196 (29.59%), Postives = 94/196 (47.96%), Query Frame = 3
Query:  726 NVPSKSLGKFLQNQ--EEMRDSKDLIIQKTNSD-SKMAI-------CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            ++P ++ G  +QN+   +  D  D ++    SD ++  +       C  C   I G  + A  + +   HF C+ C + I    F E ++G  YC +D+    +PRC  CS  I+++ + AL K WHP+ F C  C        FH  E+D +   YC +DY E +  KC GC  AI   + Y+   +  +H EC+
Sbjct:  277 SIPGQA-GGVIQNKGGAQTGDQLDSMLGSLQSDLNRQGVATLAKGQCAACLKPIAGQVVTAMGRTWHPEHFVCTECQEEIGARNFFE-RDGLPYCEKDYHFLFSPRCAYCSGPILDKVVTALDKTWHPEHFFCVQCGHFFGDEGFH--EKDGKP--YCRQDYFEMFAPKCGGCSRAI--VENYISALSALWHPECF 464          

HSP 2 Score: 79.337 bits (194), Expect = 5.059e-16
Identity = 45/131 (34.35%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C  C   I    + A +K +   HF C  C     G +    K+G  YC +D+    AP+C  CS++I+E  I AL   WHP+CF+C  C      G F   E + Q   YCE  Y E     C GC+  I
Sbjct:  381 CAYCSGPILDKVVTALDKTWHPEHFFCVQCGH-FFGDEGFHEKDGKPYCRQDYFEMFAPKCGGCSRAIVENYISALSALWHPECFVCRECFTPFINGSFF--EHEGQP--YCEVHYHERRGSLCSGCQKPI 506          

HSP 3 Score: 50.8322 bits (120), Expect = 5.205e-7
Identity = 39/126 (30.95%), Postives = 56/126 (44.44%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFG 1211
            C  C   I  +YI A + ++    F C  C  P     F E  EG  YC   +       C  C K I  + I A+ K +HP+ F+C  C K + +G F  KE++++   YC   +     IK FG
Sbjct:  440 CGGCSRAIVENYISALSALWHPECFVCRECFTPFINGSFFE-HEGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YCHPCF-----IKLFG 555          
BLAST of LIM domain protein vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 76.6406 bits (187), Expect = 2.598e-16
Identity = 46/140 (32.86%), Postives = 70/140 (50.00%), Query Frame = 3
Query:  870 IEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQ--IMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            + A  + +   HF C  C   I    F E K+G  YC ED+ +  +PRC  C++++++ Q  + AL + WHP+ F C  C +   +  FH  E D +   YC +DY   +  KC GC  AI  +  YL      +H EC+
Sbjct:    3 VTAMGRTWHPEHFVCVHCQVEIGSRNFFE-KDGQPYCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFH--ERDGKP--YCRQDYYGMFAPKCNGCSRAIMQN--YLSALNTVWHPECF 135          

HSP 2 Score: 71.2478 bits (173), Expect = 1.843e-14
Identity = 39/121 (32.23%), Postives = 60/121 (49.59%), Query Frame = 3
Query:  870 IEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDS 1232
            + A ++ +   HF C+ C +P  G +    ++G  YC +D+    AP+C  CS++I++  + AL   WHP+CF+C  C      G F   E + Q   YCE  Y E     C GC+  I  
Sbjct:   64 VTALDRTWHPEHFFCAQCGRPF-GEEGFHERDGKPYCRQDYYGMFAPKCNGCSRAIMQNYLSALNTVWHPECFICRECFTPFINGSFF--EHEGQP--YCEVHYHERRGSLCSGCQKPITG 179          

HSP 3 Score: 47.7506 bits (112), Expect = 1.932e-6
Identity = 25/78 (32.05%), Postives = 40/78 (51.28%), Query Frame = 3
Query: 1044 QQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVE 1277
            Q + A+G+ WHP+ F+C HC   I  G  +  E+D Q   YCE+DY   +  +C  C  A+  + + +      +H E
Sbjct:    1 QVVTAMGRTWHPEHFVCVHCQVEI--GSRNFFEKDGQP--YCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPE 74          

HSP 4 Score: 45.8246 bits (107), Expect = 7.262e-6
Identity = 39/126 (30.95%), Postives = 57/126 (45.24%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFG 1211
            C  C   I  +Y+ A N ++    F C  C  P     F E  EG  YC   +       C  C K I  + I A+ K +HP+ F+C  C K + +G F  KE++++   YC+  +     IK FG
Sbjct:  111 CNGCSRAIMQNYLSALNTVWHPECFICRECFTPFINGSFFE-HEGQPYCEVHYHERRGSLCSGCQKPITGRCISAMAKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YCQPCF-----IKLFG 226          
BLAST of LIM domain protein vs. Ensembl Sea Lamprey
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 58.9214 bits (141), Expect = 1.465e-9
Identity = 45/160 (28.12%), Postives = 65/160 (40.62%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFEN--------HVAPRCFKCSKSIIE-QQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYK 1286
            C  C D ++G  + A  K Y    F C+ C  P      +        C    +           +  C  C   I+  Q ++AL K WH  CF C  C K +  G++  K+     V YCE+DY+  + IKC  C   I    K L+ G  +YH  C +
Sbjct:   73 CTGCGDFVEGEVVTALGKTYHPQCFVCAVCRCPFPAGDRVTFNGKDCLCQRCIQPVATNAKDIGASTNCTGCGSDIMNGQALLALDKQWHLGCFKCKTCGKVL-TGEYISKD----GVPYCEQDYQSQFGIKCEECGKFITG--KVLEAGEKHYHPSCAR 225          

HSP 2 Score: 56.225 bits (134), Expect = 1.301e-8
Identity = 29/106 (27.36%), Postives = 44/106 (41.51%), Query Frame = 3
Query:  807 TNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQG 1124
            +  D    +C  C +  KG  +   ++ +    F C  C   +    F   K G   C  D++     RC  C   +  + + ALGK +HPQCF+C  C    P G
Sbjct:    5 SGKDKPPILCHKCSEPCKGEALRVQDRHFHIKCFICKVCGCDLAQNGFF-MKSGEYLCTHDYQQQHGTRCTGCGDFVEGEVVTALGKTYHPQCFVCAVCRCPFPAG 109          
BLAST of LIM domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006267.1 (pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 gene:ENSPMAG00000005668.1 transcript:ENSPMAT00000006267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.348e-9
Identity = 42/169 (24.85%), Postives = 71/169 (42.01%), Query Frame = 3
Query:  801 QKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQ---FHIKE----EDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYK 1286
            Q    D     C+ C+D  +G  +   N+ +  + F C  C   +    F   K G   C  D++     RC  C   +  + + ALG+ +HP+CF+C+ C +  P G    F+ +E    E  Q +    +D        C GC   I +    L +   ++H+ C+K
Sbjct:   14 QSVLVDKPAIHCYKCRDLCRGEVLRVENRHFHVSCFTCKVCGCDLAQCGFF-VKNGEYVCTLDYQRLYGTRCQACGDFVEGEVVTALGRTYHPRCFVCSVCRQPFPSGARVTFNGRECLCHECTQPISPVLRDPSN--PSNCAGCGRDIKNGQALLAL-ERHWHLGCFK 178          

HSP 2 Score: 46.595 bits (109), Expect = 3.548e-6
Identity = 38/141 (26.95%), Postives = 60/141 (42.55%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAP---------RCFKCSKSIIE-QQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C  C D ++G  + A  + Y    F CS C +P      +        C E  +  ++P          C  C + I   Q ++AL + WH  CF C  C K +  G++  K+     + YCE+DY   + + C GC+  I
Sbjct:   84 CQACGDFVEGEVVTALGRTYHPRCFVCSVCRQPFPSGARVTFNGRECLCHECTQP-ISPVLRDPSNPSNCAGCGRDIKNGQALLALERHWHLGCFKCRACGKVL-TGEYISKD----GMPYCERDYHSQFGVLCDGCEKYI 218          
BLAST of LIM domain protein vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 50.8322 bits (120), Expect = 4.150e-7
Identity = 29/90 (32.22%), Postives = 41/90 (45.56%), Query Frame = 3
Query:  831 ICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQI-MALGK---CWHPQCF 1088
            +C VC   ++G Y  A    Y   HF C+ C+ P  G +        LYC   F  + + RC  C   I +Q I    G+   CWHP+C+
Sbjct:   97 LCHVCDTPLRGLYYTAFGYRYDEEHFSCTICATPC-GVKKCFMYGNQLYCKYHFLKYFSKRCKGCEFPISDQYIEFPKGEEIHCWHPECY 185          
BLAST of LIM domain protein vs. Ensembl Nematostella
Match: LDB3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY2])

HSP 1 Score: 89.7373 bits (221), Expect = 4.207e-21
Identity = 46/143 (32.17%), Postives = 79/143 (55.24%), Query Frame = 3
Query:  858 KGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYK 1286
            +G ++ A  K +  +HF C+ C   ++   FIE + G LYC +D+    AP C  C + I+   + A+GK +HP+ F C+ C K I    F++    ++ + YCE  YK+ + +KC GC  AI   D++++    ++H  C+K
Sbjct:    1 RGPFVSAIGKSWHPDHFTCAGCGDSLQNQGFIE-EGGKLYCEKDYNKFFAPHCESCKQPIVGPCVQAIGKTFHPEHFTCSSCSKQIGSEGFNV----DRGMPYCEMCYKKLFCVKCAGCNRAIGGGDRWVEAIDVSWHATCFK 138          

HSP 2 Score: 55.8398 bits (133), Expect = 2.628e-9
Identity = 39/133 (29.32%), Postives = 62/133 (46.62%), Query Frame = 3
Query:  741 SLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFH 1133
              G  LQNQ  + +   L  +K  +      C  CK  I G  ++A  K +   HF CS CSK I G++      G  YC   ++     +C  C+++I   ++ + A+   WH  CF C+ C+K +   QF+
Sbjct:   21 GCGDSLQNQGFIEEGGKLYCEKDYNKFFAPHCESCKQPIVGPCVQAIGKTFHPEHFTCSSCSKQI-GSEGFNVDRGMPYCEMCYKKLFCVKCAGCNRAIGGGDRWVEAIDVSWHATCFKCSTCNKLLEGSQFY 152          
BLAST of LIM domain protein vs. Ensembl Nematostella
Match: EDO41181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S548])

HSP 1 Score: 87.8113 bits (216), Expect = 1.325e-19
Identity = 50/163 (30.67%), Postives = 78/163 (47.85%), Query Frame = 3
Query:  795 IIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            + ++  S +K  +C  C   I G    A  K +   HF C  C  P+ GTQ    ++G  YC  D+ +  APRC  C+  I++  + AL + WHP+ F+C  C        FH  E D +   +C +DY   +  +C GC   I   D Y+   + ++H EC+
Sbjct:   13 MTRQGVSTTKKGMCAACNKPIIGQVCTALGKTWHPEHFACVACEAPL-GTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILDSCVTALDQTWHPEHFVCAECGNPFGDTGFH--ERDGKP--FCREDYYAMFAPRCGGCGQPI--MDNYISALSAHWHAECF 168          

HSP 2 Score: 78.9518 bits (193), Expect = 1.356e-16
Identity = 47/150 (31.33%), Postives = 68/150 (45.33%), Query Frame = 3
Query:  777 RDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            RD K    ++   D+    C  C   I  S + A ++ +   HF C+ C  P   T F E ++G  +C ED+    APRC  C + I++  I AL   WH +CF+C  C +  P G F     D+    YCE  Y       C+ C+  I
Sbjct:   67 RDGKPYC-ERDYHDTFAPRCAYCNGPILDSCVTALDQTWHPEHFVCAECGNPFGDTGFHE-RDGKPFCREDYYAMFAPRCGGCGQPIMDNYISALSAHWHAECFICTECRQPFPGGSFF----DHDGRPYCEMHYHAKRGTLCYSCQKPI 210          

HSP 3 Score: 47.7506 bits (112), Expect = 3.748e-6
Identity = 33/120 (27.50%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFY 1193
            C  C   I  +YI A +  + +  F C+ C +P  G  F +  +G  YC   +       C+ C K I  + I A+ + +HP+ F+C  C K + +G F  KE++++   YC   + + +
Sbjct:  144 CGGCGQPIMDNYISALSAHWHAECFICTECRQPFPGGSFFD-HDGRPYCEMHYHAKRGTLCYSCQKPITGRCITAMHRKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YCHPCFVKLF 258          
BLAST of LIM domain protein vs. Ensembl Nematostella
Match: EDO39581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J0])

HSP 1 Score: 69.707 bits (169), Expect = 1.753e-13
Identity = 51/184 (27.72%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  765 QEEMRDSKDLIIQKTNSDSK---MAICFVCKDRI--KGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI---DSDDKYLQVGTNN--YHVECYK 1286
            +EE+    DL+++     S      +C  C  ++  +G+   A +K++    F C  C   + G  F +  +   YC  D+ + +   C+ C + I ++ + A GKC+HP CF C  CHK++    F +   DN   ++C +DY   Y  +C  C   I   D  D+ +++ + N  +HV CYK
Sbjct:   10 EEELDALTDLLMKNLEHSSDPDFFGMCSKCGQKVSGEGTGCTAMDKLFHIKCFICVKCGCQLTGKVFYKV-DNDAYCEADYLDSLE-TCWYCHQHITDRILRATGKCFHPHCFNCEECHKNLDGVPFTL---DNFNKVHCLEDYYRKYSPRCASCHQLILPEDGQDETVRIVSMNKDFHVRCYK 188          

HSP 2 Score: 48.521 bits (114), Expect = 2.181e-6
Identity = 26/104 (25.00%), Postives = 49/104 (47.12%), Query Frame = 3
Query:  825 MAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQ-------QIMALGKCWHPQCFLCNHCHKSI 1115
            +  C+ C   I    + A  K +  + F C  C K + G  F       ++C+ED+    +PRC  C + I+ +       +I+++ K +H +C+ C  C+K +
Sbjct:   93 LETCWYCHQHITDRILRATGKCFHPHCFNCEECHKNLDGVPFTLDNFNKVHCLEDYYRKYSPRCASCHQLILPEDGQDETVRIVSMNKDFHVRCYKCEDCNKQL 196          
BLAST of LIM domain protein vs. Ensembl Nematostella
Match: EDO32541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS6])

HSP 1 Score: 64.6994 bits (156), Expect = 1.868e-12
Identity = 40/122 (32.79%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  888 IYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDF---ENHVAP-RCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDK 1241
            +Y +  F C  C K ++G +F    E  +YC +D+   E H  P RC  C + I ++ +  LG+ +HP CF C  C   +    F +   D Q  IYC  DY   Y  +C  C+  I  D+K
Sbjct:    4 LYHAQCFLCHTCGKELRGQEFYRL-ENRVYCKQDYKSLERHQRPKRCHSCKEVIGQRILQTLGRDYHPVCFRCCVCEVELEGTPFTV---DRQNAIYCIPDYHRKYSPRCHACREPIAPDEK 121          

HSP 2 Score: 48.521 bits (114), Expect = 6.747e-7
Identity = 34/139 (24.46%), Postives = 61/139 (43.88%), Query Frame = 3
Query:  741 SLGKFLQNQEEMRDSKDLIIQK----TNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQ-------IMALGKCWHPQCFLCNHCHKSIPQG 1124
            + GK L+ QE  R    +  ++         +   C  CK+ I    ++   + Y    F C  C   ++GT F   ++  +YC+ D+    +PRC  C + I   +       ++ LGK +H +CF C   + S+ +G
Sbjct:   14 TCGKELRGQEFYRLENRVYCKQDYKSLERHQRPKRCHSCKEVIGQRILQTLGRDYHPVCFRCCVCEVELEGTPFTVDRQNAIYCIPDYHRKYSPRCHACREPIAPDEKSDETIRVVCLGKQFHDRCFKCEVTNNSLYRG 152          
BLAST of LIM domain protein vs. Ensembl Nematostella
Match: EDO41100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D2])

HSP 1 Score: 68.1662 bits (165), Expect = 2.701e-12
Identity = 39/140 (27.86%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  864 SYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            S +E +   +  N F C+ C + I  + F+  K+ T +C   +++  + RC  C + ++E  ++  G+ WH  CF C  CH+S+    F +++       YC + Y +FY  +C  C  AI   + Y  +  +N+H EC+
Sbjct:  367 SRLEYSGNFWHENCFRCANCGEAIGTSGFV-PKDDTFFCPGCYQSKFSKRCASCGEPLLEGGVLYNGETWHKACFSCYFCHRSLASAAFSVRD----GCRYCMECYGKFYAKQCEICLKAIVGGE-YYTLEESNFHKECF 500          

HSP 2 Score: 54.6842 bits (130), Expect = 5.569e-8
Identity = 43/146 (29.45%), Postives = 64/146 (43.84%), Query Frame = 3
Query:  861 GSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALG---KCWHPQCFLCNHCHKSI-PQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYK 1286
            G Y  A NK +   HF C  C   I G QFI   +  + C + F++  A  C  C + I  +         + WH +CF+C+ C + +  +G  H  E    T   C K Y   Y+ +C  C   IDS    L+   N +H  C++
Sbjct:  242 GEYTVAMNKNWHLGHFQCQTCDHSITGRQFIVRGDKPV-CTDCFKDSYAHECEACHQKIGPESRDISSDDDRHWHDKCFICDICRRPLKSEGSLHSTE----TKSCCNKCYVANYQKECCACGQIIDSGASRLEYSGNFWHENCFR 382          
BLAST of LIM domain protein vs. Ensembl Medaka
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:101158216])

HSP 1 Score: 135.961 bits (341), Expect = 8.972e-35
Identity = 97/411 (23.60%), Postives = 176/411 (42.82%), Query Frame = 3
Query:  147 LNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL----------KRLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAF-------------VPQTKPIV---LPSKTFESAKTDQKYSNNTSTKADKTPEL----SLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLI--IQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            L     WGF +QGGKDF  PL++ R+T    +    + + D+++ IN IS+E++ H +A  +I+     L L          + + + + E     PV++  N S++   ++    +         +  + +  F      T               V  TKP V     +KT+  +    +  N  ++    +P      S +   +  L+K+ +     + +VP+         Q    D   L+   +   + ++  +C  C + I+G ++ A    +    F C+ C   +    F+E K+  +YC+  +E   AP C  C + I+ + I AL + WH  CF+C  C + I    FH+  ED Q   YCE+DY   +   C GC   I++ DK+L+   + +H  C+
Sbjct:    9 LPGPAPWGFRLQGGKDFCMPLTISRLTEGGKAASARMSIGDVILSINGISTESMNHLEAQNKIKACTGTLSLTLQRVSAVSKEEVHKEDGETNTKKPVVEPENHSSAPSDASKKRVIEDTEDWHPRTGTSQSRSFRILAQITGTENEQTSENGGKNEVVDTKPTVHTTPTAKTYSKSAAAPRNGNIAASTFKSSPAAQSKPSFQPGGLPGLQKMAAGPSFGRVSVPAPKGPDRPTPQPHPEDLNSLVQRAEHIPAGTRTPMCCKCNNVIRGPFLVAMGMSWHPEEFNCAHCRSSLAECGFVEEKD-KVYCVHCYEQFFAPTCALCHQKILGEIINALKQTWHVSCFVCTACQQPIRSNVFHM--EDGQP--YCERDYNTLFNTTCHGCSFPIEAGDKFLEAVGHIWHDSCF 414          

HSP 2 Score: 50.8322 bits (120), Expect = 2.085e-6
Identity = 32/107 (29.91%), Postives = 52/107 (48.60%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            C +C  +I G  I A  + +  + F C+ C +PI+   F   ++G  YC  D+       C  CS  I   ++ + A+G  WH  CF+C  C  S+ +GQ    ++D
Sbjct:  329 CALCHQKILGEIINALKQTWHVSCFVCTACQQPIRSNVF-HMEDGQPYCERDYNTLFNTTCHGCSFPIEAGDKFLEAVGHIWHDSCFVCVACCTSL-EGQPFFSKKD 433          
BLAST of LIM domain protein vs. Ensembl Medaka
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:101158216])

HSP 1 Score: 105.145 bits (261), Expect = 1.157e-23
Identity = 65/251 (25.90%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  558 TKPIV--LP-SKTFESAKTDQKYSNNTSTKADKTPEL----SLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLI--IQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            TKP V   P +KT+  +    +  N  ++    +P      S +   +  L+K+ +     + +VP+         Q    D   L+   +   + ++  +C  C + I+G ++ A    +    F C+ C   +    F+E K+  +YC+  +E   AP C  C + I+ + I AL + WH  CF+C  C + I    FH+  ED Q   YCE+DY   +   C GC   I++ DK+L+   + +H  C+
Sbjct:  332 TKPTVHTTPTAKTYSKSAAAPRNGNIAASTFKSSPAAQSKPSFQPGGLPGLQKMAAGPSFGRVSVPAPKGPDRPTPQPHPEDLNSLVQRAEHIPAGTRTPMCCKCNNVIRGPFLVAMGMSWHPEEFNCAHCRSSLAECGFVEEKD-KVYCVHCYEQFFAPTCALCHQKILGEIINALKQTWHVSCFVCTACQQPIRSNVFHM--EDGQP--YCERDYNTLFNTTCHGCSFPIEAGDKFLEAVGHIWHDSCF 577          

HSP 2 Score: 56.225 bits (134), Expect = 4.815e-8
Identity = 25/72 (34.72%), Postives = 41/72 (56.94%), Query Frame = 3
Query:  147 LNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL 362
            L     WGF +QGGKDF  PL++ R+T    +    + + D+++ IN IS+E++ H +A  +I+     L L
Sbjct:    9 LPGPAPWGFRLQGGKDFCMPLTISRLTEGGKAASARMSIGDVILSINGISTESMNHLEAQNKIKACTGTLSL 80          

HSP 3 Score: 51.6026 bits (122), Expect = 1.477e-6
Identity = 32/107 (29.91%), Postives = 52/107 (48.60%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEED 1148
            C +C  +I G  I A  + +  + F C+ C +PI+   F   ++G  YC  D+       C  CS  I   ++ + A+G  WH  CF+C  C  S+ +GQ    ++D
Sbjct:  492 CALCHQKILGEIINALKQTWHVSCFVCTACQQPIRSNVF-HMEDGQPYCERDYNTLFNTTCHGCSFPIEAGDKFLEAVGHIWHDSCFVCVACCTSL-EGQPFFSKKD 596          
BLAST of LIM domain protein vs. Ensembl Medaka
Match: pxna (paxillin [Source:NCBI gene;Acc:101171569])

HSP 1 Score: 102.449 bits (254), Expect = 1.386e-22
Identity = 49/152 (32.24%), Postives = 77/152 (50.66%), Query Frame = 3
Query:  828 AICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             +C  CK  I G  + A  + +   HF C+ C + I    F E ++G  YC +D+ +  +PRC  C+  I+++ + AL K WHP+ F C  C        FH  E+D +   +C KDY + +  KC GC  AI   + Y+    + +H EC+
Sbjct:  899 GVCGACKKPIAGQVVTAMGRTWHPEHFVCTHCQEEIGSRNFFE-RDGQPYCEKDYHSLFSPRCHYCNGPILDKVVTALDKTWHPEHFFCAQCGSFFGPEGFH--EKDGKA--FCRKDYFDMFAPKCGGCARAI--LENYISALNSLWHPECF 1043          

HSP 2 Score: 83.9593 bits (206), Expect = 1.250e-16
Identity = 43/131 (32.82%), Postives = 62/131 (47.33%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C  C   I    + A +K +   HF C+ C     G +    K+G  +C +D+ +  AP+C  C+++I+E  I AL   WHP+CF+C  C      G F   + D Q   YCE  Y E     C GC+  I
Sbjct:  960 CHYCNGPILDKVVTALDKTWHPEHFFCAQCGS-FFGPEGFHEKDGKAFCRKDYFDMFAPKCGGCARAILENYISALNSLWHPECFVCRECFTPFINGSFF--DHDGQP--YCESHYHERRGSLCSGCQKPI 1085          

HSP 3 Score: 54.6842 bits (130), Expect = 1.669e-7
Identity = 35/112 (31.25%), Postives = 52/112 (46.43%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYC 1169
            C  C   I  +YI A N ++    F C  C  P     F +  +G  YC   +       C  C K I  + I A+GK +HP+ F+C  C K + +G F  KE++++   YC
Sbjct: 1019 CGGCARAILENYISALNSLWHPECFVCRECFTPFINGSFFD-HDGQPYCESHYHERRGSLCSGCQKPITGRCITAMGKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YC 1125          
BLAST of LIM domain protein vs. Ensembl Medaka
Match: pxna (paxillin [Source:NCBI gene;Acc:101171569])

HSP 1 Score: 101.679 bits (252), Expect = 2.137e-22
Identity = 49/152 (32.24%), Postives = 77/152 (50.66%), Query Frame = 3
Query:  828 AICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
             +C  CK  I G  + A  + +   HF C+ C + I    F E ++G  YC +D+ +  +PRC  C+  I+++ + AL K WHP+ F C  C        FH  E+D +   +C KDY + +  KC GC  AI   + Y+    + +H EC+
Sbjct:  701 GVCGACKKPIAGQVVTAMGRTWHPEHFVCTHCQEEIGSRNFFE-RDGQPYCEKDYHSLFSPRCHYCNGPILDKVVTALDKTWHPEHFFCAQCGSFFGPEGFH--EKDGKA--FCRKDYFDMFAPKCGGCARAI--LENYISALNSLWHPECF 845          

HSP 2 Score: 83.5741 bits (205), Expect = 1.315e-16
Identity = 42/131 (32.06%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI 1226
            C  C   I    + A +K +   HF C+ C     G +    K+G  +C +D+ +  AP+C  C+++I+E  I AL   WHP+CF+C  C      G F     D+    YCE  Y E     C GC+  I
Sbjct:  762 CHYCNGPILDKVVTALDKTWHPEHFFCAQCGS-FFGPEGFHEKDGKAFCRKDYFDMFAPKCGGCARAILENYISALNSLWHPECFVCRECFTPFINGSFF----DHDGQPYCESHYHERRGSLCSGCQKPI 887          

HSP 3 Score: 55.0694 bits (131), Expect = 1.317e-7
Identity = 35/112 (31.25%), Postives = 52/112 (46.43%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYC 1169
            C  C   I  +YI A N ++    F C  C  P     F +  +G  YC   +       C  C K I  + I A+GK +HP+ F+C  C K + +G F  KE++++   YC
Sbjct:  821 CGGCARAILENYISALNSLWHPECFVCRECFTPFINGSFFD-HDGQPYCESHYHERRGSLCSGCQKPITGRCITAMGKKFHPEHFVCAFCLKQLNKGTF--KEQNDKP--YC 927          
BLAST of LIM domain protein vs. Ensembl Medaka
Match: ldb3a (LIM domain-binding protein 3 [Source:NCBI gene;Acc:101165171])

HSP 1 Score: 101.293 bits (251), Expect = 2.195e-22
Identity = 46/161 (28.57%), Postives = 82/161 (50.93%), Query Frame = 3
Query:  801 QKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            ++  + S+  +C  C   I+G ++ A  + +    F C +C   +    F+E ++  +YC   +E   AP C +C+  I+ + + AL + WH  CF+C  C K      FH+  ED +   YCEKDY   +  KC GC   +++ DK+++   + +H  C+
Sbjct:  438 ERFAASSRTPLCGACNSVIRGPFLVALGRSWHPEEFNCHYCHVSLADVSFVE-EQNNVYCENCYEEFFAPTCARCNTKIMGEVMHALRQTWHTTCFVCAACGKPFGNSLFHM--EDGEP--YCEKDYIALFSTKCHGCDFPVEAGDKFIEALGHTWHDTCF 593          

HSP 2 Score: 61.2326 bits (147), Expect = 1.288e-9
Identity = 35/97 (36.08%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  147 LNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLEL-----KRLPRFESELXXXXXVIDSG 422
            L     WGF +QGGKDF  PL++ R+TP S +    L   D+++ I+ +S+E +TH +A  +I+  N  L L     KR P   +        IDSG
Sbjct:    8 LPGPGPWGFRLQGGKDFNMPLTISRITPGSKAALGNLIQGDVIVAIDGVSTEGMTHLEAQNKIKMANHSLALTMSKSKRPPPLAAPR------IDSG 98          

HSP 3 Score: 56.225 bits (134), Expect = 6.062e-8
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  834 CFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI--IEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEE 1145
            C  C  +I G  + A  + + +  F C+ C KP  G      ++G  YC +D+    + +C  C   +   ++ I ALG  WH  CF+C  CH ++    F+ K++
Sbjct:  508 CARCNTKIMGEVMHALRQTWHTTCFVCAACGKPF-GNSLFHMEDGEPYCEKDYIALFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFVCAVCHVNLEGHPFYSKKD 612          
BLAST of LIM domain protein vs. Planmine SMEST
Match: SMESG000066408.1 (SMESG000066408.1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 389/391 (99.49%), Postives = 389/391 (99.49%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELXXXXXVIDSGNFSNSCRVSASIXXXXXXXXXXXXXXVASNSIFYXXXXXTAFVPQTKPIVLPSKTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYKR 1289
            MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELPPPPPVIDSGNFSNSCRVSASINELPPPPPELNSSNVASNSIFYPPPPPT FVP TKPIVLPSKTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYKR
Sbjct:    1 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELPPPPPVIDSGNFSNSCRVSASINELPPPPPELNSSNVASNSIFYPPPPPTTFVPPTKPIVLPSKTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTSSDKKNQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYKR 391          
BLAST of LIM domain protein vs. Planmine SMEST
Match: SMESG000029617.1 (SMESG000029617.1)

HSP 1 Score: 117.857 bits (294), Expect = 2.044e-29
Identity = 61/169 (36.09%), Postives = 92/169 (54.44%), Query Frame = 3
Query:  783 SKDLIIQKTNSDSK--MAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            + D+ +  +N D K     C  C   I+G +I   +  +C NHF CS+C   +    F E K G  YC ED+ N +A  C KC K I+  ++ A+   WH  CF CN C   IP G    K  D+Q + YCE D+ E +++KC  C+  I   DK++++GT++YH +C+
Sbjct:  121 AGDIQLSHSNFDLKHRAPCCHGCTTEIRGPFIVVLDYCFCPNHFTCSYCFNDLSRGSFFEVK-GLFYCPEDYSNFIAAHCEKCHKPIVGNEVSAMDTKWHYGCFKCNRC--EIPLGDQLFKVGDDQ-MPYCENDWNELFQVKCLKCRGPITILDKFIEIGTSSYHAKCF 285          

HSP 2 Score: 62.7734 bits (151), Expect = 1.563e-10
Identity = 33/94 (35.11%), Postives = 52/94 (55.32%), Query Frame = 3
Query:  117 MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVNDLLIKINDISSETLTH---QQAILQIQN-LNVLLELKRLPRFES 386
            M+     L++      WGF IQGG+DF  PL + R+T +S++D  GL+  D + KIN+  +  + H   QQ I++  N LN+ +    LP  E+
Sbjct:    1 MKQMNFNLSKAGLHNPWGFRIQGGRDFNRPLIISRITCDSVADNSGLKCGDRITKINNFDTGFICHNEAQQVIIESGNTLNLEITRDPLPVAEN 94          
BLAST of LIM domain protein vs. Planmine SMEST
Match: SMESG000038145.1 (SMESG000038145.1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.255e-14
Identity = 52/152 (34.21%), Postives = 80/152 (52.63%), Query Frame = 3
Query:  858 KGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMED---FENHVAPR-CFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAI----DSDDKY-LQVGTNNYHVECYK 1286
            +G+ I   N +Y SN F C +C++ ++G  F + +E  +YC  D   F  H + + CF C   + E  + ALGK +HP+CF C+ CHK +    F +   +N   IYC  DY   +  +C  C   I    DSD+   + V   ++HVECY+
Sbjct:  215 EGACIALGN-LYHSNCFTCCYCNRSLRGRVFYKDQEK-IYCENDYMVFGFHKSVKVCFACGHIVTETILEALGKDFHPRCFKCSICHKCLDGIPFTVDRNNN---IYCIIDYHNTFAPRCAICLQPIIPRKDSDEVVRIVVNDRDFHVECYR 361          

HSP 2 Score: 56.225 bits (134), Expect = 3.053e-8
Identity = 34/124 (27.42%), Postives = 60/124 (48.39%), Query Frame = 3
Query:  753 FLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSIIEQ-------QIMALGKCWHPQCFLCNHC 1103
            F ++QE++    D ++   +   K  +CF C   +  + +EA  K +    F CS C K + G  F   +   +YC+ D+ N  APRC  C + II +       +I+   + +H +C+ C +C
Sbjct:  244 FYKDQEKIYCENDYMVFGFHKSVK--VCFACGHIVTETILEALGKDFHPRCFKCSICHKCLDGIPFTVDRNNNIYCIIDYHNTFAPRCAICLQPIIPRKDSDEVVRIVVNDRDFHVECYRCQNC 365          
BLAST of LIM domain protein vs. Planmine SMEST
Match: SMESG000009923.1 (SMESG000009923.1)

HSP 1 Score: 75.485 bits (184), Expect = 3.050e-14
Identity = 61/204 (29.90%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  780 DSKDLIIQKTNSDSKMAICFVCKDR-IKGSYIEANNKIYCSNHF------CCSFCSKPIK---------GTQF-------------IETKE-----GTLYCMEDFENHVAPRCFKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAID--SDDKYLQVGTNNYHVECY 1283
            DSKDL  ++ +   K  +C +C D  +  S+   +N +YC N F      CC  C K  +         G Q+             I TK      G + C+  +EN  A +CFKCS+ I +  I   G  WH +CFLC  C K + + +F  KEE      YC + + E +  +C  C   I      K++ VG +++H EC+
Sbjct:  315 DSKDLSFKEWHWHEKCFLCDICHDSLVDRSFTTKDNYLYCPNCFDEKFSSCCDGCGKIFRTGVKKYEYAGKQWHEDCFICADCNQSIGTKSFIPINGKISCIGCYENKHAQKCFKCSEIIRKSGITYKGDPWHKECFLCTSCQKMLSESKFTSKEEKP----YCTECFIELFCKRCKKCTQPISGFGGCKFISVGDDHWHTECF 514          

HSP 2 Score: 58.5362 bits (140), Expect = 7.456e-9
Identity = 43/171 (25.15%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  780 DSKDLIIQKTNSDSKMAICFVCKDRI-KGSYIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRCFKCSKSI-IEQQIMALGKC-WHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            DSK +   +   +     C  C + I    + +A ++ +   HF C  C   + GT++I  ++   +C++ FEN     C KCS+ I  + + ++  +  WH +CFLC+ CH S+    F  K+      +YC   + E +   C GC     +  K  +     +H +C+
Sbjct:  227 DSKAIFCLRHFGELTYCRCAECDELIVNKDFTKAMDQEFHVEHFACHVCDSSLTGTKYI-LRDDNPFCVKCFENQFGNTCHKCSEKISCDSKDLSFKEWHWHEKCFLCDICHDSLVDRSFTTKD----NYLYCPNCFDEKFSSCCDGCGKIFRTGVKKYEYAGKQWHEDCF 392          
BLAST of LIM domain protein vs. Planmine SMEST
Match: SMESG000013182.1 (SMESG000013182.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.389e-12
Identity = 31/91 (34.07%), Postives = 50/91 (54.95%), Query Frame = 3
Query: 1014 CFKCSKSIIEQQIM-ALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIYCEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECY 1283
            C KC K      I+ AL K WHP CF+C +C   + +  FH+K++      YC   +K+ Y+ +C GC   I+ +++Y+    N YH +C+
Sbjct:    7 CAKCCKPFTAGPILSALDKKWHPSCFVCVNCKGELARSSFHVKDDSP----YCVNCWKQLYQPRCTGCHTIIEPEEQYVTYNDNAYHKQCF 93          
The following BLAST results are available for this feature:
BLAST of LIM domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDLIM55.000e-2427.63PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM73.033e-2332.91PDZ and LIM domain 7 [Source:HGNC Symbol;Acc:HGNC:... [more]
PXN3.088e-2334.64paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
PDLIM73.519e-2332.91PDZ and LIM domain 7 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM54.162e-2327.63PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alp-13.761e-3032.16ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:... [more]
alp-14.161e-3032.16ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:... [more]
alp-14.860e-3032.16ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:... [more]
alp-15.576e-3032.16ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:... [more]
Y1A5A.15.147e-1630.48pep chromosome:WBcel235:III:3985565:3986809:-1 gen... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zasp528.467e-3030.77gene:FBgn0265991 transcript:FBtr0310086[more]
Zasp529.330e-3030.61gene:FBgn0265991 transcript:FBtr0329916[more]
Zasp529.334e-3030.89gene:FBgn0265991 transcript:FBtr0329914[more]
Zasp529.466e-3030.77gene:FBgn0265991 transcript:FBtr0310087[more]
Zasp529.807e-3030.61gene:FBgn0265991 transcript:FBtr0329915[more]
back to top
BLAST of LIM domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdlim76.834e-3225.94PDZ and LIM domain 7 [Source:NCBI gene;Acc:393813][more]
pdlim5b2.640e-2833.52PDZ and LIM domain 5b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pdlim5b2.640e-2833.52PDZ and LIM domain 5b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pdlim5a2.327e-2329.79PDZ and LIM domain 5a [Source:NCBI gene;Acc:436927... [more]
pdlim5a2.327e-2329.79PDZ and LIM domain 5a [Source:NCBI gene;Acc:436927... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef404.237e-3628.64Rho guanine nucleotide exchange factor 40 [Source:... [more]
arhgef404.711e-3526.60Rho guanine nucleotide exchange factor 40 [Source:... [more]
spryd39.930e-2425.10SPRY domain containing 3 [Source:Xenbase;Acc:XB-GE... [more]
spryd31.434e-2325.10SPRY domain containing 3 [Source:Xenbase;Acc:XB-GE... [more]
PDLIM52.057e-2329.83PDZ and LIM domain 5 [Source:NCBI gene;Acc:548530][more]
back to top
BLAST of LIM domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pxn8.785e-2333.99paxillin [Source:MGI Symbol;Acc:MGI:108295][more]
Pdlim71.070e-2232.28PDZ and LIM domain 7 [Source:MGI Symbol;Acc:MGI:19... [more]
Pdlim71.070e-2232.28PDZ and LIM domain 7 [Source:MGI Symbol;Acc:MGI:19... [more]
Pxn1.832e-2226.53paxillin [Source:MGI Symbol;Acc:MGI:108295][more]
Pxn3.314e-2232.89paxillin [Source:MGI Symbol;Acc:MGI:108295][more]
back to top
BLAST of LIM domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q679P3|PDLI7_CHICK1.655e-3727.11PDZ and LIM domain protein 7 OS=Gallus gallus OX=9... [more]
sp|Q6INU3|PDLI7_XENLA5.370e-3726.82PDZ and LIM domain protein 7 OS=Xenopus laevis OX=... [more]
sp|A1ZA47|ZASP_DROME1.400e-2730.61PDZ and LIM domain protein Zasp OS=Drosophila mela... [more]
sp|Q3SX40|PDLI7_BOVIN1.265e-2233.12PDZ and LIM domain protein 7 OS=Bos taurus OX=9913... [more]
sp|Q9NR12|PDLI7_HUMAN1.690e-2232.91PDZ and LIM domain protein 7 OS=Homo sapiens OX=96... [more]
back to top
BLAST of LIM domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UEP68.665e-4727.72Uncharacterized protein OS=Capitella teleta OX=283... [more]
C1LG631.947e-4128.93PDZ and LIM domain protein OS=Schistosoma japonicu... [more]
A0A2H1C4707.857e-4127.64LIM domain protein OS=Fasciola hepatica OX=6192 GN... [more]
A0A183AWW49.840e-4027.36Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A2T7Q0Q36.659e-3926.71Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdlim5b1.257e-2328.40PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim5b2.025e-2328.40PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim5b2.219e-2328.40PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim5b2.462e-2328.40PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim72.061e-2232.48PDZ and LIM domain 7 [Source:NCBI gene;Acc:1030478... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007081.11.054e-2331.68pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
PXN2.349e-2029.59paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
PXN2.598e-1632.86paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
ablim1a1.465e-928.13actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000006267.12.348e-924.85pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 g... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LRG14.150e-732.22GTPase-activating protein (GAP); contains Rho1p-sp... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LDB34.207e-2132.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411811.325e-1930.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395811.753e-1327.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325411.868e-1232.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411002.701e-1227.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdlim5b8.972e-3523.60PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim5b1.157e-2325.90PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pxna1.386e-2232.24paxillin [Source:NCBI gene;Acc:101171569][more]
pxna2.137e-2232.24paxillin [Source:NCBI gene;Acc:101171569][more]
ldb3a2.195e-2228.57LIM domain-binding protein 3 [Source:NCBI gene;Acc... [more]
back to top
BLAST of LIM domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066408.10.000e+099.49SMESG000066408.1[more]
SMESG000029617.12.044e-2936.09SMESG000029617.1[more]
SMESG000038145.11.255e-1434.21SMESG000038145.1[more]
SMESG000009923.13.050e-1429.90SMESG000009923.1[more]
SMESG000013182.11.389e-1234.07SMESG000013182.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025676 ID=SMED30025676|Name=LIM domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1457bp
TCACAAAGTCAACTAACCAATGACTCATTGCGATTTAAAGCGGCATTACA
ATTATTAATAATCTGTACAATCATTTATTTGATATTCGGTTTGTTTGAAA
TCTTAAGCTCTTTGTGATGGAAAATTTTAAAATCGAATTGACGAGATTGA
ACAAATCCACAACTTGGGGATTTTCAATTCAAGGTGGTAAAGATTTCGGA
TGTCCGTTGTCAGTGCTCCGAGTAACTCCGAATTCTATTTCTGATAAAAT
GGGATTACGTGTTAATGATTTGTTAATTAAAATCAACGATATTTCGTCTG
AAACTTTGACCCATCAACAAGCTATTTTACAAATTCAAAATCTAAACGTT
CTATTAGAACTGAAACGGTTACCAAGATTTGAATCGGAATTGCCACCACC
TCCACCGGTAATAGATAGCGGAAATTTTAGTAACAGTTGTCGAGTGTCTG
CTAGTATCAATGAATTGCCTCCTCCTCCTCCAGAGTTAAATTCATCAAAT
GTAGCAAGTAACTCGATTTTTTATCCACCTCCTCCACCCACTGCTTTCGT
GCCACAAACGAAACCGATTGTTTTACCTAGCAAAACGTTTGAGTCGGCTA
AAACCGATCAAAAATATTCTAATAACACTAGCACAAAAGCCGATAAAACA
CCGGAGTTATCATTGAAGACAGATAATATTGAACTTTTAAAGAAATTGAC
ATCCAGTGATAAAAAGAACCAAGAAAATGTACCTTCGAAAAGCTTGGGGA
AATTTTTGCAGAATCAAGAAGAGATGCGCGATTCCAAAGATTTAATAATT
CAAAAGACAAATTCTGATTCGAAAATGGCTATTTGTTTCGTATGCAAGGA
TCGTATTAAAGGTTCTTACATTGAAGCCAATAATAAGATTTATTGTTCAA
ATCATTTCTGTTGCTCATTTTGTAGTAAACCTATCAAAGGTACTCAGTTT
ATTGAAACAAAAGAAGGAACTCTTTATTGTATGGAAGATTTTGAGAATCA
TGTTGCACCTCGTTGTTTTAAATGCTCCAAATCTATAATTGAACAGCAAA
TTATGGCTCTGGGCAAATGTTGGCATCCTCAATGTTTTCTATGCAATCAT
TGTCACAAATCCATTCCACAAGGACAATTTCATATCAAAGAAGAAGATAA
TCAAACAGTGATATATTGTGAGAAAGATTACAAAGAATTTTATGAAATCA
AATGCTTTGGGTGCAAACTAGCCATTGATTCGGATGACAAATACCTTCAA
GTAGGAACAAATAATTACCACGTGGAATGTTACAAAAGATGATATTTTTG
TTCGATTTTATGCATGTGAAAATCCGATAGTTGAAATGTTGATTAAAATG
TATTCTGAATATTTTTAACATTTAATATAGCGTCTTTCTATTATAAACAT
CAAAGTTCAACTTGAAAGTGTGCTACTTATCAATTTTGTTATTTTGTAGT
GTCGCTT
back to top

protein sequence of SMED30025676-orf-1

>SMED30025676-orf-1 ID=SMED30025676-orf-1|Name=SMED30025676-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MENFKIELTRLNKSTTWGFSIQGGKDFGCPLSVLRVTPNSISDKMGLRVN
DLLIKINDISSETLTHQQAILQIQNLNVLLELKRLPRFESELPPPPPVID
SGNFSNSCRVSASINELPPPPPELNSSNVASNSIFYPPPPPTAFVPQTKP
IVLPSKTFESAKTDQKYSNNTSTKADKTPELSLKTDNIELLKKLTSSDKK
NQENVPSKSLGKFLQNQEEMRDSKDLIIQKTNSDSKMAICFVCKDRIKGS
YIEANNKIYCSNHFCCSFCSKPIKGTQFIETKEGTLYCMEDFENHVAPRC
FKCSKSIIEQQIMALGKCWHPQCFLCNHCHKSIPQGQFHIKEEDNQTVIY
CEKDYKEFYEIKCFGCKLAIDSDDKYLQVGTNNYHVECYKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001781Znf_LIM
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 15..86
e-value: 1.6E-12
score: 57.6
IPR001478PDZ domainPFAMPF00595PDZcoord: 13..77
e-value: 1.1E-8
score: 35.3
IPR001478PDZ domainPROSITEPS50106PDZcoord: 5..75
score: 12.184
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 299..354
e-value: 5.3E-10
score: 49.2
coord: 239..291
e-value: 1.8E-10
score: 50.8
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 300..356
e-value: 2.7E-12
score: 46.7
coord: 240..294
e-value: 1.9E-7
score: 31.2
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 300..333
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 298..361
score: 12.524
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 238..297
score: 7.841
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 234..297
e-value: 1.8E-13
score: 52.2
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 298..390
e-value: 3.0E-19
score: 71.3
NoneNo IPR availablePANTHERPTHR24214FAMILY NOT NAMEDcoord: 11..389
NoneNo IPR availableCDDcd08368LIMcoord: 240..292
e-value: 5.76681E-10
score: 52.7051
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 4..83
e-value: 2.4546E-16
score: 71.4438
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 266..329
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 326..389
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1..86
e-value: 2.5E-20
score: 74.1
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 6..83