Aurora kinase

Overview
NameAurora kinase
Smed IDSMED30025661
Length (bp)1400
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aurora kinase (SMED30025661) t-SNE clustered cells

Violin plots show distribution of expression levels for Aurora kinase (SMED30025661) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aurora kinase (SMED30025661) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aurora kinase (SMED30025661) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025661

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025661SMESG000016505.1 Contig711uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025661SMESG000016505.1 Contig711newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025661SMESG000008139.1 Contig711uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025661SMESG000008139.1 Contig711newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
prepharyngeal regionSMED30025661SMESG000016545.1 SMESG000016505.1 SMESG000004605.1 dd_Smed_v4_10323_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30025661SMESG000016545.1 SMESG000016505.1 SMESG000004605.1 dd_Smed_v4_10323_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30025661SMESG000016505.1 SmedASXL_015549SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30025661SMESG000016545.1 SMESG000016505.1 SMESG000004605.1 SmWIOct06_004921GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016545.1 SMESG000016505.1 SMESG000004605.1 SMED_31282_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016545.1 SMESG000016505.1 SMESG000004605.1 SMED_31282_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016545.1 SMESG000004605.1 SMED_31282_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016545.1 SMESG000004605.1 SMED_31282_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016545.1 SMESG000016505.1 SMESG000004605.1 SMED_12282_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016505.1 SmWIOct06_001228GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016505.1 SMED_05327_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025661SMESG000016505.1 SMED_05327_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aurora kinase vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 196.052 bits (497), Expect = 2.272e-74
Identity = 87/179 (48.60%), Postives = 124/179 (69.27%), Query Frame = 1
Query:   94 SDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
             ++  T     ++ S+  +    + DF++G PLG GKFG+VYLA+  +  F+ ALK++FKSQ+ +  LEHQ  REI+I  HL HPNIL+LY +FHD + VYL+LEYA  G+++  LQK ++  +   AT + +L DAL+YCH K VIHRDIKPENLL+    E+K+ADFGWS+HT  ++
Sbjct:   17 GEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLR 195          

HSP 2 Score: 99.7525 bits (247), Expect = 2.272e-74
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + YDEK+D W  G+L YE+L G+PPFE A   ETY  I    + F   + L ARDLI+R+
Sbjct:  194 LRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRL 273          

HSP 3 Score: 25.7942 bits (55), Expect = 2.272e-74
Identity = 9/32 (28.12%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++ ++L+ + +ERL    I  HPW+  +  +V
Sbjct:  269 LISRLLRYQPLERLPLAQILKHPWVQAHSRRV 300          
BLAST of Aurora kinase vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 195.667 bits (496), Expect = 3.548e-74
Identity = 87/175 (49.71%), Postives = 122/175 (69.71%), Query Frame = 1
Query:  106 ETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            E      ++ S+  +    + DF++G PLG GKFG+VYLA+  +  F+ ALK++FKSQ+ +  LEHQ  REI+I  HL HPNIL+LY +FHD + VYL+LEYA  G+++  LQK ++  +   AT + +L DAL+YCH K VIHRDIKPENLL+    E+K+ADFGWS+HT  ++
Sbjct:   18 EESNQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLR 192          

HSP 2 Score: 99.7525 bits (247), Expect = 3.548e-74
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + YDEK+D W  G+L YE+L G+PPFE A   ETY  I    + F   + L ARDLI+R+
Sbjct:  191 LRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRL 270          

HSP 3 Score: 25.7942 bits (55), Expect = 3.548e-74
Identity = 9/32 (28.12%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++ ++L+ + +ERL    I  HPW+  +  +V
Sbjct:  266 LISRLLRYQPLERLPLAQILKHPWVQAHSRRV 297          
BLAST of Aurora kinase vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 194.897 bits (494), Expect = 6.543e-74
Identity = 87/174 (50.00%), Postives = 122/174 (70.11%), Query Frame = 1
Query:  109 TKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            T     ++ S+  +    + DF++G PLG GKFG+VYLA+  +  F+ ALK++FKSQ+ +  LEHQ  REI+I  HL HPNIL+LY +FHD + VYL+LEYA  G+++  LQK ++  +   AT + +L DAL+YCH K VIHRDIKPENLL+    E+K+ADFGWS+HT  ++
Sbjct:    3 TANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLR 176          

HSP 2 Score: 99.7525 bits (247), Expect = 6.543e-74
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + YDEK+D W  G+L YE+L G+PPFE A   ETY  I    + F   + L ARDLI+R+
Sbjct:  175 LRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRL 254          

HSP 3 Score: 25.409 bits (54), Expect = 6.543e-74
Identity = 9/32 (28.12%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++ ++L+ + +ERL    I  HPW+  +  +V
Sbjct:  250 LISRLLRYQPLERLPLAQILKHPWVQAHSRRV 281          
BLAST of Aurora kinase vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 192.971 bits (489), Expect = 3.144e-73
Identity = 85/154 (55.19%), Postives = 115/154 (74.68%), Query Frame = 1
Query:  169 DFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            DF++G PLG GKFG+VYLA+  +  F+ ALK++FKSQ+ +  LEHQ  REI+I  HL HPNIL+LY +FHD + VYL+LEYA  G+++  LQK ++  +   AT + +L DAL+YCH K VIHRDIKPENLL+    E+K+ADFGWS+HT  ++
Sbjct:    8 DFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLR 161          

HSP 2 Score: 99.3673 bits (246), Expect = 3.144e-73
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + YDEK+D W  G+L YE+L G+PPFE A   ETY  I    + F   + L ARDLI+R+
Sbjct:  160 LRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRL 239          

HSP 3 Score: 25.409 bits (54), Expect = 3.144e-73
Identity = 9/32 (28.12%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++ ++L+ + +ERL    I  HPW+  +  +V
Sbjct:  235 LISRLLRYQPLERLPLAQILKHPWVQAHSRRV 266          
BLAST of Aurora kinase vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 190.274 bits (482), Expect = 1.059e-71
Identity = 84/150 (56.00%), Postives = 112/150 (74.67%), Query Frame = 1
Query:  169 DFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            DF++G PLG GKFG+VYLA+  +  F+ ALK++FKSQ+ +  LEHQ  REI+I  HL HPNIL+LY +FHD + VYL+LEYA  G+++  LQK ++  +   AT + +L DAL+YCH K VIHRDIKPENLL+    E+K+ADFGWS+H 
Sbjct:    8 DFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHP 157          

HSP 2 Score: 96.6709 bits (239), Expect = 1.059e-71
Identity = 43/78 (55.13%), Postives = 54/78 (69.23%), Query Frame = 3
Query:  675 RKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RKT+CGTLDYLPPEM+  + YDEK+D W  G+L YE+L G+PPFE A   ETY  I    + F   + L ARDLI+R+
Sbjct:  161 RKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRL 238          

HSP 3 Score: 25.409 bits (54), Expect = 1.059e-71
Identity = 9/32 (28.12%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++ ++L+ + +ERL    I  HPW+  +  +V
Sbjct:  234 LISRLLRYQPLERLPLAQILKHPWVQAHSRRV 265          
BLAST of Aurora kinase vs. Ensembl Celegans
Match: air-2 (Aurora/IPL1-related protein kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O01427])

HSP 1 Score: 193.356 bits (490), Expect = 1.953e-69
Identity = 93/171 (54.39%), Postives = 120/171 (70.18%), Query Frame = 1
Query:  106 ETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            E +  NT +K  K      + DF++G PLG GKFG VYLA+T    F  A+K++FKSQL    +EHQ  REI+I  HL+HPNI+KLYT+F D K +YLVLEYA  G+M+  L   +RF++  AA Y++++ DALSYCH+K VIHRDIKPENLLI    ELK+ DFGWS+H 
Sbjct:   12 EKETVNTPQKGGK----FTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHA 178          

HSP 2 Score: 88.9669 bits (219), Expect = 1.953e-69
Identity = 39/82 (47.56%), Postives = 55/82 (67.07%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV*MV 917
            +R+T+CGT+DYLPPEMVN  ++ + +D W  G+L YE L G PPFE   + +TYAAI+A    +   +   ARDLI R+ +V
Sbjct:  182 KRQTMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLVV 263          
BLAST of Aurora kinase vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 176.792 bits (447), Expect = 3.524e-51
Identity = 80/152 (52.63%), Postives = 111/152 (73.03%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKK--QRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSI 612
            L DFDVG PLG GKFG+V++++  K   + ALK++FK+QL +  + HQ  REI+I  HL HPNIL LY +FHD+K V+++L+YA  G++F +LQ +   +  ++ A  ++ QL +AL YCH KGVIHRDIKPENLL+   + LKLADFGWS+
Sbjct:   41 LDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSV 192          

HSP 2 Score: 70.8626 bits (172), Expect = 9.548e-14
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  603 LVYSHKFNEVRHHLTVAIIYFHIRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            L+   K N        +++  H +R TLCGT+DYL PEMV+++ +D  +D W  GILL+EML G+ PF      +  A I+   I   S +   A  LI  +
Sbjct:  175 LLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAI 276          

HSP 3 Score: 24.6386 bits (52), Expect = 9.548e-14
Identity = 10/21 (47.62%), Postives = 13/21 (61.90%), Query Frame = 1
Query:  955 ILKLKSVERLTFVAIQNHPWM 1017
            I+K +  ERL  V I  HPW+
Sbjct:  276 IIKKEPQERLPLVDIMAHPWI 296          
BLAST of Aurora kinase vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 176.792 bits (447), Expect = 3.524e-51
Identity = 80/152 (52.63%), Postives = 111/152 (73.03%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKK--QRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSI 612
            L DFDVG PLG GKFG+V++++  K   + ALK++FK+QL +  + HQ  REI+I  HL HPNIL LY +FHD+K V+++L+YA  G++F +LQ +   +  ++ A  ++ QL +AL YCH KGVIHRDIKPENLL+   + LKLADFGWS+
Sbjct:   41 LDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSV 192          

HSP 2 Score: 70.8626 bits (172), Expect = 9.548e-14
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  603 LVYSHKFNEVRHHLTVAIIYFHIRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            L+   K N        +++  H +R TLCGT+DYL PEMV+++ +D  +D W  GILL+EML G+ PF      +  A I+   I   S +   A  LI  +
Sbjct:  175 LLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAI 276          

HSP 3 Score: 24.6386 bits (52), Expect = 9.548e-14
Identity = 10/21 (47.62%), Postives = 13/21 (61.90%), Query Frame = 1
Query:  955 ILKLKSVERLTFVAIQNHPWM 1017
            I+K +  ERL  V I  HPW+
Sbjct:  276 IIKKEPQERLPLVDIMAHPWI 296          
BLAST of Aurora kinase vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 127.487 bits (319), Expect = 6.240e-36
Identity = 69/172 (40.12%), Postives = 100/172 (58.14%), Query Frame = 1
Query:   94 SDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            + Q+     +  +++++D+ + K K       +G G F  V LAK V  G   A+KI+ K+ L   +L+  F RE+ IM  LDHPNI+KLY     E+ +YLVLEYA  G++F  L    R  + EA     Q+  A+ Y H K +IHRD+K ENLL+  DM +K+ADFG+S
Sbjct:   83 TGQSGMSSRSAARRNDQDVHVGKYKLLKT---IGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLF-REVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFS 250          

HSP 2 Score: 42.743 bits (99), Expect = 6.240e-36
Identity = 17/44 (38.64%), Postives = 28/44 (63.64%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFE 809
            T CG+  Y  PE+ + K+YD  ++D W  G++LY ++ G  PF+
Sbjct:  261 TFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFD 304          
BLAST of Aurora kinase vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 126.331 bits (316), Expect = 1.487e-35
Identity = 72/181 (39.78%), Postives = 103/181 (56.91%), Query Frame = 1
Query:   76 PDVVS---KSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            PD  S    + Q+     +  +++++D+ + K K       +G G F  V LAK V  G   A+KI+ K+ L   +L+  F RE+ IM  LDHPNI+KLY     E+ +YLVLEYA  G++F  L    R  + EA     Q+  A+ Y H K +IHRD+K ENLL+  DM +K+ADFG+S
Sbjct:    8 PDSSSHARSTGQSGMSSRSAARRNDQDVHVGKYKLLKT---IGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLF-REVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFS 184          

HSP 2 Score: 42.743 bits (99), Expect = 1.487e-35
Identity = 17/44 (38.64%), Postives = 28/44 (63.64%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFE 809
            T CG+  Y  PE+ + K+YD  ++D W  G++LY ++ G  PF+
Sbjct:  195 TFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFD 238          
BLAST of Aurora kinase vs. Ensembl Fly
Match: aurA (gene:FBgn0000147 transcript:FBtr0082483)

HSP 1 Score: 185.267 bits (469), Expect = 1.084e-59
Identity = 88/181 (48.62%), Postives = 123/181 (67.96%), Query Frame = 1
Query:   79 DVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKK--QRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIH 615
            ++ + S   E +K  TE +  K     +L +FD+G  LG GKFG+VYLA+  +  FV ALK++FK Q+   N+EHQ  REI+I  HL HP+IL+LY +FHD+  +YL+LEYA  G +F  LQ +  +RF + ++ATY+  LC AL Y H++ +IHRDIKPENLL+     LK+ADFGWS+H
Sbjct:  123 ELGAASSSAEKEKTKTETQPQKPKKTWELNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVH 303          

HSP 2 Score: 65.0846 bits (157), Expect = 1.084e-59
Identity = 32/78 (41.03%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  675 RKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            R TLCGT+DYLPPEMV  K + + +D W  G+L +E+L G  PF      ETY  I     +    I   A  LI+++
Sbjct:  309 RMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEHISKAASHLISKL 386          
BLAST of Aurora kinase vs. Ensembl Fly
Match: aurB (gene:FBgn0024227 transcript:FBtr0080180)

HSP 1 Score: 161.384 bits (407), Expect = 4.297e-59
Identity = 76/153 (49.67%), Postives = 106/153 (69.28%), Query Frame = 1
Query:  166 KDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQ--KKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            +DF++G  LG GKFG VYLA+     ++ A+K+MFK +L +  ++ Q LREI+I   L HP+IL+L TWFHDE  +YL LE A  G++F  L+     RF +  +A Y +Q+ +AL+YCH   VIHRD+KPEN+L++   +LKLADFGWS HT
Sbjct:   51 RDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHT 203          

HSP 2 Score: 85.8853 bits (211), Expect = 4.297e-59
Identity = 37/76 (48.68%), Postives = 49/76 (64.47%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLI 899
            +R+TLCGTLDYLPPEMV+   YD+ +D W  GIL YE + G PPFE    + TY+ IR   I + S +    ++LI
Sbjct:  207 KRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELI 282          

HSP 3 Score: 21.9422 bits (45), Expect = 4.297e-59
Identity = 9/31 (29.03%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  955 ILKLKSVERLTFVAIQNHPWMLRNVSKVELK 1047
            +L+ +S  R+T V +  H W+   +++ EL+
Sbjct:  285 LLRKESKGRITLVDVMTHYWVKAGMAERELQ 315          
BLAST of Aurora kinase vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0100390)

HSP 1 Score: 125.561 bits (314), Expect = 2.293e-35
Identity = 63/140 (45.00%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LAK +  G   A+KI+ K+QL   +L+  F RE+ IM  LDHPNI+KL+     EK +YL++EYA  G++F  L    R  + EA     Q+  A+ YCHQK +IHRD+K ENLL+  ++ +K+ADFG+S
Sbjct:  259 IGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLF-REVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFS 397          

HSP 2 Score: 43.5134 bits (101), Expect = 2.293e-35
Identity = 18/50 (36.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+ +  +E
Sbjct:  408 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRE 457          
BLAST of Aurora kinase vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0330243)

HSP 1 Score: 125.176 bits (313), Expect = 2.370e-35
Identity = 63/140 (45.00%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LAK +  G   A+KI+ K+QL   +L+  F RE+ IM  LDHPNI+KL+     EK +YL++EYA  G++F  L    R  + EA     Q+  A+ YCHQK +IHRD+K ENLL+  ++ +K+ADFG+S
Sbjct:  259 IGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLF-REVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFS 397          

HSP 2 Score: 43.5134 bits (101), Expect = 2.370e-35
Identity = 18/50 (36.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+ +  +E
Sbjct:  408 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRE 457          
BLAST of Aurora kinase vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0301505)

HSP 1 Score: 125.176 bits (313), Expect = 2.511e-35
Identity = 63/140 (45.00%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LAK +  G   A+KI+ K+QL   +L+  F RE+ IM  LDHPNI+KL+     EK +YL++EYA  G++F  L    R  + EA     Q+  A+ YCHQK +IHRD+K ENLL+  ++ +K+ADFG+S
Sbjct:  259 IGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLF-REVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFS 397          

HSP 2 Score: 43.5134 bits (101), Expect = 2.511e-35
Identity = 18/50 (36.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+ +  +E
Sbjct:  408 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRE 457          
BLAST of Aurora kinase vs. Ensembl Zebrafish
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 191.43 bits (485), Expect = 1.326e-69
Identity = 85/152 (55.92%), Postives = 112/152 (73.68%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L++FD+G  LG GKFG VYLA+  +  F+ ALK++FK QL +  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LE+A  G+++  LQ+   F D  +ATY+ +L DAL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+HT
Sbjct:  135 LENFDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSATYIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHT 286          

HSP 2 Score: 87.0409 bits (214), Expect = 1.326e-69
Identity = 40/79 (50.63%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  K +DEK+D W  G+L YE L G PPFE    +ETY  I      + + +   +RDLI R+
Sbjct:  290 RRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSNGSRDLINRL 368          

HSP 3 Score: 26.1794 bits (56), Expect = 1.326e-69
Identity = 9/31 (29.03%), Postives = 18/31 (58.06%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK   + RL    +  HPW++ N +K
Sbjct:  364 LINRLLKHNPMHRLPIQGVMEHPWVVENSTK 394          
BLAST of Aurora kinase vs. Ensembl Zebrafish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:791894])

HSP 1 Score: 192.2 bits (487), Expect = 7.243e-69
Identity = 89/166 (53.61%), Postives = 117/166 (70.48%), Query Frame = 1
Query:  133 KSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            KSN  +    + DFD+G PLG GKFG+VYLA+  K   V ALK++FKSQ+ +  +EHQ  REI+I  HL HPNIL+ Y +FHD+  V+L+LEYA  G+M+  LQ+   F D   ATY+ ++ DAL YCH+K VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:   42 KSNSKV--LSIDDFDIGRPLGKGKFGNVYLARERKLKVVIALKVLFKSQMVKEGVEHQLRREIEIQSHLRHPNILRFYNYFHDDTRVFLILEYAPRGEMYKELQRYGHFDDQRTATYMEEVSDALQYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLR 205          

HSP 2 Score: 89.3521 bits (220), Expect = 7.243e-69
Identity = 40/80 (50.00%), Postives = 53/80 (66.25%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+    +DEK+D W  G+L YE L G PPFE A   ETY  I    ++F   +   ARDLI+++
Sbjct:  204 LRRRTMCGTLDYLPPEMIEGHSHDEKVDLWSIGVLCYECLVGNPPFETASHAETYKRITKVDLQFPKLVSEGARDLISKL 283          
BLAST of Aurora kinase vs. Ensembl Zebrafish
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 192.586 bits (488), Expect = 1.493e-57
Identity = 85/152 (55.92%), Postives = 112/152 (73.68%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L++FD+G  LG GKFG VYLA+  +  F+ ALK++FK QL +  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LE+A  G+++  LQ+   F D  +ATY+ +L DAL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+HT
Sbjct:  135 LENFDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSATYIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHT 286          
BLAST of Aurora kinase vs. Ensembl Zebrafish
Match: mark2a (MAP/microtubule affinity-regulating kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4145])

HSP 1 Score: 126.331 bits (316), Expect = 4.171e-35
Identity = 64/140 (45.71%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LAK +  G   A+KI+ K+QL   +L+  F RE+ IM  L+HPNI+KL+     EK +YLV+EYA  G++F  L    R  + EA     Q+  A+ YCHQK ++HRD+K ENLL+  DM +K+ADFG+S
Sbjct:   50 IGKGNFAKVKLAKHILTGKEVAVKIIDKTQLNSSSLQKLF-REVRIMKLLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDADMNIKIADFGFS 188          

HSP 2 Score: 41.9726 bits (97), Expect = 4.171e-35
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+    +E
Sbjct:  199 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKE 248          
BLAST of Aurora kinase vs. Ensembl Zebrafish
Match: mark2a (MAP/microtubule affinity-regulating kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4145])

HSP 1 Score: 126.331 bits (316), Expect = 4.239e-35
Identity = 64/140 (45.71%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LAK +  G   A+KI+ K+QL   +L+  F RE+ IM  L+HPNI+KL+     EK +YLV+EYA  G++F  L    R  + EA     Q+  A+ YCHQK ++HRD+K ENLL+  DM +K+ADFG+S
Sbjct:   50 IGKGNFAKVKLAKHILTGKEVAVKIIDKTQLNSSSLQKLF-REVRIMKLLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDADMNIKIADFGFS 188          

HSP 2 Score: 41.9726 bits (97), Expect = 4.239e-35
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+    +E
Sbjct:  199 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKE 248          
BLAST of Aurora kinase vs. Ensembl Xenopus
Match: zbtb39 (zinc finger and BTB domain containing 39 [Source:Xenbase;Acc:XB-GENE-957946])

HSP 1 Score: 196.052 bits (497), Expect = 2.276e-70
Identity = 86/152 (56.58%), Postives = 115/152 (75.66%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L+DF++G PLG GKFG+VYLA+  +  F+ ALK++FK+QL +  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+L+YA  G++F  LQK  RF + ++A Y+ QL +AL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+H 
Sbjct:  143 LEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKTQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILDYAPGGELFRELQKVTRFDEQKSALYIKQLAEALLYCHSKNVIHRDIKPENLLLGANGELKIADFGWSVHA 294          

HSP 2 Score: 87.4261 bits (215), Expect = 2.276e-70
Identity = 40/79 (50.63%), Postives = 52/79 (65.82%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  + +DEK+D W  G+L YE L G PPFE    QETY  I     ++ S +   ARDL++++
Sbjct:  298 RRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPSYVSEGARDLVSKL 376          

HSP 3 Score: 24.6386 bits (52), Expect = 2.276e-70
Identity = 10/39 (25.64%), Postives = 21/39 (53.85%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKVELKKMRP 1059
            ++ ++LK     RL+   +  HPW++ N ++   +K  P
Sbjct:  372 LVSKLLKHNPNHRLSLKGVLEHPWIIDNSAQKPKRKEGP 410          
BLAST of Aurora kinase vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 197.208 bits (500), Expect = 5.354e-68
Identity = 85/156 (54.49%), Postives = 117/156 (75.00%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            + DFD+G PLG GKFG+VYLA+  +  F+ ALK++FKSQL +  +EHQ  REI+I  HL HPNIL++Y +FHD K +YL+LE+A  G+++  LQK  RF +  +AT++ +L DAL YCH++ VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:   90 IDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLR 245          

HSP 2 Score: 82.0333 bits (201), Expect = 5.354e-68
Identity = 35/80 (43.75%), Postives = 53/80 (66.25%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+  K +DEK+D W  G+L +E L G PPF+     ET+  I    ++F   +   ++DLI+++
Sbjct:  244 LRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKL 323          
BLAST of Aurora kinase vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 196.823 bits (499), Expect = 6.865e-68
Identity = 85/154 (55.19%), Postives = 116/154 (75.32%), Query Frame = 1
Query:  169 DFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            DFD+G PLG GKFG+VYLA+  +  F+ ALK++FKSQL +  +EHQ  REI+I  HL HPNIL++Y +FHD K +YL+LE+A  G+++  LQK  RF +  +AT++ +L DAL YCH++ VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:  102 DFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLR 255          

HSP 2 Score: 82.0333 bits (201), Expect = 6.865e-68
Identity = 35/80 (43.75%), Postives = 53/80 (66.25%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+  K +DEK+D W  G+L +E L G PPF+     ET+  I    ++F   +   ++DLI+++
Sbjct:  254 LRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKL 333          
BLAST of Aurora kinase vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 196.438 bits (498), Expect = 7.520e-68
Identity = 85/156 (54.49%), Postives = 117/156 (75.00%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            + DFD+G PLG GKFG+VYLA+  +  F+ ALK++FKSQL +  +EHQ  REI+I  HL HPNIL++Y +FHD K +YL+LE+A  G+++  LQK  RF +  +AT++ +L DAL YCH++ VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:  105 IDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLR 260          

HSP 2 Score: 82.0333 bits (201), Expect = 7.520e-68
Identity = 35/80 (43.75%), Postives = 53/80 (66.25%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+  K +DEK+D W  G+L +E L G PPF+     ET+  I    ++F   +   ++DLI+++
Sbjct:  259 LRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKL 338          
BLAST of Aurora kinase vs. Ensembl Xenopus
Match: ovch1 (ovochymase 1 [Source:Xenbase;Acc:XB-GENE-6449526])

HSP 1 Score: 114.39 bits (285), Expect = 4.647e-37
Identity = 61/153 (39.87%), Postives = 94/153 (61.44%), Query Frame = 1
Query:  172 FDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDME----LKLADFGWSIHT 618
            +++G  +G G F  V + +   E    A+KI+ KS+L     E     E+ I+ HL HPNI+KL++ +  EK +YL+LEY   G +F ++ +  +FT+ +AA  L  LC+AL Y H K ++HRD+KPENLL+  + +    LKLADFG +I+ 
Sbjct:  429 YEIGRTIGDGNFAVVKVCRPWNENQEYAMKIIDKSKL--RGKEDIIENEVRIIKHLSHPNIVKLFSDYETEKEIYLILEYIRGGDLFDVITESIKFTEHDAALMLIDLCEALKYIHSKHIVHRDLKPENLLVQHNPDGSKSLKLADFGLAIYA 579          

HSP 2 Score: 61.2326 bits (147), Expect = 4.647e-37
Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKA--KKQETYAAIRANSIEFR----SDIVLEARDLITRV 908
            T+CGT  Y+ PE+++ K Y  K+D W TG++LY +L GFPPF      ++E +  I++   EF       I  E +DLI+++
Sbjct:  585 TVCGTPTYVAPEILSEKGYGLKVDMWATGVILYILLCGFPPFRSPDRNQEELFQIIQSGEYEFLPPYWDHISEEVKDLISKL 666          
BLAST of Aurora kinase vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 200.675 bits (509), Expect = 4.802e-73
Identity = 88/152 (57.89%), Postives = 115/152 (75.66%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK+QL + N+EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LEYA  G ++  LQK  +F +   ATY+ +L +ALSYCH K VIHRDIKPENLL+  + ELK+ADFGWS+H 
Sbjct:  121 LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHA 272          

HSP 2 Score: 87.4261 bits (215), Expect = 4.802e-73
Identity = 41/79 (51.90%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR T+CGTLDYLPPEM+  + +DEK+D W  G+L YE L G PPFE    QETY  I      F   +   ARDLI+R+
Sbjct:  276 RRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRL 354          

HSP 3 Score: 28.4906 bits (62), Expect = 4.802e-73
Identity = 11/31 (35.48%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK  + +RLT   +  HPW+  N SK
Sbjct:  350 LISRLLKHNASQRLTLAEVLEHPWIKANSSK 380          
BLAST of Aurora kinase vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 200.675 bits (509), Expect = 4.802e-73
Identity = 88/152 (57.89%), Postives = 115/152 (75.66%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK+QL + N+EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LEYA  G ++  LQK  +F +   ATY+ +L +ALSYCH K VIHRDIKPENLL+  + ELK+ADFGWS+H 
Sbjct:  121 LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHA 272          

HSP 2 Score: 87.4261 bits (215), Expect = 4.802e-73
Identity = 41/79 (51.90%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR T+CGTLDYLPPEM+  + +DEK+D W  G+L YE L G PPFE    QETY  I      F   +   ARDLI+R+
Sbjct:  276 RRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRL 354          

HSP 3 Score: 28.4906 bits (62), Expect = 4.802e-73
Identity = 11/31 (35.48%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK  + +RLT   +  HPW+  N SK
Sbjct:  350 LISRLLKHNASQRLTLAEVLEHPWIKANSSK 380          
BLAST of Aurora kinase vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 200.29 bits (508), Expect = 6.843e-73
Identity = 88/152 (57.89%), Postives = 115/152 (75.66%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK+QL + N+EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LEYA  G ++  LQK  +F +   ATY+ +L +ALSYCH K VIHRDIKPENLL+  + ELK+ADFGWS+H 
Sbjct:  143 LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHA 294          

HSP 2 Score: 87.4261 bits (215), Expect = 6.843e-73
Identity = 41/79 (51.90%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR T+CGTLDYLPPEM+  + +DEK+D W  G+L YE L G PPFE    QETY  I      F   +   ARDLI+R+
Sbjct:  298 RRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRL 376          

HSP 3 Score: 28.4906 bits (62), Expect = 6.843e-73
Identity = 11/31 (35.48%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK  + +RLT   +  HPW+  N SK
Sbjct:  372 LISRLLKHNASQRLTLAEVLEHPWIKANSSK 402          
BLAST of Aurora kinase vs. Ensembl Mouse
Match: Aurkb (aurora kinase B [Source:MGI Symbol;Acc:MGI:107168])

HSP 1 Score: 197.593 bits (501), Expect = 1.521e-69
Identity = 92/199 (46.23%), Postives = 134/199 (67.34%), Query Frame = 1
Query:   34 LAIIFDFKIFTMFYPDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            LA++  F   +   P    K  + +++     + S    P + + +F++G PLG GKFG+VYLA+  K  F+ ALKI+FKSQ+ +  +EHQ  REI+I  HL HPNIL+LY +F+D++ +YL+LEYA  G+++  LQK + F +   AT + +L DAL+YCH+K VIHRDIKPENLL+ L  ELK+ADFGWS+H   ++
Sbjct:   39 LALVNRFNSQSTAAPG--QKLAENKSQGSTASQGSQNKQPFT-IDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHLKHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELSDALTYCHKKKVIHRDIKPENLLLGLQGELKIADFGWSVHAPSLR 234          

HSP 2 Score: 86.2705 bits (212), Expect = 1.521e-69
Identity = 37/80 (46.25%), Postives = 54/80 (67.50%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + ++E +D W  G+L YE++ G PPFE     ETY  I    ++F S +   A+DLI+++
Sbjct:  233 LRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSSVPSGAQDLISKL 312          
BLAST of Aurora kinase vs. Ensembl Mouse
Match: Aurkb (aurora kinase B [Source:MGI Symbol;Acc:MGI:107168])

HSP 1 Score: 197.593 bits (501), Expect = 1.521e-69
Identity = 92/199 (46.23%), Postives = 134/199 (67.34%), Query Frame = 1
Query:   34 LAIIFDFKIFTMFYPDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            LA++  F   +   P    K  + +++     + S    P + + +F++G PLG GKFG+VYLA+  K  F+ ALKI+FKSQ+ +  +EHQ  REI+I  HL HPNIL+LY +F+D++ +YL+LEYA  G+++  LQK + F +   AT + +L DAL+YCH+K VIHRDIKPENLL+ L  ELK+ADFGWS+H   ++
Sbjct:   39 LALVNRFNSQSTAAPG--QKLAENKSQGSTASQGSQNKQPFT-IDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHLKHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELSDALTYCHKKKVIHRDIKPENLLLGLQGELKIADFGWSVHAPSLR 234          

HSP 2 Score: 86.2705 bits (212), Expect = 1.521e-69
Identity = 37/80 (46.25%), Postives = 54/80 (67.50%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + ++E +D W  G+L YE++ G PPFE     ETY  I    ++F S +   A+DLI+++
Sbjct:  233 LRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSSVPSGAQDLISKL 312          
BLAST of Aurora kinase vs. UniProt/SwissProt
Match: sp|Q9UQB9|AURKC_HUMAN (Aurora kinase C OS=Homo sapiens OX=9606 GN=AURKC PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 9.955e-74
Identity = 87/179 (48.60%), Postives = 124/179 (69.27%), Query Frame = 1
Query:   94 SDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
             ++  T     ++ S+  +    + DF++G PLG GKFG+VYLA+  +  F+ ALK++FKSQ+ +  LEHQ  REI+I  HL HPNIL+LY +FHD + VYL+LEYA  G+++  LQK ++  +   AT + +L DAL+YCH K VIHRDIKPENLL+    E+K+ADFGWS+HT  ++
Sbjct:   17 GEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLR 195          

HSP 2 Score: 99.7525 bits (247), Expect = 9.955e-74
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + YDEK+D W  G+L YE+L G+PPFE A   ETY  I    + F   + L ARDLI+R+
Sbjct:  194 LRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRL 273          

HSP 3 Score: 25.7942 bits (55), Expect = 9.955e-74
Identity = 9/32 (28.12%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++ ++L+ + +ERL    I  HPW+  +  +V
Sbjct:  269 LISRLLRYQPLERLPLAQILKHPWVQAHSRRV 300          
BLAST of Aurora kinase vs. UniProt/SwissProt
Match: sp|P97477|AURKA_MOUSE (Aurora kinase A OS=Mus musculus OX=10090 GN=Aurka PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 2.904e-72
Identity = 88/152 (57.89%), Postives = 115/152 (75.66%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK+QL + N+EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LEYA  G ++  LQK  +F +   ATY+ +L +ALSYCH K VIHRDIKPENLL+  + ELK+ADFGWS+H 
Sbjct:  121 LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHA 272          

HSP 2 Score: 87.4261 bits (215), Expect = 2.904e-72
Identity = 41/79 (51.90%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR T+CGTLDYLPPEM+  + +DEK+D W  G+L YE L G PPFE    QETY  I      F   +   ARDLI+R+
Sbjct:  276 RRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRL 354          

HSP 3 Score: 28.4906 bits (62), Expect = 2.904e-72
Identity = 11/31 (35.48%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK  + +RLT   +  HPW+  N SK
Sbjct:  350 LISRLLKHNASQRLTLAEVLEHPWIKANSSK 380          
BLAST of Aurora kinase vs. UniProt/SwissProt
Match: sp|P59241|AURKA_RAT (Aurora kinase A OS=Rattus norvegicus OX=10116 GN=Aurka PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.786e-71
Identity = 90/181 (49.72%), Postives = 124/181 (68.51%), Query Frame = 1
Query:   76 PDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            P   +  + +E ++ + +K  +       L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK QL +  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LEYA  G ++  LQK  +F +   ATY+ +L +ALSYCH K VIHRDIKPENLL+  + ELK+ADFGWS+H 
Sbjct:   94 PQPAASGNNSEKEQTSIQKTEDSKKRQWTLEDFDIGRPLGKGKFGNVYLAREKQSKFILALKVLFKVQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHA 274          

HSP 2 Score: 85.8853 bits (211), Expect = 1.786e-71
Identity = 41/79 (51.90%), Postives = 49/79 (62.03%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR TLCGTLDY PPEM+  + +DEK+D W  G+L YE L G PPFE    QETY  I      F   +   ARDLI+R+
Sbjct:  278 RRTTLCGTLDYQPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRL 356          

HSP 3 Score: 29.6462 bits (65), Expect = 1.786e-71
Identity = 12/31 (38.71%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK  S +RLT   +  HPW+  N SK
Sbjct:  352 LISRLLKHNSSQRLTLAEVLEHPWIKANSSK 382          
BLAST of Aurora kinase vs. UniProt/SwissProt
Match: sp|Q7YRC6|AURKB_BOVIN (Aurora kinase B OS=Bos taurus OX=9913 GN=AURKB PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.038e-70
Identity = 85/154 (55.19%), Postives = 115/154 (74.68%), Query Frame = 1
Query:  169 DFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            DF++G PLG GKFG+VYLA+  K  F+ ALK++FKSQ+ +  +EHQ  REI+I  HL HPNIL+LY +F+D + +YL+LEYA  G+++  LQK + F +   AT + +L DAL+YCH K VIHRDIKPENLL+ L  ELK+ADFGWS+H   ++
Sbjct:   76 DFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLQHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELADALTYCHAKKVIHRDIKPENLLLGLRGELKIADFGWSVHAPSLR 229          

HSP 2 Score: 89.3521 bits (220), Expect = 1.038e-70
Identity = 39/80 (48.75%), Postives = 54/80 (67.50%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGTLDYLPPEM+  + ++EK+D W  G+L YE+L G PPFE A   ETY  I    ++F   + L A+D I ++
Sbjct:  228 LRRKTMCGTLDYLPPEMIEGRTHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPPSVPLGAQDFIYKL 307          

HSP 3 Score: 25.409 bits (54), Expect = 1.038e-70
Identity = 9/31 (29.03%), Postives = 17/31 (54.84%), Query Frame = 1
Query:  946 MFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++++LK    ERL    +  HPW+  +  +V
Sbjct:  304 IYKLLKHNPSERLPLAQVSAHPWVRTHSRRV 334          
BLAST of Aurora kinase vs. UniProt/SwissProt
Match: sp|Q2TA06|AURKA_BOVIN (Aurora kinase A OS=Bos taurus OX=9913 GN=AURKA PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.163e-69
Identity = 95/184 (51.63%), Postives = 125/184 (67.93%), Query Frame = 1
Query:   88 SKSDQTETKKDNTEKK--SNKDIPISK-----LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            SK  Q     +N EK+  S +    SK     L+DF++G PLG GKFG+VYLA+  +  F+ ALK++FK+QL +  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LEYA  G ++  LQK  +F +   ATY+ +L +ALSYCH K VIHRDIKPENLL+    ELK+ADFGWS+H 
Sbjct:   98 SKQPQPPAPGNNPEKEVASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA 281          

HSP 2 Score: 87.0409 bits (214), Expect = 1.163e-69
Identity = 42/79 (53.16%), Postives = 50/79 (63.29%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  + +DEK+D W  G+L YE L G PPFE    QETY  I      F   +   ARDLI+R+
Sbjct:  285 RRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEADTYQETYRRISRVEFTFPDCVPEGARDLISRL 363          

HSP 3 Score: 23.483 bits (49), Expect = 1.163e-69
Identity = 9/36 (25.00%), Postives = 18/36 (50.00%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKVELKK 1050
            ++ ++LK    +R T   +  HPW++ N      +K
Sbjct:  359 LISRLLKHNPSQRPTLKEVLEHPWIIANSKPSSCQK 394          
BLAST of Aurora kinase vs. TrEMBL
Match: A0A0R3UPW9 (Protein kinase domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9907 PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 4.479e-81
Identity = 106/162 (65.43%), Postives = 136/162 (83.95%), Query Frame = 1
Query:  145 DIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            D+PISKL DF +G PLGTGKFG+V+LA+T KE FVCALKI+FK QL R N+EHQ  RE++IM HL HP+IL+LYT+FHD   +YLVLEYA++GQM++ LQ+++RF++ +AATY++QLCDAL YCH + VIHRDIKPENLL+ L  ELKLADFGWS+H   ++
Sbjct:   32 DLPISKLSDFYIGRPLGTGKFGNVFLARTRKENFVCALKILFKKQLVRCNVEHQLRREVEIMCHLRHPHILQLYTYFHDSTKIYLVLEYAYYGQMYSHLQREKRFSERKAATYVYQLCDALKYCHARHVIHRDIKPENLLLGLYNELKLADFGWSVHAPSLR 193          

HSP 2 Score: 96.2857 bits (238), Expect = 4.479e-81
Identity = 43/80 (53.75%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGT+DYLPPEM+    ++E++DHW  GIL YEML G PPFE    +ETYA IR     F S I   A+DLI+++
Sbjct:  192 LRRKTMCGTIDYLPPEMILGHHHNERVDHWAVGILCYEMLSGHPPFESDDTKETYARIRIVKYRFPSVIGALAQDLISKI 271          
BLAST of Aurora kinase vs. TrEMBL
Match: A0A0R3TJZ0 (Protein kinase domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7433 PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 4.242e-79
Identity = 108/184 (58.70%), Postives = 146/184 (79.35%), Query Frame = 1
Query:   79 DVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            +++S+++ T  + DN+E      +PISKL DF +G PLGTGKFG+V+LA+T K+ F+CALKI+FK QL +  +EHQ  REI+IM HL HP+IL+LYT+FHD   VYLVLEYA++GQM+T LQ+++RF++ ++ATY++QLCDAL YCH + VIHRDIKPENLLI    ELKLADFGWS+H   ++
Sbjct:    4 ELISEANSTNLEHDNSE------LPISKLTDFYIGRPLGTGKFGNVFLARTKKDDFICALKIIFKKQLVKGGMEHQLRREIEIMCHLRHPHILQLYTYFHDSNKVYLVLEYAFYGQMYTHLQREKRFSERKSATYIYQLCDALKYCHARHVIHRDIKPENLLIGFYNELKLADFGWSVHAPSLR 181          

HSP 2 Score: 90.5077 bits (223), Expect = 4.242e-79
Identity = 40/80 (50.00%), Postives = 55/80 (68.75%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGT+DYLPPEM+    ++E++DHW  G+L YEML+G PPF     + TYA I+     F S I   ARDLI+++
Sbjct:  180 LRRKTMCGTVDYLPPEMILGYSHNERVDHWAVGVLCYEMLYGDPPFIHENTKGTYARIKEVKYRFPSIITPLARDLISKI 259          
BLAST of Aurora kinase vs. TrEMBL
Match: A0A0R3SFI4 (Protein kinase domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3601 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 2.912e-78
Identity = 104/168 (61.90%), Postives = 138/168 (82.14%), Query Frame = 1
Query:  127 EKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            ++++N  +PIS+L DF +G PLGTGKFG+V+LA+T KE F+CALKI+FK QL +  +EHQ  REI+IM HL HP+IL+LYT+FHD   VYLVLEYA++GQM+T LQ+++RF++ ++ATY++QLCDAL YCH + VIHRDIKPENLLI    ELKLADFGWS+H   ++
Sbjct:   14 QEQNNFGLPISRLFDFYIGRPLGTGKFGNVFLARTKKEDFICALKIIFKKQLVKCGMEHQLRREIEIMCHLRHPHILQLYTYFHDSNKVYLVLEYAFYGQMYTHLQREKRFSERKSATYIYQLCDALKYCHARHVIHRDIKPENLLIGFYNELKLADFGWSVHAPSLR 181          

HSP 2 Score: 92.4337 bits (228), Expect = 2.912e-78
Identity = 41/80 (51.25%), Postives = 56/80 (70.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGT+DYLPPEM+    ++E++DHW  G+L YEML+G PPF     +ETYA I+     F S I   ARDLI+++
Sbjct:  180 LRRKTMCGTVDYLPPEMLLGYSHNERVDHWAVGVLCYEMLYGDPPFVHENTKETYARIKEVKYRFPSVITPLARDLISKI 259          
BLAST of Aurora kinase vs. TrEMBL
Match: A0A0R3WIT2 (Protein kinase domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS529 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 9.952e-78
Identity = 105/168 (62.50%), Postives = 133/168 (79.17%), Query Frame = 1
Query:  127 EKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            E   N + PIS+L DF +G PLG GKFG+V+LA+T KE FVCALKI+FK QL +  +EHQ  REI+IM HL HP+IL+LYT+FHDE  VYLVLEYA++GQM+  LQ ++RF++ +AATY++QLCDAL YCH + VIHRDIKPENLL+    ELKLADFGWS+H   ++
Sbjct:   13 ESSQNSEPPISRLSDFFIGRPLGNGKFGNVFLARTRKEDFVCALKILFKKQLVKCGMEHQLRREIEIMCHLRHPHILQLYTYFHDETKVYLVLEYAFYGQMYAHLQLEKRFSERKAATYVYQLCDALKYCHSRYVIHRDIKPENLLLGFYNELKLADFGWSVHAPSLR 180          

HSP 2 Score: 91.2781 bits (225), Expect = 9.952e-78
Identity = 40/80 (50.00%), Postives = 57/80 (71.25%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGT+DYLPPEM+    ++E++DHW  G+L YEML G PPF     +ETYA I+A   +F S I   A+DLI+++
Sbjct:  179 LRRRTMCGTIDYLPPEMLLGHCHNERVDHWAVGVLCYEMLSGNPPFVHKDTKETYARIKAVKYKFPSVITPLAQDLISKI 258          
BLAST of Aurora kinase vs. TrEMBL
Match: A0A0R3WCU9 (Protein kinase domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8552 PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 2.719e-77
Identity = 102/159 (64.15%), Postives = 130/159 (81.76%), Query Frame = 1
Query:  154 ISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            + +L DF +G PLGTGKFG+V+LA+T KE FVCALKI+FK QL +  +EHQ  REI+IM HL HP+IL+LYT+FHDE  VYLVLEYA++GQM+T LQ+++RF++ +AATY +QLCDAL YCH + VIHRDIKPENLL+    ELKLADFGWS+H   ++
Sbjct:   15 LQRLSDFYIGRPLGTGKFGNVFLARTKKEDFVCALKILFKKQLVKCGMEHQLRREIEIMCHLRHPHILQLYTYFHDESKVYLVLEYAFYGQMYTYLQREKRFSERKAATYAYQLCDALKYCHARHVIHRDIKPENLLLGFYNELKLADFGWSVHAPSLR 173          

HSP 2 Score: 93.9745 bits (232), Expect = 2.719e-77
Identity = 41/80 (51.25%), Postives = 58/80 (72.50%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RRKT+CGT+DYLPPEM+   +++E++DHW  G+L YEML G PPF     +ETYA I+A   +F S I   A+DLI+++
Sbjct:  172 LRRKTMCGTIDYLPPEMLLGHDHNERVDHWAVGVLCYEMLSGNPPFVHNDTKETYARIKAVKYKFPSVITPLAQDLISKI 251          
BLAST of Aurora kinase vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 186.808 bits (473), Expect = 3.670e-67
Identity = 83/156 (53.21%), Postives = 112/156 (71.79%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            +KDF +G PLG GKFG+VYLA+  K   V ALK++FKSQ+ +  +EHQ  REI+I   L HPNIL+ Y +F+D   V+L+LEYA  G+M+  LQ+  RF+D   AT++ ++ DAL YCH+  VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:   45 IKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLR 200          

HSP 2 Score: 88.5817 bits (218), Expect = 3.670e-67
Identity = 40/80 (50.00%), Postives = 52/80 (65.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+    +DEK+D W  G+L YE L G PPFE A   ETY  I    + F   +   ARDLI+++
Sbjct:  199 LRRRTMCGTLDYLPPEMIEGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKL 278          
BLAST of Aurora kinase vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 186.037 bits (471), Expect = 5.558e-67
Identity = 83/156 (53.21%), Postives = 112/156 (71.79%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            +KDF +G PLG GKFG+VYLA+  K   V ALK++FKSQ+ +  +EHQ  REI+I   L HPNIL+ Y +F+D   V+L+LEYA  G+M+  LQ+  RF+D   AT++ ++ DAL YCH+  VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:   32 IKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLR 187          

HSP 2 Score: 88.9669 bits (219), Expect = 5.558e-67
Identity = 40/80 (50.00%), Postives = 52/80 (65.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+    +DEK+D W  G+L YE L G PPFE A   ETY  I    + F   +   ARDLI+++
Sbjct:  186 LRRRTMCGTLDYLPPEMIEGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKL 265          
BLAST of Aurora kinase vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 191.43 bits (485), Expect = 6.652e-67
Identity = 91/185 (49.19%), Postives = 122/185 (65.95%), Query Frame = 1
Query:   85 VSKSDQTETKKDNTEKKSNKDIPIS-------KLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            V+ +    +K D   +K    I I         L++FD+G  LG GKFG VYLA+  +  F+ ALK++FK QL +  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LE+A  G+++  LQ+   F D  +ATY+ +L DAL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+HT
Sbjct:  118 VNAAAAEPSKPDKPSQKPASGIAIQASSKMPWSLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHT 302          

HSP 2 Score: 83.1889 bits (204), Expect = 6.652e-67
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLIT 902
            RR TLCGTLDYLPPEM+  K +DEK+D W  G+L YE L G PPFE    +ETY  I      + + +   +R+LI 
Sbjct:  306 RRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLIN 382          
BLAST of Aurora kinase vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 188.348 bits (477), Expect = 4.561e-66
Identity = 85/152 (55.92%), Postives = 112/152 (73.68%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L++FD+G  LG GKFG VYLA+  +  F+ ALK++FK QL +  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LE+A  G+++  LQ+   F D  +ATY+ +L DAL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+HT
Sbjct:  105 LENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHT 256          

HSP 2 Score: 83.1889 bits (204), Expect = 4.561e-66
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLIT 902
            RR TLCGTLDYLPPEM+  K +DEK+D W  G+L YE L G PPFE    +ETY  I      + + +   +R+LI 
Sbjct:  260 RRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLIN 336          
BLAST of Aurora kinase vs. Ensembl Cavefish
Match: prkx (protein kinase X-linked [Source:NCBI gene;Acc:103026199])

HSP 1 Score: 102.834 bits (255), Expect = 2.123e-35
Identity = 49/149 (32.89%), Postives = 88/149 (59.06%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            L+DFD    +GTG FG V+L K  K     ALK M    + R   E     E +++  ++HP ++ L+   HDE+ +Y++++Y   G++F+ L+ + RF++     Y  ++  A+ Y H K +++RD+KPEN+L+  +  ++L DFG++
Sbjct:   48 LEDFDTVATVGTGTFGRVFLVKDKKTRGFFALKAMKIPDVIRLKQEQHVHNEKEVLTEVNHPFLITLFWTHHDERFLYMLMDYVPGGELFSYLRSRGRFSNNTGLFYSAEIVCAIEYLHSKEIVYRDLKPENILLDGEGHIRLTDFGFA 196          

HSP 2 Score: 66.6254 bits (161), Expect = 2.123e-35
Identity = 34/91 (37.36%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV*MVVLIAVKLND 944
            R  TLCGT +YL PE++ SK +   +D W  G+L++EML G+PPF        Y  I A  +EF   +    +DLI +  +V+  A +L +
Sbjct:  202 RTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGVLIFEMLAGYPPFFDDNPFGIYQKILAGKLEFPRHLDFYVKDLIKKF-LVIDRARRLGN 291          
BLAST of Aurora kinase vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 178.333 bits (451), Expect = 2.138e-64
Identity = 87/152 (57.24%), Postives = 113/152 (74.34%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L +FD+G PLG GKFG+VYLA+     F+ ALK++FKSQL +  +EHQ  REI+I  HL HPNIL+LY +FHD   VYL+LEYA  G+++ +LQK  +F +  +A+Y+  + DAL YCH K VIHRDIKPENLL+ L  ELK+ADFGWS+H 
Sbjct:   12 LDNFDIGRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRHPNILRLYGYFHDRTRVYLILEYAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKGELKIADFGWSVHA 163          

HSP 2 Score: 85.5001 bits (210), Expect = 2.138e-64
Identity = 40/79 (50.63%), Postives = 49/79 (62.03%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  + +DEK+D W  G+L YE L G PPFE     ETY  I    + F S +   A+DLI  +
Sbjct:  167 RRATLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLVGRPPFESETHNETYRRISKVDLRFPSHLSDGAKDLIANL 245          
BLAST of Aurora kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 8.894e-37
Identity = 64/140 (45.71%), Postives = 90/140 (64.29%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LA+ +  G   A+KI+ K+QL   +L+  F RE+ IM  L+HPNI+KLY     EK +YLV+EYA  G++F  L    R  + EA     Q+  A+ YCHQK ++HRD+K ENLL+ +DM +K+ADFG+S
Sbjct:   45 IGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLF-REVRIMKCLNHPNIVKLYEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMHIKIADFGFS 183          

HSP 2 Score: 42.3578 bits (98), Expect = 8.894e-37
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+    +E
Sbjct:  194 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKE 243          
BLAST of Aurora kinase vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 124.79 bits (312), Expect = 1.793e-35
Identity = 63/140 (45.00%), Postives = 88/140 (62.86%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LA+    G   A+KI+ K+QL   +L+  F RE+ IM  L+HPNI+KL+     EK +YLV+EYA  G++F  L    R  + EA     Q+  A+ YCHQK ++HRD+K ENLL+  DM +K+ADFG+S
Sbjct:   60 IGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLF-REVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFS 198          

HSP 2 Score: 42.3578 bits (98), Expect = 1.793e-35
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+    +E
Sbjct:  209 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKE 258          
BLAST of Aurora kinase vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 121.709 bits (304), Expect = 1.720e-34
Identity = 63/140 (45.00%), Postives = 88/140 (62.86%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LAK    G   A+KI+ K+QL   +L+  F RE+ IM  L+HPNI+KL+     EK +YLV+EY+  G++F  L    R  + EA     Q+  A+ YCHQK ++HRD+K ENLL+  DM +K+ADFG+S
Sbjct:   74 IGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLF-REVRIMKVLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFS 212          

HSP 2 Score: 41.9726 bits (97), Expect = 1.720e-34
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYDE-KIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+    +E
Sbjct:  223 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKE 272          
BLAST of Aurora kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002824.1 (pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215:-1 gene:ENSPMAG00000002574.1 transcript:ENSPMAT00000002824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 3.693e-32
Identity = 64/165 (38.79%), Postives = 91/165 (55.15%), Query Frame = 1
Query:  136 SNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQR-FT-DIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNL 624
            S K IP    KDF V   LG G F  VY A++   G   A+K++ K  + R  +  +   E++I   L HP IL++Y  F D+ +VYLVLE    G+M   L+ + R FT + EA  +L ++   L Y H  GVIHRD+   NLL++ DM  ++ADFG +    L
Sbjct:    5 SGKKIP----KDFQVMNLLGKGSFACVYRARSCHTGIEVAIKMIDKQAMRRAGMVDRVRAEVEIHSQLKHPAILEMYGCFEDDNYVYLVLEMCHNGEMSRYLKNQGRPFTEEQEARQFLREISSGLLYLHAHGVIHRDLTLANLLLASDMSTRIADFGLAARLPL 165          

HSP 2 Score: 47.7506 bits (112), Expect = 3.693e-32
Identity = 21/58 (36.21%), Postives = 30/58 (51.72%), Query Frame = 3
Query:  675 RKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRA 848
            R T+CGT +Y+ PE+ +   +    D W  G   Y ML G PPF+ +    T A + A
Sbjct:  170 RLTVCGTPNYMSPEVASRGPHGTPADAWALGCAAYAMLVGRPPFQASAVPATLARVLA 227          
BLAST of Aurora kinase vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 151.369 bits (381), Expect = 1.695e-59
Identity = 79/161 (49.07%), Postives = 112/161 (69.57%), Query Frame = 1
Query:  139 NKDIPISK---LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSI 612
            NK +P  K   L DF++G  LG GKFG VY  +    G++CALK+M K ++ ++NL+ QF RE++I   L+HPN+ K Y +FHDEK VYL++EY   G+M+ +L+    F DI A+ Y++Q+ +AL Y H+K +IHRDIKPEN+LI  +  +KL DFGWSI
Sbjct:   90 NKKLPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSI 250          

HSP 2 Score: 90.1225 bits (222), Expect = 1.695e-59
Identity = 42/79 (53.16%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RRKT+CGT+DYL PEMV S+EYD  ID W  G+L +E+L G PPFE+  K  TY  I A  I+  S+I  +A+DLI ++
Sbjct:  257 RRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKL 335          

HSP 3 Score: 26.1794 bits (56), Expect = 1.695e-59
Identity = 11/37 (29.73%), Postives = 22/37 (59.46%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKVELKKM 1053
            ++ ++LK    +R+    ++ HPW+LRN    E K++
Sbjct:  331 LILKLLKYDPKDRMRLGDVKMHPWILRNKPFWENKRL 367          
BLAST of Aurora kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 107.071 bits (266), Expect = 1.738e-38
Identity = 52/158 (32.91%), Postives = 97/158 (61.39%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTR-HNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMKY 633
            L+DF +   LGTG FG V+L ++   G   A+K++ K  + R   +EH     + + + + HP I++++  F D + ++++++Y   G++F++L+K QRF +  A  Y  ++C AL Y H K +I+RD+KPEN+L+  +  +K+ DFG++ +   + Y
Sbjct:   84 LQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSI-VTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY 240          

HSP 2 Score: 69.707 bits (169), Expect = 1.738e-38
Identity = 32/76 (42.11%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            TLCGT DY+ PE+V++K Y++ ID W  GIL+YEML G+ PF  +   +TY  I    + F      + +DL++R+
Sbjct:  241 TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRL 316          
BLAST of Aurora kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 106.686 bits (265), Expect = 3.841e-38
Identity = 52/149 (34.90%), Postives = 89/149 (59.73%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            L DF +   LGTG FG V+L ++   G   ALK + K  + +         E  ++  + HP I++++  F D + V++V++Y   G++F++L+K QRF +  A  Y  ++C AL Y H K +I+RD+KPEN+L+  +  +K+ DFG++
Sbjct:   85 LSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFA 233          

HSP 2 Score: 68.5514 bits (166), Expect = 3.841e-38
Identity = 30/76 (39.47%), Postives = 49/76 (64.47%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            TLCGT DY+ PE+V++K Y++ +D W  G+L+YEML G+ PF  +   +TY  I    ++F      +A+DL+ ++
Sbjct:  242 TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKL 317          
BLAST of Aurora kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 105.531 bits (262), Expect = 2.350e-36
Identity = 49/149 (32.89%), Postives = 92/149 (61.74%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            L DF +   LGTG FG V+L ++V  G   A+K++ K Q+ +         E  ++  ++HP +++++  F D +++++V++Y   G++F++L+K QRF +  A  Y  ++  AL Y H   +I+RD+KPEN+L+  +  +K+ DFG++
Sbjct:   67 LHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA 215          

HSP 2 Score: 63.929 bits (154), Expect = 2.350e-36
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSI----EFRSDIVLEARDLIT 902
            TLCGT DY+ PE++ +K Y++ +D W  G+L+YEML G+ PF      +TY  I    +     F  D+V     LIT
Sbjct:  224 TLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLIT 301          
BLAST of Aurora kinase vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 104.76 bits (260), Expect = 2.357e-32
Identity = 55/165 (33.33%), Postives = 93/165 (56.36%), Query Frame = 1
Query:  133 KSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRH------NLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            K+ K+I    +KDF  G  +G G +  V LA ++      A K++ K  L R       ++E   L++++     + P++++L++ F DE  +Y +LEYA  G   ++++K     +  A  Y  Q+ DA+ Y H  G+IHRDIKPEN+L+  +M++KL DFG +
Sbjct:  166 KAQKNIIKKGIKDFKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLN-----NSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTA 325          

HSP 2 Score: 51.2174 bits (121), Expect = 2.357e-32
Identity = 24/82 (29.27%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  663 FHIRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
               R K+  GT +Y+ PE++N    D + D W  G +L++M+ G PPF+   +  T+  +      F     L  RDL+ ++
Sbjct:  342 LSTRSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKI 423          
BLAST of Aurora kinase vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 187.578 bits (475), Expect = 1.327e-69
Identity = 84/152 (55.26%), Postives = 114/152 (75.00%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L DFD+G PLG GKFG+VYLA+  K  ++ ALK++FKSQL + N+EHQ  REI+I  HL H NIL+L+ +F+D+  VYL+LEYA  G+++  L   ++F +  AA Y+ QL DAL+YCH K VIHRDIKPENLL++   ++K+ADFGWS+H 
Sbjct:   45 LSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHA 196          

HSP 2 Score: 92.0485 bits (227), Expect = 1.327e-69
Identity = 43/79 (54.43%), Postives = 52/79 (65.82%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  KE+DEK+D W  G+L YE L G PPFE     ETY  I    + F S +   ARDLI+++
Sbjct:  200 RRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKL 278          

HSP 3 Score: 23.8682 bits (50), Expect = 1.327e-69
Identity = 9/32 (28.12%), Postives = 18/32 (56.25%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKV 1038
            ++ ++L+     RL   A+ NHPW+  + + V
Sbjct:  274 LISKLLQHNPNNRLPLKAVLNHPWIRMHATPV 305          
BLAST of Aurora kinase vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 108.227 bits (269), Expect = 3.328e-37
Identity = 58/163 (35.58%), Postives = 95/163 (58.28%), Query Frame = 1
Query:  121 NTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +T KK  +    + L+DF++   LGTG FG V LA+  + G   ALKIM  S++ R         E +I++ ++HP I+ L    HD+  +Y++LEYA  G++FT L+   RF +     +  ++  A+ Y H   +++RD+KPEN+L+  D  +KL DFG++
Sbjct:    5 STRKKDKR----TTLQDFELSKTLGTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFA 163          

HSP 2 Score: 65.0846 bits (157), Expect = 3.328e-37
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 3
Query:  666 HIRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDI-VLEARDLITRV 908
            H +  TLCGT +YL PE++ SK +++ +D W  GIL+YEML G+PPF        Y  I +  +E+   +    A+DLI ++
Sbjct:  167 HDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNTSAKDLIKKL 248          
BLAST of Aurora kinase vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 130.183 bits (326), Expect = 7.852e-37
Identity = 68/140 (48.57%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  190 LGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +G G F  V LAK V  G   A+KI+ K+QL   +L+  F RE+ IM  LDHPNI+KLY     +K +YLV+EYA  G++F  L    R  + EA     Q+  A+ YCHQK VIHRD+K ENLL+  DM +K+ADFG+S
Sbjct:   44 IGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSLQKLF-REVRIMKFLDHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFS 182          

HSP 2 Score: 41.9726 bits (97), Expect = 7.852e-37
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYD-EKIDHWMTGILLYEMLHGFPPFEKAKKQE 827
            T CG+  Y  PE+   K+YD  ++D W  G++LY ++ G  PF+    +E
Sbjct:  193 TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKE 242          
BLAST of Aurora kinase vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 92.8189 bits (229), Expect = 1.093e-32
Identity = 53/171 (30.99%), Postives = 95/171 (55.56%), Query Frame = 1
Query:   94 SDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMV-HLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFG 603
            SD  + +K +  + +N   P +K  DF     +G G FG V+L+K  +E    A+K++ KS + + N     + E +++V ++ HP ++ L+  F  +  +Y VL+Y   G++F  LQ+++ F +  A  Y  ++  A+ Y H   +I+RD+KPEN+L+     + L DFG
Sbjct:   51 SDDADVEKIDLGESNN---PKAKPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFG 218          

HSP 2 Score: 65.4698 bits (158), Expect = 1.093e-32
Identity = 28/73 (38.36%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  681 TLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLI 899
            T CGT +YL PE++  ++YD+ +D W  G +LYEM++G PPF      E Y  I    +  R++I   AR ++
Sbjct:  232 TFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHIL 304          
BLAST of Aurora kinase vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 97.4413 bits (241), Expect = 3.278e-32
Identity = 51/150 (34.00%), Postives = 84/150 (56.00%), Query Frame = 1
Query:  160 KLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWS 609
            +L+D  V   LG G FG V L +   +    ALK + K  +     +   + E  IM+  + P I++L+  F D+K++Y++LE    G+++TIL+ +  F D     Y+  + +A  Y H KG+++RD+KPENLL+      KL DFG++
Sbjct:  348 RLEDLTVVKTLGIGGFGRVELVQVAGDKRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFA 497          

HSP 2 Score: 59.3066 bits (142), Expect = 3.278e-32
Identity = 32/86 (37.21%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  657 IYFHIRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAI--RANSIEFRSDIVLEARDLITRV 908
            I F  +  T CGT +Y+ PE++ +K +D   D+W  GIL+YE+L G PPF      +TY  I    + I+F   I   A  LI ++
Sbjct:  500 IGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFPRKITRNAHALIKKL 585          
BLAST of Aurora kinase vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 200.675 bits (509), Expect = 1.518e-69
Identity = 95/181 (52.49%), Postives = 127/181 (70.17%), Query Frame = 1
Query:   76 PDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            P    K+D+ ++K   TE+ S      S L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK QL R  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LE+A  G+++  LQ+   F +  +ATY+ +L DAL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+HT
Sbjct:  127 PSEPIKADKQQSKLSRTEQGSTSKKRWS-LEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHT 306          

HSP 2 Score: 80.4925 bits (197), Expect = 1.518e-69
Identity = 40/83 (48.19%), Postives = 52/83 (62.65%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEF----RSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  K +DEK+D W  G+L YE L G PPFE     ETY   R + +E+     + I   A+DL+ ++
Sbjct:  310 RRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYR--RISRVEYTYPAHAAISDGAKDLVAKL 390          

HSP 3 Score: 23.483 bits (49), Expect = 1.518e-69
Identity = 8/31 (25.81%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK   + RL    +  HPW+L++ ++
Sbjct:  386 LVAKLLKHNPMHRLPIQGVLCHPWLLQHSTR 416          
BLAST of Aurora kinase vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 200.29 bits (508), Expect = 2.708e-69
Identity = 95/181 (52.49%), Postives = 127/181 (70.17%), Query Frame = 1
Query:   76 PDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            P    K+D+ ++K   TE+ S      S L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK QL R  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LE+A  G+++  LQ+   F +  +ATY+ +L DAL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+HT
Sbjct:   91 PSEPIKADKQQSKLSRTEQGSTSKKRWS-LEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHT 270          

HSP 2 Score: 80.1073 bits (196), Expect = 2.708e-69
Identity = 40/83 (48.19%), Postives = 52/83 (62.65%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEF----RSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  K +DEK+D W  G+L YE L G PPFE     ETY   R + +E+     + I   A+DL+ ++
Sbjct:  274 RRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYR--RISRVEYTYPAHAAISDGAKDLVAKL 354          

HSP 3 Score: 23.483 bits (49), Expect = 2.708e-69
Identity = 8/31 (25.81%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK   + RL    +  HPW+L++ ++
Sbjct:  350 LVAKLLKHNPMHRLPIQGVLCHPWLLQHSTR 380          
BLAST of Aurora kinase vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 198.749 bits (504), Expect = 5.350e-69
Identity = 90/156 (57.69%), Postives = 115/156 (73.72%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            + DFD+G PLG GKFG+VYLA+  K   + ALK++FKSQ+ +  +EHQ  REI+I  HL HPNIL+ Y +FHD K V+LVLEYA  G+M+  LQK QRF D   ATY+ ++ DAL YCH+K VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:   62 IDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLR 217          

HSP 2 Score: 82.8037 bits (203), Expect = 5.350e-69
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+    + EK+D W  G+L +E L G PPFE A   +TY  I    + F   +   ARDLI+++
Sbjct:  216 LRRRTMCGTLDYLPPEMIEGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKL 295          
BLAST of Aurora kinase vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 198.364 bits (503), Expect = 7.039e-69
Identity = 90/156 (57.69%), Postives = 115/156 (73.72%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            + DFD+G PLG GKFG+VYLA+  K   + ALK++FKSQ+ +  +EHQ  REI+I  HL HPNIL+ Y +FHD K V+LVLEYA  G+M+  LQK QRF D   ATY+ ++ DAL YCH+K VIHRDIKPENLL+    ELK+ADFGWS+H   ++
Sbjct:   42 IDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLR 197          

HSP 2 Score: 82.8037 bits (203), Expect = 7.039e-69
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            +RR+T+CGTLDYLPPEM+    + EK+D W  G+L +E L G PPFE A   +TY  I    + F   +   ARDLI+++
Sbjct:  196 LRRRTMCGTLDYLPPEMIEGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKL 275          
BLAST of Aurora kinase vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 195.282 bits (495), Expect = 7.152e-68
Identity = 87/152 (57.24%), Postives = 114/152 (75.00%), Query Frame = 1
Query:  163 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHT 618
            L+DFD+G PLG GKFG+VYLA+  +  F+ ALK++FK QL R  +EHQ  RE++I  HL HPNIL+LY +FHD   VYL+LE+A  G+++  LQ+   F +  +ATY+ +L DAL YCH K VIHRDIKPENLL+  + ELK+ADFGWS+HT
Sbjct:  166 LEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHT 317          

HSP 2 Score: 80.4925 bits (197), Expect = 7.152e-68
Identity = 40/83 (48.19%), Postives = 52/83 (62.65%), Query Frame = 3
Query:  672 RRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEF----RSDIVLEARDLITRV 908
            RR TLCGTLDYLPPEM+  K +DEK+D W  G+L YE L G PPFE     ETY   R + +E+     + I   A+DL+ ++
Sbjct:  321 RRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYR--RISRVEYTYPAHAAISDGAKDLVAKL 401          

HSP 3 Score: 23.483 bits (49), Expect = 7.152e-68
Identity = 8/31 (25.81%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSK 1035
            ++ ++LK   + RL    +  HPW+L++ ++
Sbjct:  397 LVAKLLKHNPMHRLPIQGVLCHPWLLQHSTR 427          
BLAST of Aurora kinase vs. Planmine SMEST
Match: SMESG000016505.1 (SMESG000016505.1)

HSP 1 Score: 347.821 bits (891), Expect = 1.029e-156
Identity = 174/188 (92.55%), Postives = 181/188 (96.28%), Query Frame = 1
Query:   67 MFYPDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            MF  D+VSK+ QTETKK++ E KSNK+I +SKLKDFD+GMPLGTGKFGHVYL KTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK
Sbjct:    1 MFQSDIVSKNYQTETKKNSNENKSNKNIQVSKLKDFDIGMPLGTGKFGHVYLVKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 188          

HSP 2 Score: 167.933 bits (424), Expect = 1.029e-156
Identity = 77/80 (96.25%), Postives = 80/80 (100.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            ++RKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITR+
Sbjct:  187 MKRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRI 266          

HSP 3 Score: 79.7221 bits (195), Expect = 1.029e-156
Identity = 38/39 (97.44%), Postives = 39/39 (100.00%), Query Frame = 1
Query:  952 QILKLKSVERLTFVAIQNHPWMLRNVSKVELKKMRPDQK 1068
            +ILKLKSVERLTFVAIQNHPWMLRNVSKVELKKMRPDQK
Sbjct:  265 RILKLKSVERLTFVAIQNHPWMLRNVSKVELKKMRPDQK 303          
BLAST of Aurora kinase vs. Planmine SMEST
Match: SMESG000016545.1 (SMESG000016545.1)

HSP 1 Score: 360.533 bits (924), Expect = 1.793e-153
Identity = 178/193 (92.23%), Postives = 178/193 (92.23%), Query Frame = 1
Query:   67 MFYPDVVSKSDQTETKKDNTEKKSNK---------------DIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADF 600
            MFYPDVVSKSDQTETKKDNTEKKSNK               DIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADF
Sbjct:    1 MFYPDVVSKSDQTETKKDNTEKKSNKFVLFQEIIKFKLSLRDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADF 193          

HSP 2 Score: 202.216 bits (513), Expect = 1.793e-153
Identity = 94/109 (86.24%), Postives = 102/109 (93.58%), Query Frame = 3
Query:  582 IETGRFRLVYSHKFNEVRHHLTVAIIYFHIRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV 908
            ++   FRLVYSHKFNEVRH+LTVAIIYFHIRRKT+CGTLDYLPPE+VN KEYDEKIDHWMTGILLYEMLHG PPFE+A KQETYAAIR N+I+FRSDIVLEARDLITRV
Sbjct:  188 LKLADFRLVYSHKFNEVRHYLTVAIIYFHIRRKTMCGTLDYLPPEIVNYKEYDEKIDHWMTGILLYEMLHGCPPFERANKQETYAAIRGNTIKFRSDIVLEARDLITRV 296          
BLAST of Aurora kinase vs. Planmine SMEST
Match: SMESG000004605.1 (SMESG000004605.1)

HSP 1 Score: 379.793 bits (974), Expect = 1.523e-144
Identity = 187/203 (92.12%), Postives = 187/203 (92.12%), Query Frame = 1
Query:   67 MFYPDVVSKSDQTETKKDNTEKKSNK---------------DIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            MFYPDV SKSDQTETKKDNTEKKSNK               DIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK
Sbjct:    1 MFYPDVDSKSDQTETKKDNTEKKSNKFVLFLEIIKFKLSLRDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 203          

HSP 2 Score: 153.295 bits (386), Expect = 1.523e-144
Identity = 71/100 (71.00%), Postives = 86/100 (86.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV*MVVLIAVKLNDHVSDPKIK 968
            ++RKT+CGTLDYLPPE+VN KEYDEKIDHWMTGILLYEMLHG PPFE+A KQETYAAIR N+I+FRSDIVLEARDLITR+     + ++  + +S P+I+
Sbjct:  202 MKRKTMCGTLDYLPPEIVNYKEYDEKIDHWMTGILLYEMLHGCPPFERANKQETYAAIRGNTIKFRSDIVLEARDLITRI-----LKLRATERLSFPEIQ 296          

HSP 3 Score: 65.855 bits (159), Expect = 1.396e-11
Identity = 30/39 (76.92%), Postives = 35/39 (89.74%), Query Frame = 1
Query:  952 QILKLKSVERLTFVAIQNHPWMLRNVSKVELKKMRPDQK 1068
            +ILKL++ ERL+F  IQNHPWML+ VSKVELKKMRPDQK
Sbjct:  280 RILKLRATERLSFPEIQNHPWMLKYVSKVELKKMRPDQK 318          
BLAST of Aurora kinase vs. Planmine SMEST
Match: SMESG000004605.1 (SMESG000004605.1)

HSP 1 Score: 275.404 bits (703), Expect = 7.851e-134
Identity = 137/153 (89.54%), Postives = 137/153 (89.54%), Query Frame = 1
Query:   67 MFYPDVVSKSDQTETKKDNTEKKSNK---------------DIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAAT 480
            MFYPDV SKSDQTETKKDNTEKKSNK               DIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAAT
Sbjct:    1 MFYPDVDSKSDQTETKKDNTEKKSNKFVLFLEIIKFKLSLRDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAAT 153          

HSP 2 Score: 222.246 bits (565), Expect = 7.851e-134
Identity = 105/133 (78.95%), Postives = 119/133 (89.47%), Query Frame = 3
Query:  570 SRYGIETGRFRLVYSHKFNEVRHHLTVAIIYFHIRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV*MVVLIAVKLNDHVSDPKIK 968
            SRYGIETGRFRLVYSHKFNEVRH+LTVAIIYFHIRRKT+CGTLDYLPPE+VN KEYDEKIDHWMTGILLYEMLHG PPFE+A KQETYAAIR N+I+FRSDIVLEARDLITR+     + ++  + +S P+I+
Sbjct:  154 SRYGIETGRFRLVYSHKFNEVRHYLTVAIIYFHIRRKTMCGTLDYLPPEIVNYKEYDEKIDHWMTGILLYEMLHGCPPFERANKQETYAAIRGNTIKFRSDIVLEARDLITRI-----LKLRATERLSFPEIQ 281          

HSP 3 Score: 65.855 bits (159), Expect = 1.010e-11
Identity = 30/39 (76.92%), Postives = 35/39 (89.74%), Query Frame = 1
Query:  952 QILKLKSVERLTFVAIQNHPWMLRNVSKVELKKMRPDQK 1068
            +ILKL++ ERL+F  IQNHPWML+ VSKVELKKMRPDQK
Sbjct:  265 RILKLRATERLSFPEIQNHPWMLKYVSKVELKKMRPDQK 303          
BLAST of Aurora kinase vs. Planmine SMEST
Match: SMESG000004605.1 (SMESG000004605.1)

HSP 1 Score: 153.295 bits (386), Expect = 4.418e-72
Identity = 71/100 (71.00%), Postives = 86/100 (86.00%), Query Frame = 3
Query:  669 IRRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRV*MVVLIAVKLNDHVSDPKIK 968
            ++RKT+CGTLDYLPPE+VN KEYDEKIDHWMTGILLYEMLHG PPFE+A KQETYAAIR N+I+FRSDIVLEARDLITR+     + ++  + +S P+I+
Sbjct:  129 MKRKTMCGTLDYLPPEIVNYKEYDEKIDHWMTGILLYEMLHGCPPFERANKQETYAAIRGNTIKFRSDIVLEARDLITRI-----LKLRATERLSFPEIQ 223          

HSP 2 Score: 138.272 bits (347), Expect = 4.418e-72
Identity = 90/188 (47.87%), Postives = 103/188 (54.79%), Query Frame = 1
Query:   67 MFYPDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 630
            MFYPDV SKSDQTETKKDNTEKKSNK                                 FV  L+I+ K +L+  ++    L++ D                      V + L    FG ++     K+ F  + A  YLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK
Sbjct:    1 MFYPDVDSKSDQTETKKDNTEKKSNK---------------------------------FVLFLEII-KFKLSLRDIPISKLKDFD----------------------VGMPLGTGKFGHVYLAKTVKEGF--VCALKYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMK 130          

HSP 3 Score: 67.0106 bits (162), Expect = 2.263e-12
Identity = 30/42 (71.43%), Postives = 37/42 (88.10%), Query Frame = 1
Query:  943 IMFQILKLKSVERLTFVAIQNHPWMLRNVSKVELKKMRPDQK 1068
            ++ +ILKL++ ERL+F  IQNHPWML+ VSKVELKKMRPDQK
Sbjct:  204 LITRILKLRATERLSFPEIQNHPWMLKYVSKVELKKMRPDQK 245          
The following BLAST results are available for this feature:
BLAST of Aurora kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AURKC2.272e-7448.60aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC3.548e-7449.71aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC6.543e-7450.00aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC3.144e-7355.19aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC1.059e-7156.00aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
air-21.953e-6954.39Aurora/IPL1-related protein kinase 2 [Source:UniP... [more]
air-13.524e-5152.63Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-13.524e-5152.63Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
par-16.240e-3640.12Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-11.487e-3539.78Serine/threonine-protein kinase par-1 [Source:Uni... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurA1.084e-5948.62gene:FBgn0000147 transcript:FBtr0082483[more]
aurB4.297e-5949.67gene:FBgn0024227 transcript:FBtr0080180[more]
par-12.293e-3545.00gene:FBgn0260934 transcript:FBtr0100390[more]
par-12.370e-3545.00gene:FBgn0260934 transcript:FBtr0330243[more]
par-12.511e-3545.00gene:FBgn0260934 transcript:FBtr0301505[more]
back to top
BLAST of Aurora kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka1.326e-6955.92aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
aurkb7.243e-6953.61aurora kinase B [Source:NCBI gene;Acc:791894][more]
aurka1.493e-5755.92aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
mark2a4.171e-3545.71MAP/microtubule affinity-regulating kinase 2a [Sou... [more]
mark2a4.239e-3545.71MAP/microtubule affinity-regulating kinase 2a [Sou... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb392.276e-7056.58zinc finger and BTB domain containing 39 [Source:X... [more]
aurkb5.354e-6854.49aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb6.865e-6855.19aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb7.520e-6854.49aurora kinase B [Source:NCBI gene;Acc:549613][more]
ovch14.647e-3739.87ovochymase 1 [Source:Xenbase;Acc:XB-GENE-6449526][more]
back to top
BLAST of Aurora kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aurka4.802e-7357.89aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurka4.802e-7357.89aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurka6.843e-7357.89aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurkb1.521e-6946.23aurora kinase B [Source:MGI Symbol;Acc:MGI:107168][more]
Aurkb1.521e-6946.23aurora kinase B [Source:MGI Symbol;Acc:MGI:107168][more]
back to top
BLAST of Aurora kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UQB9|AURKC_HUMAN9.955e-7448.60Aurora kinase C OS=Homo sapiens OX=9606 GN=AURKC P... [more]
sp|P97477|AURKA_MOUSE2.904e-7257.89Aurora kinase A OS=Mus musculus OX=10090 GN=Aurka ... [more]
sp|P59241|AURKA_RAT1.786e-7149.72Aurora kinase A OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|Q7YRC6|AURKB_BOVIN1.038e-7055.19Aurora kinase B OS=Bos taurus OX=9913 GN=AURKB PE=... [more]
sp|Q2TA06|AURKA_BOVIN1.163e-6951.63Aurora kinase A OS=Bos taurus OX=9913 GN=AURKA PE=... [more]
back to top
BLAST of Aurora kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UPW94.479e-8165.43Protein kinase domain-containing protein OS=Mesoce... [more]
A0A0R3TJZ04.242e-7958.70Protein kinase domain-containing protein OS=Rodent... [more]
A0A0R3SFI42.912e-7861.90Protein kinase domain-containing protein OS=Hymeno... [more]
A0A0R3WIT29.952e-7862.50Protein kinase domain-containing protein OS=Hydati... [more]
A0A0R3WCU92.719e-7764.15Protein kinase domain-containing protein OS=Taenia... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurkb3.670e-6753.21aurora kinase B [Source:NCBI gene;Acc:103024192][more]
aurkb5.558e-6753.21aurora kinase B [Source:NCBI gene;Acc:103024192][more]
aurka6.652e-6749.19aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
aurka4.561e-6655.92aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
prkx2.123e-3532.89protein kinase X-linked [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka2.138e-6457.24aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
ENSPMAT00000006410.18.894e-3745.71pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
MARK31.793e-3545.00microtubule affinity regulating kinase 3 [Source:H... [more]
MARK31.720e-3445.00microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000002824.13.693e-3238.79pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
IPL11.695e-5949.07Aurora kinase of chromosomal passenger complex; me... [more]
TPK11.738e-3832.91cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK33.841e-3834.90cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK22.350e-3632.89cAMP-dependent protein kinase catalytic subunit; p... [more]
PKH22.357e-3233.33Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354371.327e-6955.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352283.328e-3735.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307687.852e-3748.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378001.093e-3230.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384073.278e-3234.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aurora kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka1.518e-6952.49aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurka2.708e-6952.49aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurkb5.350e-6957.69aurora kinase B [Source:NCBI gene;Acc:100301584][more]
aurkb7.039e-6957.69aurora kinase B [Source:NCBI gene;Acc:100301584][more]
aurka7.152e-6857.24aurora kinase A [Source:NCBI gene;Acc:101165631][more]
back to top
BLAST of Aurora kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016505.11.029e-15692.55SMESG000016505.1[more]
SMESG000016545.11.793e-15392.23SMESG000016545.1[more]
SMESG000004605.11.523e-14492.12SMESG000004605.1[more]
SMESG000004605.17.851e-13489.54SMESG000004605.1[more]
SMESG000004605.14.418e-7271.00SMESG000004605.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025661 ID=SMED30025661|Name=Aurora kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1400bp
TTAGATTCTTCTTGAGTTCTGCAAAAAATTAAACTGGCCATAATATTTGA
TTTTAAAATTTTTACAATGTTTTATCCAGACGTTGTTTCTAAAAGTGATC
AAACTGAAACTAAAAAAGATAATACTGAAAAGAAATCCAATAAAGACATT
CCGATATCAAAATTAAAGGATTTCGATGTCGGTATGCCACTGGGTACTGG
TAAATTTGGCCATGTATATCTGGCCAAAACTGTTAAAGAGGGATTTGTCT
GTGCCCTTAAGATCATGTTTAAATCACAATTAACTCGACATAATTTGGAG
CATCAATTCCTACGTGAAATCGATATTATGGTTCATTTAGATCATCCAAA
CATATTGAAACTTTATACCTGGTTTCACGATGAAAAACATGTATATTTAG
TTTTAGAATACGCCTGGTTTGGACAGATGTTTACAATTTTACAGAAAAAA
CAACGATTTACAGACATAGAAGCAGCTACGTATTTGCATCAATTGTGTGA
TGCTTTGAGTTACTGTCACCAGAAAGGTGTGATCCATCGAGATATTAAAC
CAGAAAATCTTCTCATTAGTCTCGATATGGAATTGAAACTGGCAGATTTC
GGCTGGTCTATTCACACAAATTTAATGAAGTACGACATCATTTGACAGTT
GCAATCATTTATTTTCATATAAGGAGAAAAACTTTGTGTGGAACTTTAGA
TTATTTGCCACCCGAAATGGTAAATTCCAAAGAGTATGATGAGAAAATCG
ACCATTGGATGACTGGAATTTTGCTTTATGAAATGTTGCACGGTTTCCCG
CCTTTTGAAAAGGCAAAGAAACAAGAAACTTATGCTGCTATCCGAGCCAA
TTCCATTGAATTTAGAAGCGATATTGTTTTAGAAGCCAGAGATTTAATTA
CAAGGGTTTGAATGGTAGTTTTGATTGCAGTTAAATTGAATGATCATGTT
TCAGATCCTAAAATTAAAATCAGTTGAACGTCTAACATTTGTAGCGATTC
AAAATCATCCTTGGATGTTAAGGAATGTTTCGAAAGTAGAATTGAAAAAG
ATGCGCCCTGATCAGAAATAAAAATTACTTTGTGTTTCTATTTAAAATAA
AATAATGTTGATATAAAATTGACTAGTGCTTTTCATTTATACATAAAATT
AAATATTAGCGACACTCATTCAGAAATTATAAACGAAAGTTTTAGTAGTA
CCGTAAAACTACAAACTACTTACAAAGATTATACTTAAACTAGCCAAAAT
ACGTAGATAAATTATTCTTTTCCAATGTTAATACAATAAGCTAAAATCAC
TTTCGAATTAGATCACAAAATCAGCGAACTAATGAAAATTATCACAATAA
AACATTATTTAAAGTCTTGCACCTGGATAAAAGTGGGGGTGCTTTTAATA
back to top

protein sequence of SMED30025661-orf-1

>SMED30025661-orf-1 ID=SMED30025661-orf-1|Name=SMED30025661-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MFYPDVVSKSDQTETKKDNTEKKSNKDIPISKLKDFDVGMPLGTGKFGHV
YLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLY
TWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYC
HQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMKYDII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000775chromosome, centromeric region
GO:0005634nucleus
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005856cytoskeleton
GO:0030496midbody
GO:0032133chromosome passenger complex
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0051301cell division
GO:0051321meiotic cell cycle
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0016310phosphorylation
GO:0031577spindle checkpoint
GO:0032467positive regulation of cytokinesis
GO:0043988histone H3-S28 phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000419prepharyngeal region
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR030616Aur
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 40..196
e-value: 6.0E-14
score: 62.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 43..188
e-value: 3.2E-43
score: 148.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 40..196
score: 31.043
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 124..189
e-value: 3.4E-23
score: 83.0
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 24..123
e-value: 7.8E-32
score: 111.1
NoneNo IPR availablePANTHERPTHR24350:SF0AURORA Acoord: 14..189
IPR030616Aurora kinasePANTHERPTHR24350SERINE/THREONINE-PROTEIN KINASE IAL-RELATEDcoord: 14..189
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 159..171
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 46..69
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 29..188