Radial spoke head 3

Overview
NameRadial spoke head 3
Smed IDSMED30025672
Length (bp)1349
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Radial spoke head 3 (SMED30025672) t-SNE clustered cells

Violin plots show distribution of expression levels for Radial spoke head 3 (SMED30025672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Radial spoke head 3 (SMED30025672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Radial spoke head 3 (SMED30025672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025672SMESG000067698.1 SmedASXL_005356SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025672SMESG000067698.1 dd_Smed_v6_2287_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025672SMESG000067698.1 dd_Smed_v4_2287_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Radial spoke head 3 vs. Ensembl Human
Match: RSPH3 (radial spoke head 3 [Source:HGNC Symbol;Acc:HGNC:21054])

HSP 1 Score: 325.094 bits (832), Expect = 4.231e-107
Identity = 197/344 (57.27%), Postives = 259/344 (75.29%), Query Frame = 2
Query:   86 TYTFSSHPSAIQ-NRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD 1114
            TYT++S P A+   R++YRD     +E   + YGN+MYDRRV+RGNT++    P+  +PD +ELQRQ+E+R+RA+A+K+A+EQLRP+TPE V+GR+H DVQTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL+G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R  QR + ELRN+E+ E QRLEEQ+RR REEK RR +QQ EI+    E+++KIAA+ FAQ YL DL+P+VFG+L D+GYF+DP+ERD+E  FLPWLM+ V + +E     R VLD++IRE V  R   Y + E+  +     DE     GG   +T+
Sbjct:   15 TYTYTSRPRALPCQRSRYRDSLTQPDEE-PMHYGNIMYDRRVIRGNTYALQTGPLLGRPDSLELQRQREARKRALARKQAQEQLRPQTPEPVEGRKHVDVQTELYLEEIADRIIEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYEELRNSERAEVQRLEEQERRHREEKERRKKQQWEIMHKHNETSQKIAARAFAQRYLADLLPSVFGSLRDSGYFYDPIERDIEIGFLPWLMNEVEKTMEYSMVGRTVLDMLIREVVEKRLCMYEHGEDTHQSPEPEDEP----GGPGAMTE 353          
BLAST of Radial spoke head 3 vs. Ensembl Human
Match: RSPH3 (radial spoke head 3 [Source:HGNC Symbol;Acc:HGNC:21054])

HSP 1 Score: 325.865 bits (834), Expect = 1.349e-105
Identity = 205/382 (53.66%), Postives = 270/382 (70.68%), Query Frame = 2
Query:   11 SHSK*QLTNSNFKMTQVLGPQVPD-------------QTYTFSSHPSAIQ-NRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD 1114
            SH+    T    K+ +  G Q PD              TYT++S P A+   R++YRD     +E   + YGN+MYDRRV+RGNT++    P+  +PD +ELQRQ+E+R+RA+A+K+A+EQLRP+TPE V+GR+H DVQTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL+G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R  QR + ELRN+E+ E QRLEEQ+RR REEK RR +QQ EI+    E+++KIAA+ FAQ YL DL+P+VFG+L D+GYF+DP+ERD+E  FLPWLM+ V + +E     R VLD++IRE V  R   Y + E+  +     DE     GG   +T+
Sbjct:  119 SHNTLAPTCFKAKLHRKRGSQPPDMASALTDRTSRAPSTYTYTSRPRALPCQRSRYRDSLTQPDEE-PMHYGNIMYDRRVIRGNTYALQTGPLLGRPDSLELQRQREARKRALARKQAQEQLRPQTPEPVEGRKHVDVQTELYLEEIADRIIEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYEELRNSERAEVQRLEEQERRHREEKERRKKQQWEIMHKHNETSQKIAARAFAQRYLADLLPSVFGSLRDSGYFYDPIERDIEIGFLPWLMNEVEKTMEYSMVGRTVLDMLIREVVEKRLCMYEHGEDTHQSPEPEDEP----GGPGAMTE 495          
BLAST of Radial spoke head 3 vs. Ensembl Human
Match: RSPH3 (radial spoke head 3 [Source:HGNC Symbol;Acc:HGNC:21054])

HSP 1 Score: 152.525 bits (384), Expect = 7.648e-42
Identity = 106/193 (54.92%), Postives = 136/193 (70.47%), Query Frame = 2
Query:  536 LFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD 1114
            LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R  QR + ELRN+E+ E QRLEEQ+RR REEK RR +QQ EI+    E+++KIAA+ FAQ YL DL+P+VFG+L D+GYF+DP+ERD+E  FLPWLM+ V + +E     R VLD++IRE V  R   Y + E+  +     DE     GG   +T+
Sbjct:   69 LFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYEELRNSERAEVQRLEEQERRHREEKERRKKQQWEIMHKHNETSQKIAARAFAQRYLADLLPSVFGSLRDSGYFYDPIERDIEIGFLPWLMNEVEKTMEYSMVGRTVLDMLIREVVEKRLCMYEHGEDTHQSPEPEDEP----GGPGAMTE 257          

HSP 2 Score: 53.5286 bits (127), Expect = 3.722e-7
Identity = 25/55 (45.45%), Postives = 37/55 (67.27%), Query Frame = 2
Query:   86 TYTFSSHPSAIQ-NRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPI 247
            TYT++S P A+   R++YRD     +E   + YGN+MYDRRV+RGNT++    P+
Sbjct:   15 TYTYTSRPRALPCQRSRYRDSLTQPDEE-PMHYGNIMYDRRVIRGNTYALQTGPL 68          
BLAST of Radial spoke head 3 vs. Ensembl Fly
Match: CG32392 (gene:FBgn0052392 transcript:FBtr0076947)

HSP 1 Score: 157.532 bits (397), Expect = 3.581e-43
Identity = 124/344 (36.05%), Postives = 185/344 (53.78%), Query Frame = 2
Query:   26 QLTNSNFKMTQVLGPQVP-DQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQP--DPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERD-VEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEE 1045
            ++T    K  +   P  P  Q + ++SHP  I+ +                 Y N+MYDRRV++G+      L     P     EL+R+   R+R +  +  R  L   TP  V GR+H+ +QTE YLE+L+ R  E  ++ QTD FL++PPTP F+PAK G DV+TEI +G+LFHFD E +PI++VLV   +EQS LEV  E EL + R +Q  FL  R AE  E +RLE ++ RL+ EK RR++Q      L+ E  + + A    Q ++  LVP V   +       D V+++ + +S  PWL   V +E+    ++R +L  II+E +  R   Y   +E
Sbjct:   31 EVTEMQLKWHENPCPAPPCKQAFWWASHPKPIKIKG-----CPKPVVPPPEPYKNVMYDRRVIKGSNFGNASLVTDVDPFDKAAELRRRNMLRKRTMQCRNQRNVL--GTPPPVKGRKHETIQTEKYLEKLVQRPPEFTIDTQTDLFLEKPPTPPFIPAKVGVDVATEIGEGELFHFDAEAQPIIDVLVDACIEQSMLEVAHEMELSSLRRKQEEFLAQREAELAELRRLEAEELRLQAEKERRLRQDAIAKELDAEMQKSVTAAKLLQGHIASLVPEVLENIEPAS---DAVKKEQLMKSVCPWLSAEVAEEVGHIVDSREILTAIIQEIIKQRAEIYAGYKE 364          
BLAST of Radial spoke head 3 vs. Ensembl Fly
Match: CG32392 (gene:FBgn0052392 transcript:FBtr0076948)

HSP 1 Score: 151.754 bits (382), Expect = 1.222e-39
Identity = 115/292 (39.38%), Postives = 168/292 (57.53%), Query Frame = 2
Query:  179 YGNLMYDRRVVRGNTHSQHLLPITAQP--DPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERD-VEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEE 1045
            Y N+MYDRRV++G+      L     P     EL+R+   R+R +  +  R  L   TP  V GR+H+ +QTE YLE+L+ R  E  ++ QTD FL++PPTP F+PAK G DV+TEI +G+LFHFD E +PI++VLV   +EQS LEV  E EL + R +Q  FL  R AE  E +RLE ++ RL+ EK RR++Q      L+ E  + + A    Q ++  LVP V   +       D V+++ + +S  PWL   V +E+    ++R +L  II+E +  R   Y   +E
Sbjct:  326 YKNVMYDRRVIKGSNFGNASLVTDVDPFDKAAELRRRNMLRKRTMQCRNQRNVL--GTPPPVKGRKHETIQTEKYLEKLVQRPPEFTIDTQTDLFLEKPPTPPFIPAKVGVDVATEIGEGELFHFDAEAQPIIDVLVDACIEQSMLEVAHEMELSSLRRKQEEFLAQREAELAELRRLEAEELRLQAEKERRLRQDAIAKELDAEMQKSVTAAKLLQGHIASLVPEVLENIEPAS---DAVKKEQLMKSVCPWLSAEVAEEVGHIVDSREILTAIIQEIIKQRAEIYAGYKE 612          
BLAST of Radial spoke head 3 vs. Ensembl Zebrafish
Match: rsph3 (radial spoke head 3 [Source:ZFIN;Acc:ZDB-GENE-040724-173])

HSP 1 Score: 317.775 bits (813), Expect = 1.311e-105
Identity = 186/317 (58.68%), Postives = 251/317 (79.18%), Query Frame = 2
Query:   89 YTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIEL--QRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYH 1033
            YTFSS P A+ NR KYR     + E  +  YGN+MYDRRVVRGNT++QH++PIT+QPDP+E   Q+QQE+RRRA++++R +EQ   KTP+ ++GR++ DVQTELYLEEL DRIEE  VE QTD FLD+P TPLF+PAKSG+DV+T+I +G+LF FD EVKP+L+VLVGKT+EQ+ LEV+EEEEL++ R Q++ F E+R+AE VE QRLEE++RRLR EK  R++QQ  ++  EKE+A+KIAA+ FAQ YL+DL+P+V+ +L D GYF+DPV+RD+E  FLPWLM+ V   LE+   AR+VLD++I++    R  A+H
Sbjct:   16 YTFSSRPRAVPNRPKYRQADPSLNEEQS-SYGNIMYDRRVVRGNTYAQHIIPITSQPDPVEFFRQQQQEARRRAMSRRRLKEQFNSKTPDPLEGRKNIDVQTELYLEELSDRIEEVSVECQTDFFLDKPATPLFIPAKSGRDVATQIEEGELFDFDLEVKPMLQVLVGKTIEQALLEVMEEEELDSLRAQKKAFKEIRDAELVEVQRLEERERRLRVEKENRIKQQKAMLEKEKETADKIAARAFAQQYLSDLLPSVYSSLRDCGYFYDPVQRDIETGFLPWLMEEVGNTLEKRYVARMVLDMLIQDVTNQRSEAFH 331          
BLAST of Radial spoke head 3 vs. Ensembl Zebrafish
Match: rsph3 (radial spoke head 3 [Source:ZFIN;Acc:ZDB-GENE-040724-173])

HSP 1 Score: 317.775 bits (813), Expect = 1.311e-105
Identity = 186/317 (58.68%), Postives = 251/317 (79.18%), Query Frame = 2
Query:   89 YTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIEL--QRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYH 1033
            YTFSS P A+ NR KYR     + E  +  YGN+MYDRRVVRGNT++QH++PIT+QPDP+E   Q+QQE+RRRA++++R +EQ   KTP+ ++GR++ DVQTELYLEEL DRIEE  VE QTD FLD+P TPLF+PAKSG+DV+T+I +G+LF FD EVKP+L+VLVGKT+EQ+ LEV+EEEEL++ R Q++ F E+R+AE VE QRLEE++RRLR EK  R++QQ  ++  EKE+A+KIAA+ FAQ YL+DL+P+V+ +L D GYF+DPV+RD+E  FLPWLM+ V   LE+   AR+VLD++I++    R  A+H
Sbjct:   16 YTFSSRPRAVPNRPKYRQADPSLNEEQS-SYGNIMYDRRVVRGNTYAQHIIPITSQPDPVEFFRQQQQEARRRAMSRRRLKEQFNSKTPDPLEGRKNIDVQTELYLEELSDRIEEVSVECQTDFFLDKPATPLFIPAKSGRDVATQIEEGELFDFDLEVKPMLQVLVGKTIEQALLEVMEEEELDSLRAQKKAFKEIRDAELVEVQRLEERERRLRVEKENRIKQQKAMLEKEKETADKIAARAFAQQYLSDLLPSVYSSLRDCGYFYDPVQRDIETGFLPWLMEEVGNTLEKRYVARMVLDMLIQDVTNQRSEAFH 331          
BLAST of Radial spoke head 3 vs. Ensembl Xenopus
Match: nr0b2 (nuclear receptor subfamily 0 group B member 2 [Source:Xenbase;Acc:XB-GENE-479354])

HSP 1 Score: 357.066 bits (915), Expect = 3.354e-120
Identity = 210/325 (64.62%), Postives = 257/325 (79.08%), Query Frame = 2
Query:   50 MTQVLGPQ--VPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDR 1018
            MT V+  Q  +   TYTFSS P  +QNR KYR     V E  +  YGN+MYDRRVVRGNT++QH LP++AQPDPIE QRQQE++RRA+AKKRA+E LRP+TPEAV+GR+H DVQTELYLEEL DR+EE D+E QTD FLDRPPTPLF+PAK+G DV+T+IL+G+LF FD EVKP+LEVLVGKT+EQ+ LEV+EEEEL   R QQR F ELRNAE  E  RLEEQ+RR REEK RR +Q  EI+  EKE+AEK+AA+ FAQ YL DLVP+VF +L DNGYF+DPVERDVE +F+PWLM+ V   +++ +  R +LD+IIR+ V  R
Sbjct:    1 MTSVIPRQKEMGSGTYTFSSQPRVVQNRRKYRGVQPTVNEE-SFTYGNIMYDRRVVRGNTYAQHTLPLSAQPDPIEFQRQQEAQRRALAKKRAKELLRPRTPEAVEGRKHIDVQTELYLEELSDRVEEKDMECQTDAFLDRPPTPLFIPAKTGADVATQILEGELFDFDLEVKPMLEVLVGKTIEQALLEVMEEEELAQLRAQQRAFEELRNAELAEAHRLEEQERRHREEKERRKKQHREILLKEKETAEKVAARAFAQQYLADLVPSVFSSLRDNGYFYDPVERDVETTFMPWLMEEVENIMKKNDLGRTMLDMIIRDVVKKR 324          
BLAST of Radial spoke head 3 vs. Ensembl Xenopus
Match: cdk2ap1 (cyclin-dependent kinase 2 associated protein 1 [Source:Xenbase;Acc:XB-GENE-5715100])

HSP 1 Score: 96.2857 bits (238), Expect = 2.129e-22
Identity = 85/278 (30.58%), Postives = 131/278 (47.12%), Query Frame = 2
Query:  170 TLRYGNLMYDRRVVRGNTHS--QHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIII 997
            +L YGN+MY RR+V+G+TH+   ++  + +   P+E+QRQQE            E L+P+TP++ +GR        L  E+        D++  T  F        F+PAK+    +T+IL+G+LF F  E           T++Q+  EV+EEEEL   R QQ +                               +   I  L + S            YL DLV  VF +L +NGYF+DPVERDV  +F+PWLM  V + + ++N+   +L  ++
Sbjct:   14 SLTYGNIMYHRRLVQGHTHTFFTYVTFVCSTEPPVEIQRQQE------------ELLQPRTPDSEEGRHIDMCPLTLGFEK--------DMKCHTKVF-------SFIPAKT--RAATQILEGELFDFKLE-----------TIKQALREVMEEEELAQLRAQQSVL------------------------------KSCVIQNLPRHS-----------DYLVDLVSFVFCSLRENGYFYDPVERDVAPAFMPWLMKKV-ENIMKKNDLVYLLKYVL 209          
BLAST of Radial spoke head 3 vs. Ensembl Xenopus
Match: cdk2ap1 (cyclin-dependent kinase 2 associated protein 1 [Source:Xenbase;Acc:XB-GENE-5715100])

HSP 1 Score: 62.3882 bits (150), Expect = 7.718e-11
Identity = 25/39 (64.10%), Postives = 30/39 (76.92%), Query Frame = 2
Query:  827 YLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAV 943
            YL DLV  VF +L +NGYF+DPVERDV  +F+PWLM  V
Sbjct:  127 YLVDLVSFVFCSLRENGYFYDPVERDVAPAFMPWLMKKV 165          
BLAST of Radial spoke head 3 vs. Ensembl Mouse
Match: Rsph3b (radial spoke 3B homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:3630308])

HSP 1 Score: 290.812 bits (743), Expect = 2.580e-94
Identity = 196/375 (52.27%), Postives = 267/375 (71.20%), Query Frame = 2
Query:   89 YTFSSHPSAIQ-NRNKYRDKT-KLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD--INEEIDQNEMKNDISIEPMAELENQPTED 1201
            YT+SS P A+   R ++RD   + VEE ++  YGN+MYDRRV+RGNT++     +  QPDP+ELQRQQ++RRRA+A+KRA+EQL+P+TPE V+GR+H D+QTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R +Q  + E+RN E  E QRLEEQ+RR REEK RR +QQ EI+    E+ +KI+A +FA+ YL +L+P+VF  L ++G+F+DP+ERD+E  FLPWLM+ V + +E     R VLD++IR+ V  R   Y + E     A    + +  + G  T+TD  +     Q  + + +S +P    E +P E+
Sbjct:   15 YTYSSRPRAVACQRRRHRDSILQPVEEPMS--YGNIMYDRRVIRGNTYALPTGQVPGQPDPLELQRQQQARRRALARKRAQEQLKPRTPEPVEGRKHVDIQTELYLEEIADRIVEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILGGELFDFDLEVKPMLEVLVGKTIEQSLLEVMEEEELANLRARQYAYEEIRNVELAEVQRLEEQERRHREEKERRKKQQWEIVHKRNETLQKISALIFARQYLANLLPSVFDKLRNSGFFYDPIERDIEVGFLPWLMNEVEKSMEHSMVGRTVLDMLIRDVVERRINDYEHKE-----AMPPGQKTNVINGPNTVTDPSVTTLHTQKPVLDRVSSQPAPSQERKPVEE 382          
BLAST of Radial spoke head 3 vs. Ensembl Mouse
Match: Rsph3a (radial spoke 3A homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1914082])

HSP 1 Score: 290.426 bits (742), Expect = 1.503e-92
Identity = 199/395 (50.38%), Postives = 274/395 (69.37%), Query Frame = 2
Query:   29 LTNSNFKMTQVLGPQVPDQTYTFSSHPSAIQ-NRNKYRDKT-KLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD--INEEIDQNEMKNDISIEPMAELENQPTED 1201
            +T+ N +  +  G       YT+SS P A+   R ++RD   + VEE ++  YGN+MYDRRV+RGNT++     +  QPDP+ELQRQQ++RRRA+A+KRA+EQL+P+TPE V+GR+H D+QTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R +Q  + E+RN E  E QRLEEQ+RR REEK RR +QQ EI+    E+ +KI+A +FA+ YL +L+P+VF  L ++G+F+DP+ERD+E  FLPWLM+ V + +E     R VLD++IR+ V  R   Y + E     A    + +  + G  T+TD  +     Q  + + +S +P    E +P E+
Sbjct:  128 MTDPNPRTAEASG------LYTYSSRPRAVACQRRRHRDSILQPVEEPMS--YGNIMYDRRVIRGNTYALPTGQVPGQPDPLELQRQQQARRRALARKRAQEQLKPRTPEPVEGRKHVDIQTELYLEEIADRIVEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILGGELFDFDLEVKPMLEVLVGKTIEQSLLEVMEEEELANLRARQYAYEEIRNVELAEVQRLEEQERRHREEKERRKKQQWEIVHKRNETLQKISALIFARQYLANLLPSVFDKLRNSGFFYDPIERDIEVGFLPWLMNEVEKSMEHSMVGRTVLDMLIRDVVERRINDYEHKE-----AMPPGQKTNVINGPNTVTDPSVTTLHTQKPVLDRVSSQPAPSQERKPVEE 509          
BLAST of Radial spoke head 3 vs. Ensembl Mouse
Match: Rsph3b (radial spoke 3B homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:3630308])

HSP 1 Score: 290.041 bits (741), Expect = 3.416e-92
Identity = 196/375 (52.27%), Postives = 267/375 (71.20%), Query Frame = 2
Query:   89 YTFSSHPSAIQ-NRNKYRDKT-KLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD--INEEIDQNEMKNDISIEPMAELENQPTED 1201
            YT+SS P A+   R ++RD   + VEE ++  YGN+MYDRRV+RGNT++     +  QPDP+ELQRQQ++RRRA+A+KRA+EQL+P+TPE V+GR+H D+QTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R +Q  + E+RN E  E QRLEEQ+RR REEK RR +QQ EI+    E+ +KI+A +FA+ YL +L+P+VF  L ++G+F+DP+ERD+E  FLPWLM+ V + +E     R VLD++IR+ V  R   Y + E     A    + +  + G  T+TD  +     Q  + + +S +P    E +P E+
Sbjct:  160 YTYSSRPRAVACQRRRHRDSILQPVEEPMS--YGNIMYDRRVIRGNTYALPTGQVPGQPDPLELQRQQQARRRALARKRAQEQLKPRTPEPVEGRKHVDIQTELYLEEIADRIVEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILGGELFDFDLEVKPMLEVLVGKTIEQSLLEVMEEEELANLRARQYAYEEIRNVELAEVQRLEEQERRHREEKERRKKQQWEIVHKRNETLQKISALIFARQYLANLLPSVFDKLRNSGFFYDPIERDIEVGFLPWLMNEVEKSMEHSMVGRTVLDMLIRDVVERRINDYEHKE-----AMPPGQKTNVINGPNTVTDPSVTTLHTQKPVLDRVSSQPAPSQERKPVEE 527          
BLAST of Radial spoke head 3 vs. Ensembl Mouse
Match: Rsph3a (radial spoke 3A homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1914082])

HSP 1 Score: 287.345 bits (734), Expect = 1.875e-91
Identity = 201/397 (50.63%), Postives = 275/397 (69.27%), Query Frame = 2
Query:   29 LTNSNFKMTQVLGPQVPDQTYTFSSHPSAIQ-NRNKYRDKT-KLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPIT--AQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD--INEEIDQNEMKNDISIEPMAELENQPTED 1201
            +T+ N +  +  G       YT+SS P A+   R ++RD   + VEE ++  YGN+MYDRRV+RGNT++   LP     QPDP+ELQRQQ++RRRA+A+KRA+EQL+P+TPE V+GR+H D+QTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R +Q  + E+RN E  E QRLEEQ+RR REEK RR +QQ EI+    E+ +KI+A +FA+ YL +L+P+VF  L ++G+F+DP+ERD+E  FLPWLM+ V + +E     R VLD++IR+ V  R   Y + E     A    + +  + G  T+TD  +     Q  + + +S +P    E +P E+
Sbjct:  128 MTDPNPRTAEASG------LYTYSSRPRAVACQRRRHRDSILQPVEEPMS--YGNIMYDRRVIRGNTYA---LPTGQPGQPDPLELQRQQQARRRALARKRAQEQLKPRTPEPVEGRKHVDIQTELYLEEIADRIVEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILGGELFDFDLEVKPMLEVLVGKTIEQSLLEVMEEEELANLRARQYAYEEIRNVELAEVQRLEEQERRHREEKERRKKQQWEIVHKRNETLQKISALIFARQYLANLLPSVFDKLRNSGFFYDPIERDIEVGFLPWLMNEVEKSMEHSMVGRTVLDMLIRDVVERRINDYEHKE-----AMPPGQKTNVINGPNTVTDPSVTTLHTQKPVLDRVSSQPAPSQERKPVEE 508          
BLAST of Radial spoke head 3 vs. Ensembl Mouse
Match: Rsph3a (radial spoke 3A homolog (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1914082])

HSP 1 Score: 149.443 bits (376), Expect = 3.387e-43
Identity = 69/93 (74.19%), Postives = 83/93 (89.25%), Query Frame = 2
Query:  326 EQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQS 604
            EQL+P+TPE V+GR+H D+QTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL G+LF FD EVKP+LEVLVGKT+EQS
Sbjct:    2 EQLKPRTPEPVEGRKHVDIQTELYLEEIADRIVEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILGGELFDFDLEVKPMLEVLVGKTIEQS 94          
BLAST of Radial spoke head 3 vs. UniProt/SwissProt
Match: sp|Q86UC2|RSPH3_HUMAN (Radial spoke head protein 3 homolog OS=Homo sapiens OX=9606 GN=RSPH3 PE=1 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 6.479e-105
Identity = 205/382 (53.66%), Postives = 270/382 (70.68%), Query Frame = 2
Query:   11 SHSK*QLTNSNFKMTQVLGPQVPD-------------QTYTFSSHPSAIQ-NRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD 1114
            SH+    T    K+ +  G Q PD              TYT++S P A+   R++YRD     +E   + YGN+MYDRRV+RGNT++    P+  +PD +ELQRQ+E+R+RA+A+K+A+EQLRP+TPE V+GR+H DVQTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL+G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R  QR + ELRN+E+ E QRLEEQ+RR REEK RR +QQ EI+    E+++KIAA+ FAQ YL DL+P+VFG+L D+GYF+DP+ERD+E  FLPWLM+ V + +E     R VLD++IRE V  R   Y + E+  +     DE     GG   +T+
Sbjct:  119 SHNTLAPTCFKAKLHRKRGSQPPDMASALTDRTSRAPSTYTYTSRPRALPCQRSRYRDSLTQPDEE-PMHYGNIMYDRRVIRGNTYALQTGPLLGRPDSLELQRQREARKRALARKQAQEQLRPQTPEPVEGRKHVDVQTELYLEEIADRIIEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYEELRNSERAEVQRLEEQERRHREEKERRKKQQWEIMHKHNETSQKIAARAFAQRYLADLLPSVFGSLRDSGYFYDPIERDIEIGFLPWLMNEVEKTMEYSMVGRTVLDMLIREVVEKRLCMYEHGEDTHQSPEPEDEP----GGPGAMTE 495          
BLAST of Radial spoke head 3 vs. UniProt/SwissProt
Match: sp|A8E4N3|RSPH3_BOVIN (Radial spoke head protein 3 homolog OS=Bos taurus OX=9913 GN=RSPH3 PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 8.891e-100
Identity = 200/339 (59.00%), Postives = 252/339 (74.34%), Query Frame = 2
Query:   86 TYTFSSHPSAIQ-NRNKYRDK-TKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGG 1096
            TYT++S P A+   R +YRD   +  EE V   YGN+MYDRRV+RGNT++   +P+  QPDP+E+QRQQ++RRRA A+K+A+EQLRP+TPE V+GR+H DVQTELYLEE+ DRI E D+E QTD FLD+PPTPLF+PAK+GKDV+TEIL+G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R  Q  + ELRN E  E QRLEEQ+RR REEK RR QQQ +++    E+++KIAA+ FAQ YL DL+P+VF +L D GYF+DPVERD+E  FLPWLM+ V + +E     R VLD++IRE V  R     NL EQ E    +      LGG
Sbjct:  202 TYTYTSRPRALPCQRRRYRDDLMQQPEEPV--HYGNIMYDRRVIRGNTYALQSVPLPGQPDPVEIQRQQQARRRAFARKQAQEQLRPRTPEPVEGRKHVDVQTELYLEEIADRIVEVDMECQTDAFLDKPPTPLFIPAKTGKDVATEILEGELFDFDLEVKPMLEVLVGKTIEQSLLEVMEEEELANLRASQYAYEELRNIELAEVQRLEEQERRHREEKERRKQQQWQVVHKHNETSQKIAARAFAQRYLADLLPSVFDSLRDGGYFYDPVERDIEIGFLPWLMNEVDKTMESSMVGRTVLDMLIREVVERR----LNLYEQKEGRHASVRPENGLGG 534          
BLAST of Radial spoke head 3 vs. UniProt/SwissProt
Match: sp|Q9DA80|RSH3B_MOUSE (Radial spoke head protein 3 homolog B OS=Mus musculus OX=10090 GN=Rsph3b PE=2 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 1.805e-93
Identity = 196/375 (52.27%), Postives = 267/375 (71.20%), Query Frame = 2
Query:   89 YTFSSHPSAIQ-NRNKYRDKT-KLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD--INEEIDQNEMKNDISIEPMAELENQPTED 1201
            YT+SS P A+   R ++RD   + VEE ++  YGN+MYDRRV+RGNT++     +  QPDP+ELQRQQ++RRRA+A+KRA+EQL+P+TPE V+GR+H D+QTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R +Q  + E+RN E  E QRLEEQ+RR REEK RR +QQ EI+    E+ +KI+A +FA+ YL +L+P+VF  L ++G+F+DP+ERD+E  FLPWLM+ V + +E     R VLD++IR+ V  R   Y + E     A    + +  + G  T+TD  +     Q  + + +S +P    E +P E+
Sbjct:   15 YTYSSRPRAVACQRRRHRDSILQPVEEPMS--YGNIMYDRRVIRGNTYALPTGQVPGQPDPLELQRQQQARRRALARKRAQEQLKPRTPEPVEGRKHVDIQTELYLEEIADRIVEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILGGELFDFDLEVKPMLEVLVGKTIEQSLLEVMEEEELANLRARQYAYEEIRNVELAEVQRLEEQERRHREEKERRKKQQWEIVHKRNETLQKISALIFARQYLANLLPSVFDKLRNSGFFYDPIERDIEVGFLPWLMNEVEKSMEHSMVGRTVLDMLIRDVVERRINDYEHKE-----AMPPGQKTNVINGPNTVTDPSVTTLHTQKPVLDRVSSQPAPSQERKPVEE 382          
BLAST of Radial spoke head 3 vs. UniProt/SwissProt
Match: sp|Q3UFY4|RSH3A_MOUSE (Radial spoke head protein 3 homolog A OS=Mus musculus OX=10090 GN=Rsph3a PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 1.051e-91
Identity = 199/395 (50.38%), Postives = 274/395 (69.37%), Query Frame = 2
Query:   29 LTNSNFKMTQVLGPQVPDQTYTFSSHPSAIQ-NRNKYRDKT-KLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITD--INEEIDQNEMKNDISIEPMAELENQPTED 1201
            +T+ N +  +  G       YT+SS P A+   R ++RD   + VEE ++  YGN+MYDRRV+RGNT++     +  QPDP+ELQRQQ++RRRA+A+KRA+EQL+P+TPE V+GR+H D+QTELYLEE+ DRI E D+E QTD FLDRPPTPLF+PAK+GKDV+T+IL G+LF FD EVKP+LEVLVGKT+EQS LEV+EEEEL N R +Q  + E+RN E  E QRLEEQ+RR REEK RR +QQ EI+    E+ +KI+A +FA+ YL +L+P+VF  L ++G+F+DP+ERD+E  FLPWLM+ V + +E     R VLD++IR+ V  R   Y + E     A    + +  + G  T+TD  +     Q  + + +S +P    E +P E+
Sbjct:  128 MTDPNPRTAEASG------LYTYSSRPRAVACQRRRHRDSILQPVEEPMS--YGNIMYDRRVIRGNTYALPTGQVPGQPDPLELQRQQQARRRALARKRAQEQLKPRTPEPVEGRKHVDIQTELYLEEIADRIVEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILGGELFDFDLEVKPMLEVLVGKTIEQSLLEVMEEEELANLRARQYAYEEIRNVELAEVQRLEEQERRHREEKERRKKQQWEIVHKRNETLQKISALIFARQYLANLLPSVFDKLRNSGFFYDPIERDIEVGFLPWLMNEVEKSMEHSMVGRTVLDMLIRDVVERRINDYEHKE-----AMPPGQKTNVINGPNTVTDPSVTTLHTQKPVLDRVSSQPAPSQERKPVEE 509          
BLAST of Radial spoke head 3 vs. UniProt/SwissProt
Match: sp|P12759|RSP3_CHLRE (Flagellar radial spoke protein 3 OS=Chlamydomonas reinhardtii OX=3055 GN=RSP3 PE=1 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 3.248e-73
Identity = 155/306 (50.65%), Postives = 198/306 (64.71%), Query Frame = 2
Query:   83 QTYTFSSHPSAIQNRN-KYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIII 997
            Q YT ++ P A+Q R  KYR+     E   TL   N+M+DRRVVRGNT++  +LP  A       Q Q +    A  KKR    L P+TPEAVDGR+H D+QT++YLEEL D + EAD   QTD FLDRPPTPLFVP K+G D  T+I  GDLF FD EV+PILEVLVGK +EQ  +EVLEEEEL   R  Q  F ++RNAE V  QR+E  +RR  EEK RRMQQ+ E +  E+   +K+AA  FA+ YL+ +V TVF  L  +GY +DPV R+VE +F+PWL +     L +   AR V+D ++
Sbjct:    9 QLYTHAAEPKAVQQRRAKYRED----ETTQTLPTANIMFDRRVVRGNTYAARILPADA------TQTQTKGPSPASTKKRTTRTLPPRTPEAVDGRRHIDIQTDVYLEELTDTVPEADTSTQTDAFLDRPPTPLFVPQKTGTDAITQIENGDLFDFDFEVEPILEVLVGKVLEQGLMEVLEEEELAAMRAHQEHFEQIRNAELVATQRMEAAERRKLEEKERRMQQERERVERERVVRQKVAASAFARGYLSGIVNTVFDRLVSSGYIYDPVMREVETAFMPWLKEQAIGYLARGVVARRVVDKLV 304          
BLAST of Radial spoke head 3 vs. TrEMBL
Match: A0A1I8HW35 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020095g1 PE=4 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 3.834e-134
Identity = 228/335 (68.06%), Postives = 272/335 (81.19%), Query Frame = 2
Query:   86 TYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKAL 1090
            TYTFSS P A+ NR KYRD+           +GNLMYDRRV+RGNT+SQH+LP  AQPDP+E+QRQQE RRRA+A+KRAREQLRPK+PEAV+GR+H D+QTELYLEEL DRIEEADV+ QTDDFLDRPP+PLFVPAKSG+D  T+IL  +LF+FD EVKPILEVLVGKT+EQS LEV  EEEL N R QQR F ELRNAE VEQQRLEEQDRR REEK RR+QQQ E+   E+E+A KIAA+ FAQSYL DLVP+VFGTLA++GYF+DPVERDVE  FLPWL+DAV  +++    AR +LD ++RE + DRH AY  LE +IE+ R+A+E  +A+
Sbjct:   14 TYTFSSQPRAVPNRRKYRDQFAQQNSDEVPHHGNLMYDRRVIRGNTYSQHVLPAVAQPDPVEIQRQQEMRRRAMARKRAREQLRPKSPEAVEGRKHIDIQTELYLEELADRIEEADVQCQTDDFLDRPPSPLFVPAKSGEDKETQILDNELFNFDIEVKPILEVLVGKTIEQSLLEVCGEEELANLRAQQRAFEELRNAELVEQQRLEEQDRRHREEKARRVQQQREVQEKERETANKIAARAFAQSYLADLVPSVFGTLAEHGYFYDPVERDVESGFLPWLVDAVNTDIDSSVRARALLDGLLREVIRDRHTAYRALETRIEQQRMAEEDRRAM 348          
BLAST of Radial spoke head 3 vs. TrEMBL
Match: V3ZT82 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_130261 PE=4 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 9.257e-133
Identity = 227/334 (67.96%), Postives = 278/334 (83.23%), Query Frame = 2
Query:   50 MTQVLGPQVPDQTYTFSSHPSAIQNRNKYRD-KTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQ 1048
            M  VL P+    TYTF+S P A+Q R KYR+ +  L++  V  +YGN+MYDRR+VRGNT++QH LP +AQPDPIE+QRQQE++RRA+A+KRA+EQLRP++PEAV+GR+H DVQTELYLEEL DR+EEADV+ QTD FLDRPP+PLF+PAK+GKDV+T+IL+GDLF FD EVKPILEVLVGKTVEQ+ LEV+EEEEL N R QQR F ELRNAE VEQQRLEEQ+RR REEK RRM+QQ E+++ EKE+AEKIAA+ FAQSYL DLVP+VFGTLADNGYF+DPVERDVEQ F+PWLM+ V  +LE+    R+VLD IIRE  ++R   Y   E++
Sbjct:    1 MAAVLPPKGDGGTYTFASQPRAVQERKKYRETRDPLIQNDVPSQYGNIMYDRRIVRGNTYAQHTLPASAQPDPIEIQRQQENKRRAMARKRAKEQLRPRSPEAVEGRKHIDVQTELYLEELSDRVEEADVDCQTDAFLDRPPSPLFIPAKTGKDVATQILEGDLFDFDIEVKPILEVLVGKTVEQALLEVMEEEELSNLRQQQRAFEELRNAELVEQQRLEEQERRHREEKERRMKQQHEVLKKEKETAEKIAARAFAQSYLADLVPSVFGTLADNGYFYDPVERDVEQGFMPWLMEQVEIQLEKSELGRMVLDGIIREVTSNRLDLYSTAEDK 334          
BLAST of Radial spoke head 3 vs. TrEMBL
Match: K1QY04 (Radial spoke head protein 3-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10026456 PE=4 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 2.170e-129
Identity = 224/327 (68.50%), Postives = 271/327 (82.87%), Query Frame = 2
Query:   50 MTQVLGPQVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAY 1030
            MT VL PQ P  TYTF+S P A+Q R KYRD   + +     +YGN+MYDRR+VRGNT++QH LP  AQPDPIE+QRQQE+RRRAIA+KRA+EQLRP++P+ V+GR+H DVQTELYLEEL DR+EEADVE QTD FLDRPP+P++VPAK+G D++T+IL+GDLF FD EVKPILEVLVGKTVEQ+ LEV+EEEEL N R QQR F ELRNAE VEQQRLEEQ+RR REEK RRM+QQ EI++ EKE+++KIAA+ FAQSYL DLVPTVFGTL+DNGYF+DPVERD+EQ F+PWL+D V  +L++    RLVLD IIR+ +  R  AY
Sbjct:    1 MTTVL-PQKPQGTYTFASQPRAVQQRKKYRDANPIDQSQGPPQYGNIMYDRRIVRGNTYAQHTLPAHAQPDPIEIQRQQENRRRAIARKRAKEQLRPRSPDPVEGRKHIDVQTELYLEELSDRVEEADVEVQTDAFLDRPPSPMYVPAKTGVDITTQILEGDLFDFDIEVKPILEVLVGKTVEQALLEVMEEEELANLRSQQRAFEELRNAELVEQQRLEEQERRHREEKERRMKQQREIVKKEKETSDKIAARAFAQSYLADLVPTVFGTLSDNGYFYDPVERDIEQGFMPWLIDQVQVQLQKSQLGRLVLDGIIRDVMNQRIDAY 326          
BLAST of Radial spoke head 3 vs. TrEMBL
Match: A0A1S3JCM9 (radial spoke head protein 3 homolog B OS=Lingula unguis OX=7574 GN=LOC106172118 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 2.301e-128
Identity = 226/331 (68.28%), Postives = 273/331 (82.48%), Query Frame = 2
Query:   50 MTQVLGPQVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLE 1042
            MT +L PQ  + TYTF+S P A+Q R KYR+  +  E      YGN+MYDRR+VRGNT++QH LP  AQPDPIE+QRQQE+RRRAIA+KRA+EQLRP++PEAV+GR+H DVQTELYLEEL DR+EEADV+ QTD FLDRPP+P+F+PAK+G D++T+IL+G+LF FD EVKPILEVLVGKTVEQS LEV+EEEEL N R QQR F ELRNAE VEQQRLEEQ+RR REEK RRM+QQ EI+R EKE+A+KIAA+ FAQSYL DLVP+VFGTL+DNGYFFDP+ERDVEQ F+PWLM+ V + LE++N  RLV+D I+RE V  R   +   E
Sbjct:    1 MTTLL-PQKTEGTYTFASQPRAVQQRRKYRETEQQNEGPAP--YGNIMYDRRIVRGNTYAQHTLPARAQPDPIEIQRQQEARRRAIARKRAKEQLRPRSPEAVEGRKHIDVQTELYLEELSDRVEEADVDCQTDAFLDRPPSPMFIPAKTGVDIATQILEGELFDFDIEVKPILEVLVGKTVEQSLLEVMEEEELANLRSQQRSFEELRNAELVEQQRLEEQERRHREEKERRMKQQREILRKEKETADKIAARAFAQSYLADLVPSVFGTLSDNGYFFDPIERDVEQGFIPWLMERVAERLEKQNLGRLVVDGILREVVKQRWEHFKKYE 328          
BLAST of Radial spoke head 3 vs. TrEMBL
Match: W4Y8I6 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 1.700e-127
Identity = 224/333 (67.27%), Postives = 266/333 (79.88%), Query Frame = 2
Query:   50 MTQVL-GPQVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEE 1045
            MT +L  PQ    TYTF+S P A+  R KYRD      EAV +  GN+MYDRR+VRGNT++QH LP TAQPDPIE+QRQQE RRR IA KRA++QLRP++PE V+GR+H DVQTELYLEEL DR+EEADVEAQTD FLDRPPTPLFVPAK+G D++T+I +GDLF FD EVKPILEV+VGKTVEQ+ LEV+EEEEL N R QQR F ELRNAE VE QRLEEQ+RR REEK RRM+QQ E+++ EKE+AEKIAA+ FAQSYL DL+P+VFGTL D GYF+DPVERDVE  F+PW+MDA  + +++    R VLD IIR+ V +R  AY  LEE
Sbjct:    1 MTTILPAPQQKSGTYTFASQPRAVPQRKKYRDPLAQNPEAVPI--GNIMYDRRIVRGNTYAQHTLPATAQPDPIEIQRQQEIRRRKIAAKRAKDQLRPRSPEPVEGRKHIDVQTELYLEELSDRVEEADVEAQTDAFLDRPPTPLFVPAKTGMDIATQIYEGDLFDFDIEVKPILEVIVGKTVEQALLEVMEEEELANLRAQQRAFEELRNAELVETQRLEEQERRHREEKERRMKQQREVLKKEKETAEKIAARAFAQSYLADLIPSVFGTLNDKGYFYDPVERDVELGFMPWIMDAFAKCIDKSVLGRTVLDGIIRDVVKERMAAYFKLEE 331          
BLAST of Radial spoke head 3 vs. Ensembl Cavefish
Match: rsph3 (radial spoke head protein 3 homolog [Source:NCBI gene;Acc:103033990])

HSP 1 Score: 313.923 bits (803), Expect = 2.309e-104
Identity = 192/326 (58.90%), Postives = 244/326 (74.85%), Query Frame = 2
Query:   50 MTQVLGP--QVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRH 1021
            M   L P  Q P+  Y FSS P     R KY+D   +++   +  YGN+MYDRRVVRGNT++QH LP+ +QPDP EL++QQE+RRRA+A+KRA+EQ R  TPEA +GR+H+DVQTELYLEEL D  E+A +  QTD FLD P TPLF+PAKSGKDV+T+I +G+LF+FDTEV+P+LEVL+GKT+EQ+ LEVLEEEEL + R QQR F ELRNAE VE QRLEEQ+RR REEK RR++QQ E++  E+  AEKIAA+VFAQ YL DL+P+V+ TL D GYF+DPV+RD+E  FLPWLM  V   L++      +LD +I +    R 
Sbjct:    1 MASALQPYNQDPNGAYVFSSRPRPAPTRLKYKDPA-VIQNEESYVYGNIMYDRRVVRGNTYAQHTLPLRSQPDPAELKKQQEARRRALARKRAKEQFRLLTPEAPEGRKHKDVQTELYLEELSDHPEDASMGCQTDAFLDEPATPLFIPAKSGKDVATQIEEGELFYFDTEVQPVLEVLIGKTMEQALLEVLEEEELASLRAQQRAFQELRNAEIVEVQRLEEQERRHREEKVRRLKQQREVLENERVIAEKIAARVFAQQYLADLLPSVYNTLRDQGYFYDPVQRDIETGFLPWLMTEVDSALKKREIVLTMLDTLIYDVANSRQ 325          
BLAST of Radial spoke head 3 vs. Ensembl Cavefish
Match: ENSAMXT00000049884.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:19188901:19201011:1 gene:ENSAMXG00000036446.1 transcript:ENSAMXT00000049884.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.047 bits (619), Expect = 4.930e-76
Identity = 140/289 (48.44%), Postives = 179/289 (61.94%), Query Frame = 2
Query:   71 QVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMD 937
            Q P+  Y FSS P     R KY+D   +  E  +  YGN+MY RRVVRGNT++QH LP+ +QPDP ELQ+Q +            EQ    TPEA++GR+H +VQTELYLEEL D  E+A V  QTD FLD+P TPLF+PAKSGKDV+T+I +G+LFHFDTEV+P+LEVL+GKT+EQ+ LEVLEEEEL + R QQ                           + RR ++            EK+       + L DL+P+V+ TL D GYF+DPV+RD+E  FLPWLMD
Sbjct:   10 QAPNGAYVFSSRPRPAPTRLKYKDPAVIQNEG-SYVYGNIMYVRRVVRGNTYAQHTLPLRSQPDPAELQKQAK------------EQFCLLTPEALEGRKHTEVQTELYLEELSDHPEDASVGCQTDAFLDKPATPLFIPAKSGKDVATQIEEGELFHFDTEVQPVLEVLIGKTMEQALLEVLEEEELASLRAQQE--------------------------QERRHRE------------EKVTLPSICSAILADLLPSVYNTLKDQGYFYDPVQRDIETGFLPWLMD 247          
BLAST of Radial spoke head 3 vs. Ensembl Cavefish
Match: ENSAMXT00000055330.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:15352880:15357266:1 gene:ENSAMXG00000033650.1 transcript:ENSAMXT00000055330.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.149 bits (531), Expect = 7.279e-65
Identity = 129/200 (64.50%), Postives = 158/200 (79.00%), Query Frame = 2
Query:  389 ELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLD 988
            +LYLEEL D  E+A V  QTD FLD+P TPLF+PAKSGKDV+T+I +G+LFHFDTEV+P+LEVL+GKT+EQ+ LEVLEEEEL + R QQR F ELRNAE VE QRLEEQ+RR REEK RR++QQ E++  E+  AEKIAA+ FAQ YL DL+P+V+ TL + GYF+DPV+RD+E  FLPWLM  V   LE+   A  VLD
Sbjct:   12 KLYLEELSDHPEDASVGCQTDAFLDKPATPLFIPAKSGKDVATQIEEGELFHFDTEVQPVLEVLIGKTMEQALLEVLEEEELASLRAQQRAFQELRNAELVEVQRLEEQERRHREEKVRRLKQQREVLENERVIAEKIAARGFAQQYLADLLPSVYNTLREQGYFYDPVQRDIETGFLPWLMAEVDNALEKREIALTVLD 211          
BLAST of Radial spoke head 3 vs. Ensembl Cavefish
Match: ENSAMXT00000047988.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:15353402:15361480:1 gene:ENSAMXG00000033650.1 transcript:ENSAMXT00000047988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.305 bits (534), Expect = 1.145e-64
Identity = 130/206 (63.11%), Postives = 159/206 (77.18%), Query Frame = 2
Query:  371 HQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLD 988
            H     +LYLEEL D  E+A V  QTD FLD+P TPLF+PAKSGKDV+T+I +G+LFHFDTEV+P+LEVL+GKT+EQ+ LEVLEEEEL + R QQR F ELRNAE VE QRLEEQ+RR REEK RR++QQ E++  E+  AEKIAA+ FAQ YL DL+P+V+ TL + GYF+DPV+RD+E  FLPWLM  V   LE+   A  VLD
Sbjct:   22 HSFSPKKLYLEELSDHPEDASVGCQTDAFLDKPATPLFIPAKSGKDVATQIEEGELFHFDTEVQPVLEVLIGKTMEQALLEVLEEEELASLRAQQRAFQELRNAELVEVQRLEEQERRHREEKVRRLKQQREVLENERVIAEKIAARGFAQQYLADLLPSVYNTLREQGYFYDPVQRDIETGFLPWLMAEVDNALEKREIALTVLD 227          
BLAST of Radial spoke head 3 vs. Ensembl Cavefish
Match: ENSAMXT00000043046.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:29960739:29963784:-1 gene:ENSAMXG00000029064.1 transcript:ENSAMXT00000043046.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.512 bits (493), Expect = 1.459e-59
Identity = 118/183 (64.48%), Postives = 145/183 (79.23%), Query Frame = 2
Query:  440 AQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLD 988
             QTD FLDRP TPLF+PAKSGKDV+T+I +G+LF FDTEV+P+LEVL+GKTVEQ+ L+VLEEEEL + R QQR F ELRNAE VE QRLEEQ+RR REEK RR++QQ E++  E+  AEKIAA+ FAQ YL DL+P+V+ TL D GYF+DPV+RD+E  FLPWLM  V   LE++  A  + D
Sbjct:    2 CQTDAFLDRPATPLFIPAKSGKDVATQIEEGELFDFDTEVQPVLEVLIGKTVEQALLDVLEEEELASLRSQQRAFQELRNAELVEVQRLEEQERRHREEKVRRLKQQREVLENERVIAEKIAARGFAQQYLADLLPSVYNTLRDQGYFYDPVQRDIETGFLPWLMAEVDSALEKQETALTMFD 184          
BLAST of Radial spoke head 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010457.1 (pep scaffold:Pmarinus_7.0:GL482018:8229:17275:1 gene:ENSPMAG00000009466.1 transcript:ENSPMAT00000010457.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 302.753 bits (774), Expect = 1.564e-100
Identity = 194/339 (57.23%), Postives = 245/339 (72.27%), Query Frame = 2
Query:   50 MTQVLGPQVPDQTYTFSSHPSAIQNRNKY-RDKTKLVE-EAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLAD------NGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLE 1042
            MT  L  Q   + YTF+S P  +  R  Y R+   L   +  + R+GN+MYDRRVVRGNT++QHL P +A PDP+ELQRQQESRRRA+A+KRA+  LRP +PE V+GR+H DVQTELYLEEL  R++E D   QTD FLDRP +PLF+PAKSG+D +T+IL G+LF F+ EV+P++EVLVGKTVEQS LEV+EEEEL + R QQR FLELRNAE+ E QRL EQDRRLR EK+RR +QQ E++  EKE A+K+AA+ FA+ YL DL+P VF TL D      +   F  V  DVE +F+PWLM+AV  EL++  EAR +LD IIR+    R  +Y   E
Sbjct:    1 MTAFLA-QAQSEAYTFTSRPRPVPLRAPYSRESPSLYSVDDGSDRFGNIMYDRRVVRGNTYAQHLQPTSAGPDPVELQRQQESRRRALARKRAKAALRPFSPEPVEGRKHVDVQTELYLEELSGRVQERDWGCQTDAFLDRPASPLFIPAKSGRDATTQILPGELFDFEVEVRPLVEVLVGKTVEQSLLEVMEEEELASLRAQQRAFLELRNAERAEAQRLHEQDRRLRAEKDRRRRQQQEVVAQEKEVADKVAARAFAKRYLGDLIPAVFSTLRDICTALSDDPTFPHVSLDVENAFMPWLMNAVEAELQKALEARALLDSIIRDVAARRERSYGGGE 338          
BLAST of Radial spoke head 3 vs. Ensembl Nematostella
Match: EDO41065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5C1])

HSP 1 Score: 344.739 bits (883), Expect = 5.066e-117
Identity = 204/302 (67.55%), Postives = 250/302 (82.78%), Query Frame = 2
Query:   83 QTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLD 988
            +TYTF+S P  +Q R K+RD      EA ++ YGN+MYDRR+VRGNT++Q  LP TAQPDPIE+Q+QQE+RRRAIA+KRA++QL+P++PE V+GR+H DVQTELYLEEL DR+EEA+VE QTD FLDRPP+PLF+PAK+G DV+T+IL+G+LF FD EVKPILEVLVGKTVEQ+ LEV+EEEEL N R QQR F ELRNAE VE QRLEEQ+RR REEK RRM+QQ ++++ EKE+ EKIAA+ FAQSYL DLVP+VFG+L +NGYF+DPVERDVE  F+PWLM  V   L +   AR VLD
Sbjct:   13 RTYTFASQPRPVQQRKKFRDPLTQQNEA-SMPYGNIMYDRRIVRGNTYAQRTLPATAQPDPIEIQKQQEARRRAIARKRAKQQLQPRSPEPVEGRKHIDVQTELYLEELSDRVEEAEVETQTDAFLDRPPSPLFIPAKTGVDVATQILEGELFDFDIEVKPILEVLVGKTVEQALLEVMEEEELSNLRAQQRRFEELRNAELVETQRLEEQERRHREEKERRMRQQAQVLKKEKETGEKIAARAFAQSYLADLVPSVFGSLNENGYFYDPVERDVETYFMPWLMGRVDVNLNRSLVARTVLD 313          
BLAST of Radial spoke head 3 vs. Ensembl Medaka
Match: rsph3 (radial spoke head protein 3 homolog [Source:NCBI gene;Acc:101175526])

HSP 1 Score: 161.77 bits (408), Expect = 1.572e-45
Identity = 124/302 (41.06%), Postives = 157/302 (51.99%), Query Frame = 2
Query:   83 QTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLD 988
            + Y FSS P  +++  K R       E +  ++GN+M D RV RG   SQ   P+     P+                   +  R KT +            E YLEEL D  E  + E QTD FLDRP TPLF+ AK+GKD +T+I +GDLF F+ EV+PILE+LVGKT+EQS LEV+EEEEL     QQR FLE RN E         +       +     QQ   +  EKE AEKIAA+   Q  L DLVP+V  +L   GYF+DPVER     F P LMD V   L++    R +LD
Sbjct:   14 RMYVFSSRPRVVEDPWKPRWSPS---ERMQQKHGNIMRDPRVFRGIASSQ---PLKFAVSPVLF-----------LYLSHNQSRRSKTGQEEMFSPPFGSHAESYLEELSDIPEVKETECQTDAFLDRPETPLFLAAKTGKDAATQIYEGDLFDFEEEVQPILEILVGKTLEQSLLEVMEEEELAALMAQQRAFLERRNNE----LPEVHRLEEQERRRREERVQQRRALEEEKEVAEKIAARALTQQQLADLVPSVLASLRREGYFYDPVERGEATHFFPRLMDDVESILQKNCRVRELLD 294          
BLAST of Radial spoke head 3 vs. Planmine SMEST
Match: SMESG000067698.1 (SMESG000067698.1)

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 401/402 (99.75%), Postives = 402/402 (100.00%), Query Frame = 2
Query:   50 MTQVLGPQVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNVTITDINEEIDQNEMKNDISIEPMAELENQPTEDKELKEDVSIIPNELSQIT 1255
            MTQVLGPQVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESRRRAIAKKRAREQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCLEVLEEEELENFRCQQRMFLELRNAEKVEQQRLEEQDRRLREEKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGN+TITDINEEIDQNEMKNDISIEPMAELENQPTEDKELKEDVSIIPNELSQIT
Sbjct:    1 MTQVLGPQVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYDRRVVRGNTHSQHLLPITAQPDPIELQRQQESRRRAIAKKRAREQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCLEVLEEEELENFRCQQRMFLELRNAEKVEQQRLEEQDRRLREEKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGNITITDINEEIDQNEMKNDISIEPMAELENQPTEDKELKEDVSIIPNELSQIT 402          
BLAST of Radial spoke head 3 vs. Planmine SMEST
Match: SMESG000021328.1 (SMESG000021328.1)

HSP 1 Score: 169.474 bits (428), Expect = 8.261e-49
Identity = 131/320 (40.94%), Postives = 180/320 (56.25%), Query Frame = 2
Query:   86 TYTFSSHPSAIQNRNK-YRDK----TKLVEEAVTLRYGNLMYDR---RVVRGNTHSQHLLPITAQPDPIELQRQQESXXXXXXXXXXXEQLRPKTPEAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKSGKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCXXXXXXXXXXNFRCQQRMFLELRNAEKVXXXXXXXXXXXXXXXKNRRMQQQVEIIRLEKESAEKIAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQELEQENEARLVLDIIIREAVTDRH 1021
            T+ F S P+   ++ K YRDK     K V E  T++  N  Y R   ++ R        LP                               P  P  V GR H++VQT+LYLEEL+D+IE  D   QTD+FL+RP TPLF+PAKSG D+ST++ +GD+F FD EVKPI+EVLV KT+EQ+ LEV+EEEEL N RC+     ELR A   E  R E Q++R REE  RR+++  E+  L+ E+ +KI   +F+Q  L  L+P  F  L  NGYF DPVE D++  F+  L+     +      A +++D +IR+A TD+H
Sbjct:   13 TFVFESFPTVCSDKWKPYRDKEFIEDKRVNELTTVQCKNTEYLRPLKKIPRTKGFKGGYLP-------------------------------PDLP-PVAGRLHEEVQTDLYLEELVDKIELIDKCTQTDNFLNRPSTPLFIPAKSGFDISTQVYEGDVFFFDIEVKPIIEVLVTKTIEQALLEVMEEEELANIRCEINHQGELRAAYLNEIMRREIQNQRYREEYQRRLKEAKELAALKLETGKKIITSLFSQKLLEPLMPLSFENLYVNGYFRDPVELDLQTFFMKELLRETINKTNANLRAFVMVDGLIRDA-TDQH 299          
The following BLAST results are available for this feature:
BLAST of Radial spoke head 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RSPH34.231e-10757.27radial spoke head 3 [Source:HGNC Symbol;Acc:HGNC:2... [more]
RSPH31.349e-10553.66radial spoke head 3 [Source:HGNC Symbol;Acc:HGNC:2... [more]
RSPH37.648e-4254.92radial spoke head 3 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG323923.581e-4336.05gene:FBgn0052392 transcript:FBtr0076947[more]
CG323921.222e-3939.38gene:FBgn0052392 transcript:FBtr0076948[more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rsph31.311e-10558.68radial spoke head 3 [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
rsph31.311e-10558.68radial spoke head 3 [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nr0b23.354e-12064.62nuclear receptor subfamily 0 group B member 2 [Sou... [more]
cdk2ap12.129e-2230.58cyclin-dependent kinase 2 associated protein 1 [So... [more]
cdk2ap17.718e-1164.10cyclin-dependent kinase 2 associated protein 1 [So... [more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rsph3b2.580e-9452.27radial spoke 3B homolog (Chlamydomonas) [Source:MG... [more]
Rsph3a1.503e-9250.38radial spoke 3A homolog (Chlamydomonas) [Source:MG... [more]
Rsph3b3.416e-9252.27radial spoke 3B homolog (Chlamydomonas) [Source:MG... [more]
Rsph3a1.875e-9150.63radial spoke 3A homolog (Chlamydomonas) [Source:MG... [more]
Rsph3a3.387e-4374.19radial spoke 3A homolog (Chlamydomonas) [Source:MG... [more]
back to top
BLAST of Radial spoke head 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86UC2|RSPH3_HUMAN6.479e-10553.66Radial spoke head protein 3 homolog OS=Homo sapien... [more]
sp|A8E4N3|RSPH3_BOVIN8.891e-10059.00Radial spoke head protein 3 homolog OS=Bos taurus ... [more]
sp|Q9DA80|RSH3B_MOUSE1.805e-9352.27Radial spoke head protein 3 homolog B OS=Mus muscu... [more]
sp|Q3UFY4|RSH3A_MOUSE1.051e-9150.38Radial spoke head protein 3 homolog A OS=Mus muscu... [more]
sp|P12759|RSP3_CHLRE3.248e-7350.65Flagellar radial spoke protein 3 OS=Chlamydomonas ... [more]
back to top
BLAST of Radial spoke head 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HW353.834e-13468.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V3ZT829.257e-13367.96Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
K1QY042.170e-12968.50Radial spoke head protein 3-like protein OS=Crasso... [more]
A0A1S3JCM92.301e-12868.28radial spoke head protein 3 homolog B OS=Lingula u... [more]
W4Y8I61.700e-12767.27Uncharacterized protein OS=Strongylocentrotus purp... [more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsph32.309e-10458.90radial spoke head protein 3 homolog [Source:NCBI g... [more]
ENSAMXT00000049884.14.930e-7648.44pep primary_assembly:Astyanax_mexicanus-2.0:13:191... [more]
ENSAMXT00000055330.17.279e-6564.50pep primary_assembly:Astyanax_mexicanus-2.0:8:1535... [more]
ENSAMXT00000047988.11.145e-6463.11pep primary_assembly:Astyanax_mexicanus-2.0:8:1535... [more]
ENSAMXT00000043046.11.459e-5964.48pep primary_assembly:Astyanax_mexicanus-2.0:13:299... [more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010457.11.564e-10057.23pep scaffold:Pmarinus_7.0:GL482018:8229:17275:1 ge... [more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Radial spoke head 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO410655.066e-11767.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Radial spoke head 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rsph31.572e-4541.06radial spoke head protein 3 homolog [Source:NCBI g... [more]
back to top
BLAST of Radial spoke head 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000067698.10.000e+099.75SMESG000067698.1[more]
SMESG000021328.18.261e-4940.94SMESG000021328.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025672 ID=SMED30025672|Name=Radial spoke head 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1349bp
CTAAGCTCCCTCCCATAGCAAATAACAACTTACAAATTCAAATTTTAAAA
TGACTCAAGTTTTAGGACCACAAGTTCCAGATCAAACTTACACTTTTTCG
AGTCATCCTAGCGCCATCCAAAATCGAAATAAATATAGAGACAAAACTAA
ATTAGTAGAGGAAGCTGTGACTCTTCGATATGGCAATTTGATGTATGACA
GAAGAGTTGTTAGAGGAAACACTCATTCACAACATTTGCTACCAATAACT
GCTCAACCCGACCCAATTGAGCTTCAGAGACAACAGGAATCGAGAAGACG
AGCAATAGCAAAGAAAAGAGCTCGAGAACAACTTCGTCCTAAAACACCTG
AAGCAGTTGATGGCCGTCAACATCAAGATGTACAAACAGAATTGTATCTC
GAAGAATTGATTGACCGAATTGAAGAGGCTGACGTTGAAGCTCAGACCGA
TGATTTCCTCGATAGACCACCAACACCATTATTTGTTCCTGCAAAAAGCG
GAAAAGATGTTTCTACAGAAATCCTAAAAGGCGATCTATTTCATTTCGAT
ACTGAAGTTAAACCAATATTGGAAGTTCTTGTGGGAAAAACTGTCGAACA
ATCATGCTTAGAAGTTCTCGAAGAAGAAGAATTGGAAAATTTCCGCTGTC
AACAAAGAATGTTTTTGGAATTAAGAAATGCGGAAAAAGTTGAGCAACAA
AGATTGGAGGAACAAGATAGGAGATTGAGAGAAGAAAAAAATAGAAGAAT
GCAACAGCAAGTTGAAATTATCCGATTAGAAAAAGAATCAGCTGAAAAAA
TTGCAGCAAAGGTCTTTGCTCAAAGTTATTTAACCGACCTGGTCCCGACT
GTTTTTGGTACTTTGGCCGATAATGGCTACTTCTTTGATCCAGTTGAAAG
AGATGTGGAACAAAGTTTCTTGCCTTGGTTAATGGATGCCGTGTGCCAAG
AATTAGAACAAGAAAATGAAGCCCGCCTAGTTTTGGATATAATAATTCGA
GAGGCTGTTACTGACCGACATGTTGCTTATCATAATTTGGAGGAGCAAAT
AGAACGTGCAAGATTGGCGGATGAAGCGTCAAAAGCATTAGGAGGAAATG
TCACAATTACTGATATTAATGAAGAAATTGATCAAAATGAAATGAAAAAC
GATATTTCAATTGAACCTATGGCAGAACTTGAAAATCAACCAACTGAAGA
TAAAGAACTAAAGGAAGACGTGTCAATCATTCCTAATGAATTATCACAAA
TAACGGAGGAAAATCCAGAAGAGGAGGTGGAAGAATAAATAAAATTCTCA
TTTACAAACACAATAACAATACTGTATTAATTATTATTAATAAGATTAA
back to top

protein sequence of SMED30025672-orf-1

>SMED30025672-orf-1 ID=SMED30025672-orf-1|Name=SMED30025672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MTQVLGPQVPDQTYTFSSHPSAIQNRNKYRDKTKLVEEAVTLRYGNLMYD
RRVVRGNTHSQHLLPITAQPDPIELQRQQESRRRAIAKKRAREQLRPKTP
EAVDGRQHQDVQTELYLEELIDRIEEADVEAQTDDFLDRPPTPLFVPAKS
GKDVSTEILKGDLFHFDTEVKPILEVLVGKTVEQSCLEVLEEEELENFRC
QQRMFLELRNAEKVEQQRLEEQDRRLREEKNRRMQQQVEIIRLEKESAEK
IAAKVFAQSYLTDLVPTVFGTLADNGYFFDPVERDVEQSFLPWLMDAVCQ
ELEQENEARLVLDIIIREAVTDRHVAYHNLEEQIERARLADEASKALGGN
VTITDINEEIDQNEMKNDISIEPMAELENQPTEDKELKEDVSIIPNELSQ
ITEENPEEEVEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005929cilium
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR009290Radial_spoke_3
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 209..251
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 92..108
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 89..108
IPR009290Radial spoke 3PFAMPF06098Radial_spoke_3coord: 44..323
e-value: 6.2E-120
score: 399.8
IPR009290Radial spoke 3PANTHERPTHR21648FLAGELLAR RADIAL SPOKE PROTEIN 3coord: 7..386