pi3k-like protein

Overview
Namepi3k-like protein (ACT98281.1)
Smed IDSMED30025635
Length (bp)3274
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of pi3k-like protein (SMED30025635) t-SNE clustered cells

Violin plots show distribution of expression levels for pi3k-like protein (SMED30025635) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of pi3k-like protein (SMED30025635) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for pi3k-like protein (SMED30025635) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025635

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30025635h1SMcG0013438 dd_Smed_v4_8025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025635h1SMcG0013438 dd_Smed_v4_8025_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of pi3k-like protein vs. Ensembl Human
Match: PIK3CA (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:8975])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 378/1054 (35.86%), Postives = 577/1054 (54.74%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   +++  LL + SSYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + ++ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           +KAI  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ--LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. Ensembl Human
Match: PIK3CA (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:8975])

HSP 1 Score: 519.235 bits (1336), Expect = 1.150e-166
Identity = 342/982 (34.83%), Postives = 522/982 (53.16%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAY 2999
            + V  LLPN  +      R+A+L  IK  L KE +   +++  LL + SSYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + ++ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           +KAI  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+    +  K  EF    G+ +
Sbjct:   20 ILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ--LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQ---ECTKTREFESSQGECF 985          
BLAST of pi3k-like protein vs. Ensembl Human
Match: PIK3CB (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:8976])

HSP 1 Score: 464.922 bits (1195), Expect = 1.345e-149
Identity = 271/706 (38.39%), Postives = 406/706 (57.51%), Query Frame = 3
Query: 1197 VRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-------------------KTERGGNEVL--LGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSINI---SKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWV-PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY----LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            VR  +F+G          S +   +   WNE L FDI   ++PR A+LCF++                     +T R   +V   + W N  +F++ G+L  G I L+ W     +     NP G+  T+ Y   N+  L +      K  YYY      R  G      +  +K I+DRD L +L E ++D + +  ++C  + P+SLP+L  SI+WN + +V    +LL  WP++    +L+LL  N+ D+ +R++AV  LR  +++ +++ YLLQLVQ LKYE +    LS FLL+ AL N+++GQ  FW L+SE+H  ++ + F ++LEA+CRG +  M V+  Q   + KL  ++ ++K     L  +  KE     LK   + E   ++ S LN       + VE C    SK +P++L + N  +F E S+     IFK GDDLRQD+LTLQ+L + D +WK    D+++LPYGCLATG  SG+IE V  ++T+  IQ   SN+ AA   N  +L  W++  N + +   +A+E FT SCAGY VA+++LGI DRH DNIMV   GQLFHIDFGHIL N K KFG+ RERVPF+LT DFI  I  G  +  ++ KF  F   C  AYL LR H +L +TL+++M+ +GLPELT V+D++YL+ +L++   E+ AL  F ++F +A R +WTTK++W++H
Sbjct:    2 VRAGLFHGTELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPY-TENATALHVKFPENKKQPYYYPPFDKSR--GG--KKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQ-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYNNK-VFGEDSVGV---IFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYN-SGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQG--KTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAH 694          
BLAST of pi3k-like protein vs. Ensembl Human
Match: PIK3CB (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:8976])

HSP 1 Score: 473.781 bits (1218), Expect = 1.096e-148
Identity = 293/815 (35.95%), Postives = 451/815 (55.34%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFP---------ILSLYPREYLE-NISINRFI--IPPYFYQNIPQTKRRTRQDSV----SKMFSLLLISA-QLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-------------------KTERGGNEV--LLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSINIS---KVNYYYQE-----QSPVRIMGSPISTTIQR--------IKAIIDRDWLYELSEQDIDYLRSNLENCLWV-PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY----LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I + Y+++C+ N   P         I  +Y +E +    +INR    +P      +P   ++TR  S     +  F ++L+   +L  +E  K++VR  +F+G          S +   +   WNE L FDI   ++PR A+LCF++                     +T R   +V   + W N  +F++ G+L  G I L+ W     +     NP G+  T+ Y   N+  L +      K  YYY       +    I  S  +    R        +K I+DRD L +L E ++D + +  ++C  + P+SLP+L  SI+WN + +V    +LL  WP++    +L+LL  N+ D+ +R++AV  LR  +++ +++ YLLQLVQ LKYE +    LS FLL+ AL N+++GQ  FW L+SE+H  ++ + F ++LEA+CRG +  M V+  Q   + KL  ++ ++K     L  +  KE     LK   + E   ++ S LN       + VE C    SK +P++L + N  +F E S+     IFK GDDLRQD+LTLQ+L + D +WK    D+++LPYGCLATG  SG+IE V  ++T+  IQ   SN+ AA   N  +L  W++  N + +   +A+E FT SCAGY VA+++LGI DRH DNIMV   GQLFHIDFGHIL N K KFG+ RERVPF+LT DFI  I  G  +  ++ KF  F   C  AYL LR H +L +TL+++M+ +GLPELT V+D++YL+ +L++   E+ AL  F ++F +A R +WTTK++W++H
Sbjct:  263 LIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLP------LPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPY-TENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQ-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYNNK-VFGEDSV---GVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYN-SGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQG--KTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAH 1062          
BLAST of pi3k-like protein vs. Ensembl Human
Match: PIK3CB (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:8976])

HSP 1 Score: 473.781 bits (1218), Expect = 1.096e-148
Identity = 293/815 (35.95%), Postives = 451/815 (55.34%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFP---------ILSLYPREYLE-NISINRFI--IPPYFYQNIPQTKRRTRQDSV----SKMFSLLLISA-QLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-------------------KTERGGNEV--LLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSINIS---KVNYYYQE-----QSPVRIMGSPISTTIQR--------IKAIIDRDWLYELSEQDIDYLRSNLENCLWV-PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY----LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I + Y+++C+ N   P         I  +Y +E +    +INR    +P      +P   ++TR  S     +  F ++L+   +L  +E  K++VR  +F+G          S +   +   WNE L FDI   ++PR A+LCF++                     +T R   +V   + W N  +F++ G+L  G I L+ W     +     NP G+  T+ Y   N+  L +      K  YYY       +    I  S  +    R        +K I+DRD L +L E ++D + +  ++C  + P+SLP+L  SI+WN + +V    +LL  WP++    +L+LL  N+ D+ +R++AV  LR  +++ +++ YLLQLVQ LKYE +    LS FLL+ AL N+++GQ  FW L+SE+H  ++ + F ++LEA+CRG +  M V+  Q   + KL  ++ ++K     L  +  KE     LK   + E   ++ S LN       + VE C    SK +P++L + N  +F E S+     IFK GDDLRQD+LTLQ+L + D +WK    D+++LPYGCLATG  SG+IE V  ++T+  IQ   SN+ AA   N  +L  W++  N + +   +A+E FT SCAGY VA+++LGI DRH DNIMV   GQLFHIDFGHIL N K KFG+ RERVPF+LT DFI  I  G  +  ++ KF  F   C  AYL LR H +L +TL+++M+ +GLPELT V+D++YL+ +L++   E+ AL  F ++F +A R +WTTK++W++H
Sbjct:  263 LIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLP------LPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPY-TENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQ-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYNNK-VFGEDSV---GVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYN-SGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQG--KTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAH 1062          
BLAST of pi3k-like protein vs. Ensembl Celegans
Match: age-1 (Phosphatidylinositol 3-kinase age-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94125])

HSP 1 Score: 325.865 bits (834), Expect = 6.962e-94
Identity = 215/736 (29.21%), Postives = 371/736 (50.41%), Query Frame = 3
Query: 1191 LYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKL-NFDIYYSNIPRNAKLCFSLI-EKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQ------------SPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWV---------PESLPRLAK-SIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSE--------MHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNII---AAMQMNSSSLYRWIQA-------------------------NNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEK-AALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +YVR+     + T     + ++ V++    WN+++  FD+Y  ++P +A L   ++  K +    E  +GW N+++ ++  +L +G    +LW  E   +       G+        ++ +S    +V    Q Q              + IMG    + I R         L +  E  I  L  + +  +W+         P+ L  L++ +  W +    +  Y +L KW   ++ ++L LL     D+V+R+FAV+ L   L+    +L++L L+QALKYE    +++ + LL  AL + ++G + FW L++E        + +E  +   +L++EA+ RG    + +I  Q   +++L  IS ++K   +D+    L++ L++   +   +N+ S L+   K G +I++   V  S KRP+ L W+N +  S+  +P    IFK GDDLRQD+L LQ+L + D IWK    D  L PY  L  G+  GIIE V + KT+  IQ        A   ++ S + +WI+                          N +  +++ ++++ F  SC GYSVAT+I+GI+DRH DN+M+   G+ FHIDFGHIL + K K G+ R+R PF+LTE F+  I  G     +S +  +F  LC +AY  +  +  L ++L+++M+   LPEL+   DL++L+KTL    + K  A  +F   + +A+ G+W+TK +WL H
Sbjct:  447 MYVRIEFSVYVGTLTLASKSTTKVNAQFAKWNKEMYTFDLYMKDMPPSAVLSIRVLYGKVKLKSEEFEVGWVNMSLTDWRDELRQGQFLFHLWAPEPTANRSRIGENGARIGTNAAVTIEISSYGGRVRMPSQGQYTYLVKHRSTWTETLNIMGDDYESCI-RDPGYKKLQMLVKKHESGI-VLEEDEQRHVWMWRRYIQKQEPDLLIVLSELAFVWTDRENFSELYVMLEKWKPPSVAAALTLLGKRCTDRVIRKFAVEKLNEQLSPVTFHLFILPLIQALKYEPRAQSEVGMMLLTRALCDYRIGHRLFWLLRAEIARLRDCDLKSEEYR-RISLLMEAYLRGNEEHIKIITRQVDMVDELTRISTLVKGMPKDVATMKLRDELRS--ISHKMENMDSPLDPVYKLGEMIIDKAIVLGSAKRPLMLHWKNKNPKSDLHLPFCAMIFKNGDDLRQDMLVLQVLEVMDNIWKAANIDCCLNPYAVLPMGEMIGIIEVVPNCKTIFEIQVGTGFMNTAVRSIDPSFMNKWIRKQCGIEDEKKKSKKDSTKNPIEKKIDNTQAMKKYFESVDRFLYSCVGYSVATYIMGIKDRHSDNLMLTEDGKYFHIDFGHILGHGKTKLGIQRDRQPFILTEHFMTVIRSGKSVDGNSHELQKFKTLCVEAYEVMWNNRDLFVSLFTLMLGMELPELSTKADLDHLKKTLFCNGESKEEARKFFAGIYEEAFNGSWSTKTNWLFH 1177          
BLAST of pi3k-like protein vs. Ensembl Celegans
Match: piki-1 (Phosphatidylinositol 3-kinase piki-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDY0])

HSP 1 Score: 172.555 bits (436), Expect = 2.949e-43
Identity = 176/753 (23.37%), Postives = 344/753 (45.68%), Query Frame = 3
Query: 1014 LSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQK-SSLVSSDHPTWNEKLNFDIY-------YSNIPRNAKLCFSL---IEKTERGGNE-----VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNS--VILSINISKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSE-QDIDYLRSNLENCLWV--------PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLY--LLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIK-IYFALMLEAFCRGYL------NFMTVIRPQSIGIEKLVEISRILKAQREDLQ---LSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNE-FMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVE-SDEKAALNY 3149
            L LY R      +++R+ IPP      P+ +  ++ D +  M + +    +    + S+ Y+ + +++G         K    + +DH  +  ++  D+Y           PR  ++  S+   +  + +  NE     V+LG+ ++ +++    + +G + L   P   ++      P G     K+     +I+S  I     Y+     V I    I      +  I  +++L EL E QD   L ++ ++ +W         PE+LP +  S++  +   V   Y +L +W  +  E +++ L   + D+ +R  AV++L    T+    LY  + Q ++AL++E Y  + L+ F+L+ +  +     + +W L+  + + ++  + +A+  +   +  +      N  T I+ Q   + +L  I   L+++  D +   L  L+  L   D       V   +  +     + +E C V  S  +P+ + +   ++   +SI     I K  DD+RQD   +++L+  D IWK    D++++ +  +  G   G+ E V +  T+M IQ+   +  + +N   L +W+  +N     + +A E F RSCAG+ + T++LGI DRH DNI+    G +FHIDFG  + + +   G  R+RVPFV T +    I +G        ++N+ F+  C KA+  LR + + +  L  IM  S +P +  +  L ++   L ++ SD  A + +
Sbjct:  569 LELYCR-----CTVSRYNIPPLQIITKPKVEVLSKMDFLQIMLNSVHSIPEHWQSQYSEFYMSLDLYHGTQVLDGFSNKVPKTIKNDH--FFPRIPLDLYAKFKRLNLCQYPRETRIVVSISGTVRNSAQAANEYNPDIVMLGYCSVPLYDENLFMRQGPLFL---PLTLLKKQPMLKPFGPYPYIKDARDPILIMSFKIWDTEIYFPN---VVIDMQCIPQDFATLD-IETQEYLLELIENQDTSTLETDDQDLIWQKRLHLTNQPEALPLVLSSLQDWSFGFVMRVYQILEEWAPLRPEIAMEFLLPKYPDERIRAHAVQSLARGSTDF---LYHTIPQFIEALRFELYEKSALADFILELSFVSLDFTFEIYWQLQQRVDHCAVDDLPYAIRCQNLQQKMIDEHENPNLKTDIKLQHELLNELDSIQDDLRSKSGDSEIERLHRLRTRLGILDSKLLQNKVRLPICPAFDCTGVRIEECSVFNSNAKPLKIVFRGLNM--NYSI-----IHKRDDDMRQDAFVMKMLNEMDRIWKSNGLDLRMITFRIMPVGYRRGMGELVLNCATLMEIQKEEGLRGV-LNDEILRKWLMKHNSDEFAYKEAQENFIRSCAGWCIVTYVLGIGDRHNDNILFTKNGHVFHIDFGKYMGDWQMAAGFRRDRVPFVFTTEMFHVINNGR----APTQYNQKFIDYCCKAFNHLRRNKNTLTNLLRIMACSDIPGIN-MDSLAFVENNLMLDLSDTDATVQF 1291          
BLAST of pi3k-like protein vs. Ensembl Celegans
Match: vps-34 (Phosphatidylinositol 3-kinase catalytic subunit type 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXI7])

HSP 1 Score: 166.007 bits (419), Expect = 2.225e-42
Identity = 147/548 (26.82%), Postives = 248/548 (45.26%), Query Frame = 3
Query: 1731 PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYES-----------------------------------------------YYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHN------ESIKIYFAL---MLEAFCRGYLNFMTV--IRPQSIGIEKLVEISRILKAQREDLQLSTLKEY---LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWE--------NADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLR--KTLSVE-SDEKAALNYFNR 3158
            P++L +  +S+ W +  EV    +L++ W  I  E +L+LLS  F    +R ++V  L    +   + LYL QLVQALKYE                                                    DL+ FL+  AL + ++    +W LK+E+ +      E  K+Y  +   ++EA  +       V  +  Q I +E L+ +    KA+   L  S   E+   L         K V   L+ S +  ++I +T    KS+  P  + ++        + +I  E+++     IFK GDDLRQD L  Q++ + D I K+   D+KL PY  L+TG   G ++ +K +K + +IQ       M     ++ + ++  +         ++ + RS AGYSV  +ILG+ DRH DN+++   G+LFH+DFG IL    K            LT + ++ +       + S +F EF+     AY  LR HS+++L L+S+M+D+G+P++    D    +  + L ++ SDE A  + F +
Sbjct:   96 PKALNKYLRSVNWVHPQEVKTALALMNDWELIEAEDALELLSSAFTHPAVRAYSVSRLLEAASPEQVLLYLPQLVQALKYEQGQQLPEEGNPVPVVSEEEGKIPSVATTPTEELEGRDMTVVTKKEARKAASGDLATFLIDYALASPKVSNYLYWHLKTEIESTKESKEEHSKMYQNIQDRLMEALVKRPDTRAQVDSLHQQQIFVEDLIILMNEAKARGGRLNESKSAEFRTMLSRAKHMLDLKGVHLPLDPSFRLSSVIPDTASFFKSEMMPAKISFKVLQPNGKADRNIPEEYTV-----IFKTGDDLRQDQLIQQMVRLIDIILKKGQLDLKLTPYLVLSTGVGQGFVQCIK-SKPLRAIQEQYKAHKMDCIREAM-KELRPGDGPFGIEPNVIDNYVRSLAGYSVIMYILGLGDRHLDNLLLCENGKLFHVDFGFILGRDPKPMPPP-----MKLTSEMVQVMGG-----VKSKQFLEFVQHVDSAYRILRRHSNVLLNLFSLMLDAGIPDIAAEPDKAIFKIEQRLRLDLSDEAATKHIFTQ 626          
BLAST of pi3k-like protein vs. Ensembl Celegans
Match: vps-34 (Phosphatidylinositol 3-kinase catalytic subunit type 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXI7])

HSP 1 Score: 166.777 bits (421), Expect = 7.685e-42
Identity = 147/548 (26.82%), Postives = 248/548 (45.26%), Query Frame = 3
Query: 1731 PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYES-----------------------------------------------YYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHN------ESIKIYFAL---MLEAFCRGYLNFMTV--IRPQSIGIEKLVEISRILKAQREDLQLSTLKEY---LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWE--------NADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLR--KTLSVE-SDEKAALNYFNR 3158
            P++L +  +S+ W +  EV    +L++ W  I  E +L+LLS  F    +R ++V  L    +   + LYL QLVQALKYE                                                    DL+ FL+  AL + ++    +W LK+E+ +      E  K+Y  +   ++EA  +       V  +  Q I +E L+ +    KA+   L  S   E+   L         K V   L+ S +  ++I +T    KS+  P  + ++        + +I  E+++     IFK GDDLRQD L  Q++ + D I K+   D+KL PY  L+TG   G ++ +K +K + +IQ       M     ++ + ++  +         ++ + RS AGYSV  +ILG+ DRH DN+++   G+LFH+DFG IL    K            LT + ++ +       + S +F EF+     AY  LR HS+++L L+S+M+D+G+P++    D    +  + L ++ SDE A  + F +
Sbjct:  347 PKALNKYLRSVNWVHPQEVKTALALMNDWELIEAEDALELLSSAFTHPAVRAYSVSRLLEAASPEQVLLYLPQLVQALKYEQGQQLPEEGNPVPVVSEEEGKIPSVATTPTEELEGRDMTVVTKKEARKAASGDLATFLIDYALASPKVSNYLYWHLKTEIESTKESKEEHSKMYQNIQDRLMEALVKRPDTRAQVDSLHQQQIFVEDLIILMNEAKARGGRLNESKSAEFRTMLSRAKHMLDLKGVHLPLDPSFRLSSVIPDTASFFKSEMMPAKISFKVLQPNGKADRNIPEEYTV-----IFKTGDDLRQDQLIQQMVRLIDIILKKGQLDLKLTPYLVLSTGVGQGFVQCIK-SKPLRAIQEQYKAHKMDCIREAM-KELRPGDGPFGIEPNVIDNYVRSLAGYSVIMYILGLGDRHLDNLLLCENGKLFHVDFGFILGRDPKPMPPP-----MKLTSEMVQVMGG-----VKSKQFLEFVQHVDSAYRILRRHSNVLLNLFSLMLDAGIPDIAAEPDKAIFKIEQRLRLDLSDEAATKHIFTQ 877          
BLAST of pi3k-like protein vs. Ensembl Celegans
Match: vps-34 (Phosphatidylinositol 3-kinase catalytic subunit type 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXI7])

HSP 1 Score: 166.392 bits (420), Expect = 8.184e-42
Identity = 147/548 (26.82%), Postives = 248/548 (45.26%), Query Frame = 3
Query: 1731 PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYES-----------------------------------------------YYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHN------ESIKIYFAL---MLEAFCRGYLNFMTV--IRPQSIGIEKLVEISRILKAQREDLQLSTLKEY---LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWE--------NADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLR--KTLSVE-SDEKAALNYFNR 3158
            P++L +  +S+ W +  EV    +L++ W  I  E +L+LLS  F    +R ++V  L    +   + LYL QLVQALKYE                                                    DL+ FL+  AL + ++    +W LK+E+ +      E  K+Y  +   ++EA  +       V  +  Q I +E L+ +    KA+   L  S   E+   L         K V   L+ S +  ++I +T    KS+  P  + ++        + +I  E+++     IFK GDDLRQD L  Q++ + D I K+   D+KL PY  L+TG   G ++ +K +K + +IQ       M     ++ + ++  +         ++ + RS AGYSV  +ILG+ DRH DN+++   G+LFH+DFG IL    K            LT + ++ +       + S +F EF+     AY  LR HS+++L L+S+M+D+G+P++    D    +  + L ++ SDE A  + F +
Sbjct:  343 PKALNKYLRSVNWVHPQEVKTALALMNDWELIEAEDALELLSSAFTHPAVRAYSVSRLLEAASPEQVLLYLPQLVQALKYEQGQQLPEEGNPVPVVSEEEGKIPSVATTPTEELEGRDMTVVTKKEARKAASGDLATFLIDYALASPKVSNYLYWHLKTEIESTKESKEEHSKMYQNIQDRLMEALVKRPDTRAQVDSLHQQQIFVEDLIILMNEAKARGGRLNESKSAEFRTMLSRAKHMLDLKGVHLPLDPSFRLSSVIPDTASFFKSEMMPAKISFKVLQPNGKADRNIPEEYTV-----IFKTGDDLRQDQLIQQMVRLIDIILKKGQLDLKLTPYLVLSTGVGQGFVQCIK-SKPLRAIQEQYKAHKMDCIREAM-KELRPGDGPFGIEPNVIDNYVRSLAGYSVIMYILGLGDRHLDNLLLCENGKLFHVDFGFILGRDPKPMPPP-----MKLTSEMVQVMGG-----VKSKQFLEFVQHVDSAYRILRRHSNVLLNLFSLMLDAGIPDIAAEPDKAIFKIEQRLRLDLSDEAATKHIFTQ 873          
BLAST of pi3k-like protein vs. Ensembl Fly
Match: Pi3K92E (gene:FBgn0015279 transcript:FBtr0083940)

HSP 1 Score: 416.001 bits (1068), Expect = 3.738e-127
Identity = 262/728 (35.99%), Postives = 401/728 (55.08%), Query Frame = 3
Query: 1188 KLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEK--------LNFDIYYSNIPRNAKLCFSLIEKTERGG-----------------NEVLLGWANINIFNYFGKLIEGSIDLNLWPF-EKIQDNGYFNPGGSTDSYKNRNS------VILSINISKVNY--------YYQEQSPV----RIMGSPISTTIQRIKAIIDR----DWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNII--AAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADG-SDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            K+ V V +++G     A        S+D P  N          ++FDI   N+PR  +LC  + E T+                    N+  L W N  IF++   L  G   L  W + + IQ    F+P G+ +    +          LS     V Y        Y  ++  V    R +  P    I+ +K ++      D +YE+ +QD + +     + L  +PE L  L   + W    +V   + LL +WP I++E SL+LL   + D  +R+FA++ L   L + D+ LYLLQLVQA+K+ESY  +DL VFLL+ ALRN+++G  FFW L+SEM   S++  F L+LE + +G  + +  +R Q   +EKL + S I K   ++   + L+++L++   +   +N+ + LN S +   +  + C V  SK RP+++ +ENAD+    +   +  IFK GDDLRQD+LTLQ+L + D +WKR   D ++  Y C++  K  G+IE V+ A+T+ +IQ+   +  A       SL  W++ +N+  ++  KA+  FT SCAGY VAT++LG+ DRH DNIMV   GQLFHIDFGHIL + K+K GV RERVPFVLT DF+  I  G +DR  +S +F  F  LC +A+L LR+H  LIL+L+S+MI +GLPEL+  +DL+YLR+TL ++  E+ A  +F  +F +A   +W T ++W SH
Sbjct:  367 KVGVHVCLYHGDKKLCAQR------STDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLCIVIFEVTKMSRSKKSSNNKDIALKDVPYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYADDIQSVEVFHPLGTIEPNPRKEECALVDLTFLSSGTGTVRYPSEEVVLQYAADREQVNRLQRQLAGP-EKPIKELKELMANYTGLDKIYEMVDQDRNAIWERRNDILRELPEELSILLHCVYWKERDDVADMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLH-FLKDEDLLLYLLQLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLKGCKHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSAVFQNIQNPLNPSFRCSGVTPDRCKVMDSKMRPLWVVFENADV----NASDVHIIFKNGDDLRQDMLTLQMLRVMDQLWKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSWLKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKEKLGVRRERVPFVLTHDFVYVINKGFNDR--ESKEFCHFQELCERAFLVLRKHGCLILSLFSMMISTGLPELSSEKDLDYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASH 1080          
BLAST of pi3k-like protein vs. Ensembl Fly
Match: Pi3K92E (gene:FBgn0015279 transcript:FBtr0083941)

HSP 1 Score: 416.001 bits (1068), Expect = 3.738e-127
Identity = 262/728 (35.99%), Postives = 401/728 (55.08%), Query Frame = 3
Query: 1188 KLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEK--------LNFDIYYSNIPRNAKLCFSLIEKTERGG-----------------NEVLLGWANINIFNYFGKLIEGSIDLNLWPF-EKIQDNGYFNPGGSTDSYKNRNS------VILSINISKVNY--------YYQEQSPV----RIMGSPISTTIQRIKAIIDR----DWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNII--AAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADG-SDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            K+ V V +++G     A        S+D P  N          ++FDI   N+PR  +LC  + E T+                    N+  L W N  IF++   L  G   L  W + + IQ    F+P G+ +    +          LS     V Y        Y  ++  V    R +  P    I+ +K ++      D +YE+ +QD + +     + L  +PE L  L   + W    +V   + LL +WP I++E SL+LL   + D  +R+FA++ L   L + D+ LYLLQLVQA+K+ESY  +DL VFLL+ ALRN+++G  FFW L+SEM   S++  F L+LE + +G  + +  +R Q   +EKL + S I K   ++   + L+++L++   +   +N+ + LN S +   +  + C V  SK RP+++ +ENAD+    +   +  IFK GDDLRQD+LTLQ+L + D +WKR   D ++  Y C++  K  G+IE V+ A+T+ +IQ+   +  A       SL  W++ +N+  ++  KA+  FT SCAGY VAT++LG+ DRH DNIMV   GQLFHIDFGHIL + K+K GV RERVPFVLT DF+  I  G +DR  +S +F  F  LC +A+L LR+H  LIL+L+S+MI +GLPEL+  +DL+YLR+TL ++  E+ A  +F  +F +A   +W T ++W SH
Sbjct:  367 KVGVHVCLYHGDKKLCAQR------STDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLCIVIFEVTKMSRSKKSSNNKDIALKDVPYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYADDIQSVEVFHPLGTIEPNPRKEECALVDLTFLSSGTGTVRYPSEEVVLQYAADREQVNRLQRQLAGP-EKPIKELKELMANYTGLDKIYEMVDQDRNAIWERRNDILRELPEELSILLHCVYWKERDDVADMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLH-FLKDEDLLLYLLQLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLKGCKHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSAVFQNIQNPLNPSFRCSGVTPDRCKVMDSKMRPLWVVFENADV----NASDVHIIFKNGDDLRQDMLTLQMLRVMDQLWKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSWLKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKEKLGVRRERVPFVLTHDFVYVINKGFNDR--ESKEFCHFQELCERAFLVLRKHGCLILSLFSMMISTGLPELSSEKDLDYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASH 1080          
BLAST of pi3k-like protein vs. Ensembl Fly
Match: Pi3K92E (gene:FBgn0015279 transcript:FBtr0334643)

HSP 1 Score: 416.001 bits (1068), Expect = 3.738e-127
Identity = 262/728 (35.99%), Postives = 401/728 (55.08%), Query Frame = 3
Query: 1188 KLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEK--------LNFDIYYSNIPRNAKLCFSLIEKTERGG-----------------NEVLLGWANINIFNYFGKLIEGSIDLNLWPF-EKIQDNGYFNPGGSTDSYKNRNS------VILSINISKVNY--------YYQEQSPV----RIMGSPISTTIQRIKAIIDR----DWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNII--AAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADG-SDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            K+ V V +++G     A        S+D P  N          ++FDI   N+PR  +LC  + E T+                    N+  L W N  IF++   L  G   L  W + + IQ    F+P G+ +    +          LS     V Y        Y  ++  V    R +  P    I+ +K ++      D +YE+ +QD + +     + L  +PE L  L   + W    +V   + LL +WP I++E SL+LL   + D  +R+FA++ L   L + D+ LYLLQLVQA+K+ESY  +DL VFLL+ ALRN+++G  FFW L+SEM   S++  F L+LE + +G  + +  +R Q   +EKL + S I K   ++   + L+++L++   +   +N+ + LN S +   +  + C V  SK RP+++ +ENAD+    +   +  IFK GDDLRQD+LTLQ+L + D +WKR   D ++  Y C++  K  G+IE V+ A+T+ +IQ+   +  A       SL  W++ +N+  ++  KA+  FT SCAGY VAT++LG+ DRH DNIMV   GQLFHIDFGHIL + K+K GV RERVPFVLT DF+  I  G +DR  +S +F  F  LC +A+L LR+H  LIL+L+S+MI +GLPEL+  +DL+YLR+TL ++  E+ A  +F  +F +A   +W T ++W SH
Sbjct:  367 KVGVHVCLYHGDKKLCAQR------STDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLCIVIFEVTKMSRSKKSSNNKDIALKDVPYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYADDIQSVEVFHPLGTIEPNPRKEECALVDLTFLSSGTGTVRYPSEEVVLQYAADREQVNRLQRQLAGP-EKPIKELKELMANYTGLDKIYEMVDQDRNAIWERRNDILRELPEELSILLHCVYWKERDDVADMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLH-FLKDEDLLLYLLQLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLKGCKHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSAVFQNIQNPLNPSFRCSGVTPDRCKVMDSKMRPLWVVFENADV----NASDVHIIFKNGDDLRQDMLTLQMLRVMDQLWKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSWLKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKEKLGVRRERVPFVLTHDFVYVINKGFNDR--ESKEFCHFQELCERAFLVLRKHGCLILSLFSMMISTGLPELSSEKDLDYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASH 1080          
BLAST of pi3k-like protein vs. Ensembl Fly
Match: Pi3K68D (gene:FBgn0015278 transcript:FBtr0076087)

HSP 1 Score: 222.631 bits (566), Expect = 9.322e-59
Identity = 185/692 (26.73%), Postives = 324/692 (46.82%), Query Frame = 3
Query: 1293 LNFDIY-YSNIPRNAKLCFSLIEKT-------------ERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRN-SVILSINI----SKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYEL-SEQDIDYL-RSNLENCLW--------VPESLPR-LAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLE--------AFCRGYLNFMTVIRP-QSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVE-TCDVKKSKKRPIYLEWENADIFSEFSIP-----------TLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            L FD +    +PR A+L F L  K              ER      LGW +I +F++   +I G   L+LWP      +    P  +   +   +   +LSI +     ++ +   ++ P                A +D +   EL    ++ Y   +      W         P +LP+ L  +  W+    ++L ++LL  W  ++   SL+LL   + D  +R+ AV+ + + + N  +  +L QLVQ+LK+++Y  + ++ FLL   L + +     +W L   + ++      A M++           R Y     ++R   +I  EK+++  R +   R   +L+T+ E +K  +  E+ +  S    + E   +++ + TC     +     +   N   F+  ++P           +L  IFKCGDDL+QD LT+QL+ I + +W  +  D+K++ + C+ TG  SG+IE V +A+T+  IQ    +         +  W+   N +  ++  A+  FT SCAGYSVAT++LGI DRH DNIM+ T G LFHIDFG  L + +      R+R PFVLT D    I +G D+P  S  F+ F+ LC +A+  +R+++ L+L   + M  +G+P +     ++Y+R+ L        A   F +    + + +W T+ ++  H
Sbjct:  911 LTFDQHPICTLPREARLTFVLYGKQAASEGEPNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWP---PMTDKMLGPAPARGCHPQPDFCPVLSIEVPPYGGRIEFPEHQEVP--------KPAPHYDFASLDANLQEELLDTAELGYTGATERREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDL-HALLHSWAPLSPLQSLELLLPRYPDAKVREKAVEWI-SKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHMYWLLVHSLPDDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQ--RFMYQHRMCQKLTTIAESVK--EAKESMRQKSLAAGMDEVHQDLLEQPTCLPLGPELEVTGVSVRNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLKMVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTG-SFKDRPIAEWLGKQNPSPLEYQSAVRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVI-NGGDKP--STDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNS-NAVQYVRRALLPSQSNPEAAATFAKMIQSSLK-SWFTQFNFFLH 1579          
BLAST of pi3k-like protein vs. Ensembl Fly
Match: Pi3K68D (gene:FBgn0015278 transcript:FBtr0301816)

HSP 1 Score: 222.631 bits (566), Expect = 9.322e-59
Identity = 185/692 (26.73%), Postives = 324/692 (46.82%), Query Frame = 3
Query: 1293 LNFDIY-YSNIPRNAKLCFSLIEKT-------------ERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRN-SVILSINI----SKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYEL-SEQDIDYL-RSNLENCLW--------VPESLPR-LAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLE--------AFCRGYLNFMTVIRP-QSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVE-TCDVKKSKKRPIYLEWENADIFSEFSIP-----------TLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            L FD +    +PR A+L F L  K              ER      LGW +I +F++   +I G   L+LWP      +    P  +   +   +   +LSI +     ++ +   ++ P                A +D +   EL    ++ Y   +      W         P +LP+ L  +  W+    ++L ++LL  W  ++   SL+LL   + D  +R+ AV+ + + + N  +  +L QLVQ+LK+++Y  + ++ FLL   L + +     +W L   + ++      A M++           R Y     ++R   +I  EK+++  R +   R   +L+T+ E +K  +  E+ +  S    + E   +++ + TC     +     +   N   F+  ++P           +L  IFKCGDDL+QD LT+QL+ I + +W  +  D+K++ + C+ TG  SG+IE V +A+T+  IQ    +         +  W+   N +  ++  A+  FT SCAGYSVAT++LGI DRH DNIM+ T G LFHIDFG  L + +      R+R PFVLT D    I +G D+P  S  F+ F+ LC +A+  +R+++ L+L   + M  +G+P +     ++Y+R+ L        A   F +    + + +W T+ ++  H
Sbjct:  911 LTFDQHPICTLPREARLTFVLYGKQAASEGEPNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWP---PMTDKMLGPAPARGCHPQPDFCPVLSIEVPPYGGRIEFPEHQEVP--------KPAPHYDFASLDANLQEELLDTAELGYTGATERREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDL-HALLHSWAPLSPLQSLELLLPRYPDAKVREKAVEWI-SKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHMYWLLVHSLPDDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQ--RFMYQHRMCQKLTTIAESVK--EAKESMRQKSLAAGMDEVHQDLLEQPTCLPLGPELEVTGVSVRNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLKMVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTG-SFKDRPIAEWLGKQNPSPLEYQSAVRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVI-NGGDKP--STDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNS-NAVQYVRRALLPSQSNPEAAATFAKMIQSSLK-SWFTQFNFFLH 1579          
BLAST of pi3k-like protein vs. Ensembl Zebrafish
Match: zgc:158659 (zgc:158659 [Source:ZFIN;Acc:ZDB-GENE-070112-492])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 379/1053 (35.99%), Postives = 578/1053 (54.89%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKK---EHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLL----ISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVN---YYYQEQ--------SPVRIMG--------------SPISTT-IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V   LPN  +      R+A L  IK  L  E +   +Y   LL   S YIF GV ++AE EE+YDE++ LC+L L   +L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V ++   E E   A+   + ++    + +          L     +    +I   S +  K  + I+ +   ++ I + +  K  S     +    +   E   +Y+LKV   D Y L     +  Y Y++SC+     P L L  ++ L +   +   + P + +  PQ              SL      +  +L+C        ++  K+YVR  +++G    +     +  V   +P WNE L++DIY +++PR+A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + L LWP     ++   NP G + S  N+ +  + +     N    +  EQ        S  R +G              S IS    ++++ +  RD LYELSEQ+ D+L  +   C+ +PESLP+L  S++WN+  EV+  Y LL  WP +  ESSL+LL  NF D ++R+FA++ L   LT+  ++ YLLQLVQ LKYE Y  N L+ FL++ AL N+++G  FFW LKSEMHN+++   F L+LEAFCR    ++  +  Q   ++KLV ++  LK +++D     Q+  L E++   D+ E  +   S LN   + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE VK++ T+M IQ +  +  A+Q NS++L+ WI+  N+  E + +A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G      + +F  F  +C KAYL +R+H+SL + L+S+++  G+PEL    D+ YLRKTL++E  ++ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCCLPNGILVSLECLREAPLTSIKQQLFSEARKYPLYH--LLQEESCYIFVGVTQEAEREEFYDETRRLCDLRLFHPILKVIEPLGNREEK----ILNREIGFAIGMPICEFELVKDPEVQDFRRNILSVCREAVEEREGGGAHTQALYVYPPNVESSPDLPQHIYSKLDKGRLIVTIWVIVSPSNSKQKYTLKIAHDSLPEQLIAEAIRKKTRSMHLS-AQQLRLCVQEYQGQYILKVCGCDEYFLEKY-PLSQYKYIRSCITLCRLPHLMLVSKDSLYSQLPSSGFMAPSYSRRTPQPSPCPGGGDPGSPRSLWAFNTHLRVRLLCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLSYDIYLTDVPRSARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYKDTLVSGKVALGLWPVPHGLED-LLNPIGVSGSNPNKETPCVELEFPWFNQTVVFPDEQQIEEHANWSISRELGYSYCLGLSSRLACDSSISQADAEQLRTLCSRDPLYELSEQEKDFLWRHRHYCVNIPESLPKLLLSVKWNSRDEVSQIYCLLKDWPLMQPESSLELLDCNFPDPMVREFALRCLIQGLTDDKLSQYLLQLVQVLKYEMYLDNPLARFLIKKALTNQRIGHFFFWHLKSEMHNKTVSRRFGLLLEAFCRACGMYLKHLNRQVEAMDKLVNLTDTLKQEKKDETQKTQMKFLVEHMSRPDYMEALQGFVSPLNPVHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFTNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVKNSHTIMQIQCKGGLKGALQFNSNTLHHWIRDRNKG-EAYDRAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGVQECTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLLLGCGMPELQSFDDIAYLRKTLALEKSQQEALEYFTKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Zebrafish
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha [Source:ZFIN;Acc:ZDB-GENE-130409-1])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 373/1059 (35.22%), Postives = 583/1059 (55.05%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG-----FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQI---LQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY---------------------YYQEQSPVRIMGSPISTT--IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVK-FNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   +SYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L   I   IG     F+L   P+           + R++ L V K   E   A+  +   ++ Y  +  E +    + I   L     + +  +I   + +  K  + I+ +   ++ I + +  K  S          +   E   KY+LKV   D YLL     I  Y YV+SC+     P L L  ++ L   + ++ F +P Y  +    T     + S   ++++   +  +++C        ++  K+YVR  +++G   ++     +  V   +P WNE L +D+Y  +IPR A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +      S V +                     Y Q     R+      T   I++++ + +RD L E++EQ+ D+L  + + C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  D+ +  +N +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NS++L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G  +     + F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDLVKDPEVQ---------DFRRNILNVCKDSVELRDASGAHSRALYVYPPNV-ESSPELPKHIYGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAE-QLKMCVQEYQGKYILKVCGCDEYLLEKY-PISQYKYVRSCIMLGRLPNLMLMSKDSLYSQLPMDNFTMPSYSRRISTATPYMNGEASTKSLWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGIYHG-GEQLCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDYFSSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRVARDHAMTEADIEQLRQLGNRDPLSEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSTTLHQWLKDKNKG-EMYDMAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Zebrafish
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha [Source:ZFIN;Acc:ZDB-GENE-130409-1])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 373/1059 (35.22%), Postives = 583/1059 (55.05%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG-----FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQI---LQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY---------------------YYQEQSPVRIMGSPISTT--IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVK-FNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   +SYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L   I   IG     F+L   P+           + R++ L V K   E   A+  +   ++ Y  +  E +    + I   L     + +  +I   + +  K  + I+ +   ++ I + +  K  S          +   E   KY+LKV   D YLL     I  Y YV+SC+     P L L  ++ L   + ++ F +P Y  +    T     + S   ++++   +  +++C        ++  K+YVR  +++G   ++     +  V   +P WNE L +D+Y  +IPR A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +      S V +                     Y Q     R+      T   I++++ + +RD L E++EQ+ D+L  + + C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  D+ +  +N +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NS++L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G  +     + F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDLVKDPEVQ---------DFRRNILNVCKDSVELRDASGAHSRALYVYPPNV-ESSPELPKHIYGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAE-QLKMCVQEYQGKYILKVCGCDEYLLEKY-PISQYKYVRSCIMLGRLPNLMLMSKDSLYSQLPMDNFTMPSYSRRISTATPYMNGEASTKSLWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGIYHG-GEQLCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDYFSSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRVARDHAMTEADIEQLRQLGNRDPLSEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSTTLHQWLKDKNKG-EMYDMAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Zebrafish
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha [Source:ZFIN;Acc:ZDB-GENE-130409-1])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 373/1059 (35.22%), Postives = 583/1059 (55.05%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG-----FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQI---LQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY---------------------YYQEQSPVRIMGSPISTT--IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVK-FNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   +SYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L   I   IG     F+L   P+           + R++ L V K   E   A+  +   ++ Y  +  E +    + I   L     + +  +I   + +  K  + I+ +   ++ I + +  K  S          +   E   KY+LKV   D YLL     I  Y YV+SC+     P L L  ++ L   + ++ F +P Y  +    T     + S   ++++   +  +++C        ++  K+YVR  +++G   ++     +  V   +P WNE L +D+Y  +IPR A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +      S V +                     Y Q     R+      T   I++++ + +RD L E++EQ+ D+L  + + C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  D+ +  +N +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NS++L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G  +     + F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDLVKDPEVQ---------DFRRNILNVCKDSVELRDASGAHSRALYVYPPNV-ESSPELPKHIYGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAE-QLKMCVQEYQGKYILKVCGCDEYLLEKY-PISQYKYVRSCIMLGRLPNLMLMSKDSLYSQLPMDNFTMPSYSRRISTATPYMNGEASTKSLWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGIYHG-GEQLCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDYFSSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRVARDHAMTEADIEQLRQLGNRDPLSEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSTTLHQWLKDKNKG-EMYDMAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Zebrafish
Match: zgc:158659 (zgc:158659 [Source:ZFIN;Acc:ZDB-GENE-070112-492])

HSP 1 Score: 510.375 bits (1313), Expect = 4.325e-168
Identity = 269/626 (42.97%), Postives = 389/626 (62.14%), Query Frame = 3
Query: 1431 LIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVN---YYYQEQ--------SPVRIMG--------------SPISTT-IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            L+ G + L LWP     ++   NP G + S  N+ +  + +     N    +  EQ        S  R +G              S IS    ++++ +  RD LYELSEQ+ D+L  +   C+ +PESLP+L  S++WN+  EV+  Y LL  WP +  ESSL+LL  NF D ++R+FA++ L   LT+  ++ YLLQLVQ LKYE Y  N L+ FL++ AL N+++G  FFW LKSEMHN+++   F L+LEAFCR    ++  +  Q   ++KLV ++  LK +++D     Q+  L E++   D+ E  +   S LN   + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE VK++ T+M IQ +  +  A+Q NS++L+ WI+  N+  E + +A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G      + +F  F  +C KAYL +R+H+SL + L+S+++  G+PEL    D+ YLRKTL++E  ++ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:    3 LVSGKVALGLWPVPHGLED-LLNPIGVSGSNPNKETPCVELEFPWFNQTVVFPDEQQIEEHANWSISRELGYSYCLGLSSRLACDSSISQADAEQLRTLCSRDPLYELSEQEKDFLWRHRHYCVNIPESLPKLLLSVKWNSRDEVSQIYCLLKDWPLMQPESSLELLDCNFPDPMVREFALRCLIQGLTDDKLSQYLLQLVQVLKYEMYLDNPLARFLIKKALTNQRIGHFFFWHLKSEMHNKTVSRRFGLLLEAFCRACGMYLKHLNRQVEAMDKLVNLTDTLKQEKKDETQKTQMKFLVEHMSRPDYMEALQGFVSPLNPVHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFTNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVKNSHTIMQIQCKGGLKGALQFNSNTLHHWIRDRNKG-EAYDRAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGVQECTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLLLGCGMPELQSFDDIAYLRKTLALEKSQQEALEYFTKQMNDAHHGGWTTKMDWIFH 626          
BLAST of pi3k-like protein vs. Ensembl Xenopus
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:100144924])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 379/1053 (35.99%), Postives = 583/1053 (55.37%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQI---LQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNYY-------YQEQSPVRIMG-----SPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  V      R+A+L  IK  L KE +   +Y   LL + SSYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + RK+ L V K   E   AN P    ++ Y  +  E ++   + I   L     + +  +I   +    K  + I+ +  V E +    + KK       S    +   E   KY+LKV       L     +  Y Y++SC+     P L L  ++ L   I ++ F +P Y  +          + S   ++++   +  +++C        ++  K+YVR  +++G+   +     +  V   +P WNE L +D++  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G + S  N+ +  L +      S V +        +  +   R MG     S +S  I R           +KAI +RD L E++EQ+ ++L S+   C  +PE LP+L  S++WN   +V+  Y LL +WP I  E +++LL  N+ D+++R FAV  L   LT+  ++ YL+QLVQ +KYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E +K  DF +  +  +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G      +  F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMVVVLECLREATLVNIKHELFKEARKYPLYH--LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVVEPVGNREE----KILNREIGFAIGMPVCEFDMVKDSEVQDFRKNILNVCKDSVELRDANGPISRALYVYPPNV-ESSSELPKHIESKLDKGQIIVVIWVIVSPNNEKQKYSLKINHD-CVPEHVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKDSLYSQIPVDVFTMPSYSRRISTAAPYMNGEASAKSLWAINSTLRIKILCATYVNVNIRDIDKIYVRTGIYHGVEP-LCDNVNTQRVPCSNPRWNEWLLYDMFIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVSGSNPNKETPCLELEFDCFSSPVKFPDMTAIEDHANKVLEREMGYNYSHSGLSNRIVRENEVRESDKEQLKAISNRDPLSEITEQEKEFLWSHRLYCRNIPEILPKLLLSVKWNCRDDVSQMYCLLKEWPAIRPEQAMELLDFNYPDRIVRSFAVSCLEKYLTDDKLSQYLIQLVQVMKYEQYLDNHLVRFLLKKALVNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSKQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMKRPDFMDALQGFTSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSEMLFLNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRCSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-ETYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDNGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGIQECTKTRDFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. Ensembl Xenopus
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:100144924])

HSP 1 Score: 512.686 bits (1319), Expect = 2.457e-164
Identity = 339/960 (35.31%), Postives = 522/960 (54.37%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQI---LQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNYY-------YQEQSPVRIMG-----SPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADG 2936
            + V  LLPN  V      R+A+L  IK  L KE +   +Y   LL + SSYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + RK+ L V K   E   AN P    ++ Y  +  E ++   + I   L     + +  +I   +    K  + I+ +  V E +    + KK       S    +   E   KY+LKV       L     +  Y Y++SC+     P L L  ++ L   I ++ F +P Y  +          + S   ++++   +  +++C        ++  K+YVR  +++G+   +     +  V   +P WNE L +D++  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G + S  N+ +  L +      S V +        +  +   R MG     S +S  I R           +KAI +RD L E++EQ+ ++L S+   C  +PE LP+L  S++WN   +V+  Y LL +WP I  E +++LL  N+ D+++R FAV  L   LT+  ++ YL+QLVQ +KYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E +K  DF +  +  +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G
Sbjct:   20 ILVECLLPNGMVVVLECLREATLVNIKHELFKEARKYPLYH--LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVVEPVGNREE----KILNREIGFAIGMPVCEFDMVKDSEVQDFRKNILNVCKDSVELRDANGPISRALYVYPPNV-ESSSELPKHIESKLDKGQIIVVIWVIVSPNNEKQKYSLKINHD-CVPEHVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKDSLYSQIPVDVFTMPSYSRRISTAAPYMNGEASAKSLWAINSTLRIKILCATYVNVNIRDIDKIYVRTGIYHGVEP-LCDNVNTQRVPCSNPRWNEWLLYDMFIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVSGSNPNKETPCLELEFDCFSSPVKFPDMTAIEDHANKVLEREMGYNYSHSGLSNRIVRENEVRESDKEQLKAISNRDPLSEITEQEKEFLWSHRLYCRNIPEILPKLLLSVKWNCRDDVSQMYCLLKEWPAIRPEQAMELLDFNYPDRIVRSFAVSCLEKYLTDDKLSQYLIQLVQVMKYEQYLDNHLVRFLLKKALVNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSKQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMKRPDFMDALQGFTSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSEMLFLNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRCSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-ETYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDNGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKG 967          
BLAST of pi3k-like protein vs. Ensembl Xenopus
Match: slc27a6 (solute carrier family 27 member 6 [Source:Xenbase;Acc:XB-GENE-491992])

HSP 1 Score: 456.447 bits (1173), Expect = 1.177e-142
Identity = 281/794 (35.39%), Postives = 439/794 (55.29%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSL-----------------IEKTERGGNEVLL--------GWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSI---NISKVNYYYQEQSPVRIM---GSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY------LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I + Y+++C+ N   P L+L     +E  +I +      F Q + + +   R+ S   M   L +    +  +   + VR  +F+G      P     +   +   WNE L F+I   ++PR A+LCF++                 I+K+    +EVLL         W N  +F+Y G+L  G   L+ W     +     NP G+  T+ Y   N+  L I   + SK    Y     V ++   G         +K I++RD L +L E + D + +   +C    P SLP+L  S++WN + +V    +LL  W ++    +L+LL  N+ D+ +R++AV  L+  +++ +++ YLLQLVQ LKYE +    LS FLLQ AL N+++GQ  FW L+SE+HN ++ + F L+LEA+CRG +  M V+  Q   + KL  ++ ++K     ++LS +K        L+ + + E   ++ S LN S     ++VE C    SK +P+++ + N    S+    +L  IFK GDDLRQD+L LQLL + D +WK    D++++PYGCLATG   G IE V  A+T+  IQ   SN+ AA   N  +L  WI+  + + +   +A+E FT SCAGY VAT++LGI DRH DNIMV   GQLFHIDFGHIL N K KF + RER PF+LT DFI  I  G  +P ++ KF  F   C  AYL LR + +LI+TL+++M+ +GLPEL+ V+D++Y++ +L++   E+ AL  F ++F +A + +WTTK++W++H
Sbjct:  255 LIQFQYIRNCVMNKALPHLTL-----VECCNIKKL-----FDQEMSEIEHAVRRKS--SMHPALPMP---LPPKKRGVLVRAGLFHGTELLCKPTMTPEVQGKNDHVWNETLEFEINVCDLPRMARLCFAIYAVLDKPRNKNKTKYQTIKKSALCCSEVLLCFTQHFPVAWVNTMVFDYKGQLRSGDHVLHCWSSFPDELEEMLNPMGTVRTNPY-TENTTTLHIKFHDYSKEPISYPPFDKVNLLVRHGECGKKLNIELKEIMERDPLCQLCENEKDLIWTLRYDCRENFPGSLPKLLLSVKWNKLEDVAQLQALLQIWSKLPPRDALELLDFNYPDQYVREYAVNCLKP-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLQRALDNRRIGQFLFWHLRSEVHNPAVSVQFGLLLEAYCRGSVAHMKVLSRQVEALNKLRTLNGLIKLNA--VKLSKVKNKDNMHTCLRENAYKEALMHIQSPLNPSITLSELVVEKCKYMDSKMKPLWIVYNNRGFGSD----SLGIIFKNGDDLRQDMLALQLLRLMDMLWKEAGLDLRIVPYGCLATGDRCGFIEVVSAAETIADIQLDSSNLAAAAAFNKDALLNWIKECH-SGDDLERAIEEFTLSCAGYCVATYVLGIGDRHNDNIMVRKTGQLFHIDFGHILGNFKSKFKIKRERGPFILTYDFIHVIQQG--KPGNTEKFGRFRQCCEDAYLILRRNGNLIITLFALMLTAGLPELSSVKDIQYVKDSLALGKKEEDALKQFRQKFDEALKESWTTKVNWMAH 1022          
BLAST of pi3k-like protein vs. Ensembl Xenopus
Match: slc27a6 (solute carrier family 27 member 6 [Source:Xenbase;Acc:XB-GENE-491992])

HSP 1 Score: 455.292 bits (1170), Expect = 5.472e-142
Identity = 278/800 (34.75%), Postives = 439/800 (54.87%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFPILSL---------YPREY--LENISINRFIIPPYFYQNIPQTKRRTRQDS---------VSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTER---------------GGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSINISKVNYYYQE--QSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY------LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I + Y+++C+ N   P L+L         + +E   +E+    +  + P     +P  KR     +         + + + ++L     +  E+S L VR  +F+G      P     +   +   WNE L F+I   ++PR A+LCF++    ++               G     + W N  +F+Y G+L  G   L+ W     +     NP G+  T+ Y   N+  L I   K + Y +E    P    G         +K I++RD L +L E + D + +   +C    P SLP+L  S++WN + +V    +LL  W ++    +L+LL  N+ D+ +R++AV  L+  +++ +++ YLLQLVQ LKYE +    LS FLLQ AL N+++GQ  FW L+SE+HN ++ + F L+LEA+CRG +  M V+  Q   + KL  ++ ++K     ++LS +K        L+ + + E   ++ S LN S     ++VE C    SK +P+++ + N    S+    +L  IFK GDDLRQD+L LQLL + D +WK    D++++PYGCLATG   G IE V  A+T+  IQ   SN+ AA   N  +L  WI+  + + +   +A+E FT SCAGY VAT++LGI DRH DNIMV   GQLFHIDFGHIL N K KF + RER PF+LT DFI  I  G  +P ++ KF  F   C  AYL LR + +LI+TL+++M+ +GLPEL+ V+D++Y++ +L++   E+ AL  F ++F +A + +WTTK++W++H
Sbjct:  255 LIQFQYIRNCVMNKALPHLTLVECCNIKKLFDQEMSEIEHAVRRKSSMHPALPMPLPPKKRGASMKTLNMRDIVWNIVQPYKIILSKGSRLNTEDSVL-VRAGLFHGTELLCKPTMTPEVQGKNDHVWNETLEFEINVCDLPRMARLCFAIYAVLDKPRNKNKTKYQTIKKSGKMHFPVAWVNTMVFDYKGQLRSGDHVLHCWSSFPDELEEMLNPMGTVRTNPY-TENTTTLHI---KFHDYSKEPISYPPFDKGRGGKKLNIELKEIMERDPLCQLCENEKDLIWTLRYDCRENFPGSLPKLLLSVKWNKLEDVAQLQALLQIWSKLPPRDALELLDFNYPDQYVREYAVNCLKP-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLQRALDNRRIGQFLFWHLRSEVHNPAVSVQFGLLLEAYCRGSVAHMKVLSRQVEALNKLRTLNGLIKLNA--VKLSKVKNKDNMHTCLRENAYKEALMHIQSPLNPSITLSELVVEKCKYMDSKMKPLWIVYNNRGFGSD----SLGIIFKNGDDLRQDMLALQLLRLMDMLWKEAGLDLRIVPYGCLATGDRCGFIEVVSAAETIADIQLDSSNLAAAAAFNKDALLNWIKECH-SGDDLERAIEEFTLSCAGYCVATYVLGIGDRHNDNIMVRKTGQLFHIDFGHILGNFKSKFKIKRERGPFILTYDFIHVIQQG--KPGNTEKFGRFRQCCEDAYLILRRNGNLIITLFALMLTAGLPELSSVKDIQYVKDSLALGKKEEDALKQFRQKFDEALKESWTTKVNWMAH 1039          
BLAST of pi3k-like protein vs. Ensembl Xenopus
Match: slc27a6 (solute carrier family 27 member 6 [Source:Xenbase;Acc:XB-GENE-491992])

HSP 1 Score: 451.825 bits (1161), Expect = 1.849e-140
Identity = 278/815 (34.11%), Postives = 445/815 (54.60%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFPILSL---------YPREY--LENISINRFIIPPYFYQNIPQTKRRTRQDS---------VSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTER---------------GGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSI---NISKVNYYY-------QEQSPVRIMGSPISTTIQ-------RIKAIIDRDWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY------LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I + Y+++C+ N   P L+L         + +E   +E+    +  + P     +P  KR     +         + + + ++L     +  E+S L VR  +F+G      P     +   +   WNE L F+I   ++PR A+LCF++    ++               G     + W N  +F+Y G+L  G   L+ W     +     NP G+  T+ Y   N+  L I   + SK    Y       ++ + +      +ST+ +        +K I++RD L +L E + D + +   +C    P SLP+L  S++WN + +V    +LL  W ++    +L+LL  N+ D+ +R++AV  L+  +++ +++ YLLQLVQ LKYE +    LS FLLQ AL N+++GQ  FW L+SE+HN ++ + F L+LEA+CRG +  M V+  Q   + KL  ++ ++K     ++LS +K        L+ + + E   ++ S LN S     ++VE C    SK +P+++ + N    S+    +L  IFK GDDLRQD+L LQLL + D +WK    D++++PYGCLATG   G IE V  A+T+  IQ   SN+ AA   N  +L  WI+  + + +   +A+E FT SCAGY VAT++LGI DRH DNIMV   GQLFHIDFGHIL N K KF + RER PF+LT DFI  I  G  +P ++ KF  F   C  AYL LR + +LI+TL+++M+ +GLPEL+ V+D++Y++ +L++   E+ AL  F ++F +A + +WTTK++W++H
Sbjct:  261 LIQFQYIRNCVMNKALPHLTLVECCNIKKLFDQEMSEIEHAVRRKSSMHPALPMPLPPKKRGASMKTLNMRDIVWNIVQPYKIILSKGSRLNTEDSVL-VRAGLFHGTELLCKPTMTPEVQGKNDHVWNETLEFEINVCDLPRMARLCFAIYAVLDKPRNKNKTKYQTIKKSGKMHFPVAWVNTMVFDYKGQLRSGDHVLHCWSSFPDELEEMLNPMGTVRTNPY-TENTTTLHIKFHDYSKEPISYPPFDKILEKAAEIARNSDSLSTSGRGGKKLNIELKEIMERDPLCQLCENEKDLIWTLRYDCRENFPGSLPKLLLSVKWNKLEDVAQLQALLQIWSKLPPRDALELLDFNYPDQYVREYAVNCLKP-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLQRALDNRRIGQFLFWHLRSEVHNPAVSVQFGLLLEAYCRGSVAHMKVLSRQVEALNKLRTLNGLIKLNA--VKLSKVKNKDNMHTCLRENAYKEALMHIQSPLNPSITLSELVVEKCKYMDSKMKPLWIVYNNRGFGSD----SLGIIFKNGDDLRQDMLALQLLRLMDMLWKEAGLDLRIVPYGCLATGDRCGFIEVVSAAETIADIQLDSSNLAAAAAFNKDALLNWIKECH-SGDDLERAIEEFTLSCAGYCVATYVLGIGDRHNDNIMVRKTGQLFHIDFGHILGNFKSKFKIKRERGPFILTYDFIHVIQQG--KPGNTEKFGRFRQCCEDAYLILRRNGNLIITLFALMLTAGLPELSSVKDIQYVKDSLALGKKEEDALKQFRQKFDEALKESWTTKVNWMAH 1063          
BLAST of pi3k-like protein vs. Ensembl Mouse
Match: Pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:1206581])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 375/1054 (35.58%), Postives = 577/1054 (54.74%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L +E +   +++  LL + +SYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + I+ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           ++A+  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQ--LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. Ensembl Mouse
Match: Pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:1206581])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 375/1054 (35.58%), Postives = 577/1054 (54.74%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L +E +   +++  LL + +SYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + I+ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           ++A+  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQ--LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. Ensembl Mouse
Match: Pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:1206581])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 309/796 (38.82%), Postives = 466/796 (58.54%), Query Frame = 3
Query:  969 YDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            Y Y++SC+     P L L  +E L   + I+ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           ++A+  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:  148 YKYIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFH 938          
BLAST of pi3k-like protein vs. Ensembl Mouse
Match: Pik3cb (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:MGI Symbol;Acc:MGI:1922019])

HSP 1 Score: 469.544 bits (1207), Expect = 2.427e-147
Identity = 289/815 (35.46%), Postives = 450/815 (55.21%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFP---------ILSLYPREYLE-NISINRFI--IPPYFYQNIPQTKRRTRQDSV----SKMFSLLLISA-QLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-------------------KTERGGNEV--LLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSINIS---KVNYYYQ------EQSPVRIMGSPISTT-------IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY----LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I + Y+++C+ N   P         I  +Y +E +    +INR    +P      +P   ++TR  S     +  F + L+   +L  +E  K++VR  +F+G          S +   +   WNE+L FDI   ++PR A+LCF++                     +T R   +V   + W N  +F++ G+L  G + L+ W     +     NP G+  T+ Y   N+  L I      K   YY       E++     G   + +       +  +K I+DRD L +L E ++D + +  ++C    P+SLP+L  SI+WN + +V    +LL  WP++    +L+LL  N+ D+ +R++AV  LR  +++ +++ YLLQLVQ LKYE +    LS FLL+ AL N+++GQ  FW L+SE+H  ++ + F ++LEA+CRG +  M V+  Q   + KL  ++ ++K     L  +  KE     LK   + E   ++ S LN       + VE C    SK +P++L + ++  F E S+     IFK GDDLRQD+LTLQ+L + D +WK    D+++LPYGCLATG  SG+IE V  ++T+  IQ   SN+ A    N  +L  W++  N + +   +A+E FT SCAGY VA+++LGI DRH DNIMV   GQLFHIDFGHIL N K KFG+ RERVPF+LT DFI  I  G  +  ++ KF  F   C  AYL LR H +L +TL+++M+ +GLPELT V+D++YL+ +L++   E+ AL  F ++F +A R +WTTK++W++H
Sbjct:  257 LIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLP------LPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTEETVKVHVRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYA-ENATALHITFPENKKQPCYYPPFDKIIEKAAELASGDSANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQ-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVY-SSRAFGEDSV---GVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYN-SGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQG--KTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAH 1056          
BLAST of pi3k-like protein vs. Ensembl Mouse
Match: Pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta [Source:MGI Symbol;Acc:MGI:1098211])

HSP 1 Score: 453.366 bits (1165), Expect = 2.041e-141
Identity = 261/727 (35.90%), Postives = 404/727 (55.57%), Query Frame = 3
Query: 1125 SVSKMFSLLLISAQLI-CKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSL---IEKTERGGN--------EVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNS----VILSINISKVNYYYQEQSPVRIMG-----SPISTTIQRIKAIIDRDWLYELSEQDIDY---LRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYL----KNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            S+ + FS+ LI  + +   E  KL V+  +F+G          S +     P W ++L FDI   ++PR A+LCF+L   +EK ++  +        +  + WAN+ +F+Y  +L  G   L +WP    +     NP G+     N  S    VI    ++    Y+     +  +G       I+    +++ I++R    EL E + D    +R  ++     PE+L RL    +WN   +V     LL  WP + + S+L+LL  +F D  +  FA+K+LR  LT+ ++  YLLQLVQ LKYESY   +L+ FLL  AL N+++G   FW L+SEMH  S+ + F L++EA+CRG  + M V+  Q   + KL  ++  +K   +       KE +    + + + E   ++ S L+ S     + VE C    SK +P+++ + + +  S  ++     IFK GDDLRQD+LTLQ++ + D +WK++  D+++ PYGCL TG  +G+IE V  + T+ +IQ  +SN+ A    N  +L  W+++ N   E   +A+E FT SCAGY VAT++LGI DRH DNIM+   GQLFHIDFGH L N K KFG+NRERVPF+LT DF+  I  G     +S KF  F   C +AY  LR H  L L L+++M  +GLPEL+  +D++YL+ +L++   E+ AL +F  +F +A R +W TK++WL+H
Sbjct:  318 SLEQPFSIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEELQLREILERRGSGELYEHEKDLVWKMRHEVQEHF--PEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRK-LTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNV---GIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKN-PGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTN--NSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAH 1035          

HSP 2 Score: 60.8474 bits (146), Expect = 9.147e-9
Identity = 39/122 (31.97%), Postives = 63/122 (51.64%), Query Frame = 3
Query:  162 DVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNL 527
            D P+ ++T   S  V V  LLP      F VSR A+L  IK +L    +   ++   +L++  +Y+F  VN+ AE +E  DE + LC++     VL  + R+G+  +  + S I+  IG  L
Sbjct:    6 DCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH--MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLLIGKGL 125          
BLAST of pi3k-like protein vs. UniProt/SwissProt
Match: sp|A0A0G2K344|PK3CA_RAT (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Pik3ca PE=1 SV=1)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 377/1054 (35.77%), Postives = 577/1054 (54.74%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   +++  LL + SSYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + I+ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           ++A+  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ--LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETATKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. UniProt/SwissProt
Match: sp|P42336|PK3CA_HUMAN (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PIK3CA PE=1 SV=2)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 378/1054 (35.86%), Postives = 577/1054 (54.74%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   +++  LL + SSYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + ++ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           +KAI  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ--LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. UniProt/SwissProt
Match: sp|P32871|PK3CA_BOVIN (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus OX=9913 GN=PIK3CA PE=1 SV=1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 377/1054 (35.77%), Postives = 577/1054 (54.74%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   +++  LL + SSYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + ++ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           ++AI  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ--LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. UniProt/SwissProt
Match: sp|P42337|PK3CA_MOUSE (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Pik3ca PE=1 SV=2)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 375/1054 (35.58%), Postives = 577/1054 (54.74%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPY---FYQNIPQTKRRTRQDSVSKMFSLLLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----------------SKVNYYYQEQSPVRIMGSPISTTIQR-----------IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L +E +   +++  LL + +SYIF  V ++AE EE++DE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K+  +    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       S    +   E   KY+LKV             +  Y Y++SC+     P L L  +E L   + I+ F +P Y        P     T   S+  + S L I  +++C        ++  K+YVR  +++G    +     +  V   +P WNE LN+DIY  ++PR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                     N+    ++      + +S  + R           ++A+  RD L E++EQ+ D+L S+   C+ +PE LP+L  S++WN+  EV   Y L+  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  DF +  +   S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQ--LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFVIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNV-ESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKV-CGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRI--KILCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKG-EIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. UniProt/SwissProt
Match: sp|Q9Z1L0|PK3CB_RAT (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Pik3cb PE=2 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 6.854e-149
Identity = 285/809 (35.23%), Postives = 443/809 (54.76%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFP---------ILSLYPREYLE-NISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISA-QLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-------------------KTERGGNEVL--LGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS--TDSYKNRNSVILSINIS---KVNYYYQEQSPVRIMGSPISTT-------------IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY----LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I + Y+++C+ N   P         I  +Y +E +    +INR            +T+  +     +  F ++L+   +L  +E  K++VR  +F+G          S +   +   WNE+L FDI   ++PR A+LCF++                     +T R   +V   + W N  +F++ G+L  G + L+ W     +     NP G+  T+ Y   N+  L I      K  YYY     +    + I++              +  +K I+DRD L +L E ++D + +  ++C    P+SLP+L  SI+WN + +V    +LL  WP++    +L+LL  N+ D+ +R++AV  LR  +++ +++ YLLQLVQ LKYE +    LS FLL+ AL N+++GQ  FW L+SE+H  ++ I F ++LEA+CRG +  M V+  Q   + KL  ++ ++K     L  +  KE     LK   + E   ++ S LN       + VE C    SK +P++L + N      F    +  IFK GDDLRQD+LTLQ+L + D +WK    D+++LPYGCLATG  SG+IE V  ++T+  IQ   SN+ A    N  +L  W++  N + +   +A+E FT SCAGY VA+++LGI DRH DNIMV   GQLFHIDFGHIL N K KFG+ RERVPF+LT DFI  I  G  +  ++ KF  F   C  AYL LR H +L +TL+++M+ +GLPELT V+D++YL+ +L++   E+ AL  F ++F +A R +WTTK++W++H
Sbjct:  263 LIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINRNSSSLPLPLPPKKTRVISHVWGNNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYA-ENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASGDSANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQ-MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHLRSEVHTPAVSIQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAMKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCRYMDSKMKPLWLVYSN----RAFGEDAVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYN-SGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQG--KTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAH 1062          
BLAST of pi3k-like protein vs. TrEMBL
Match: D2DJU4 (Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2027.68 bits (5252), Expect = 0.000e+0
Identity = 1017/1023 (99.41%), Postives = 1022/1023 (99.90%), Query Frame = 3
Query:  150 MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF 3218
            MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNS+YEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVI+HCIG NLDNLPKEYYELYDLELLNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVSSLDSYLLNLNDKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMF+LLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPIS+TIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVI+PQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF
Sbjct:    1 MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSVYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVISHCIGLNLDNLPKEYYELYDLELLNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVSSLDSYLLNLNDKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFTLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPISSTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIKPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF 1023          
BLAST of pi3k-like protein vs. TrEMBL
Match: A0A222C681 (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 1582.77 bits (4097), Expect = 0.000e+0
Identity = 785/1026 (76.51%), Postives = 902/1026 (87.91%), Query Frame = 3
Query:  150 MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYE-ELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKV-NYYYQEQSPVRIMGSPISTTIQ-RIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF 3218
            M RS+VPLNYY+YSF N+V+VMILLPNFSVEEF VS+K SL+E+KDIL+KELKTN IYE E  LNNFSSYIFCGVNR+AEIEEYYDESQLLCNLNL+DFVLNCLERKGN+ ESQLTSVINHCIG NLDN+PKE  +L  L    ARKSYLEVV  EHE+L+ N N+++++QYGADYNE+TT T RQILQSM+ LYIT++ISYK+ + FKC+++ISKE+TVK+TI KIL DKK+ FE+D + D  +W+SEN+ KYVLK SSLDSYL+  +DK+I+Y+YVQSCLYNNEFPILSLYP  YLENISI +F+IP YFYQN+PQ KR+ + D  +K FS+ L  AQLICKENSK+Y+R AMFNGINTRI  EQKS+LV SDHP WNE LNFDI   NIPRNAKLC SLIE+ ERG NE++LGW NINIFNY+G+LIEGS+DLNLW  EK  DNGYF+P GS  S K   ++I+ ++I K+ NYYYQE   +RI  SP+   IQ RIK IIDRD L ELSEQDIDYLR+NLENCLW+PESLPRLAKSIRWNN  EVN FYSLLS WP+++LESSLQLL GNFFD++LR+FAV NLR+ILTNAD+NLYLLQL+QALKYESYYFNDL+++L+QSALR+KQLGQKFFWFLKSEMHN++IK+YFA++ EAFCRGY NF+ +IRPQ I IEKL+EIS ILK QR +LQLSTLK+YL+ND+FNE CKNV+SLL LSEKQGNIIV+TCDVKKSKKRPIYLEW+NADIFS+   PTLKFIFKCGDDLRQD+LTLQ+LSIFDWIWKRQFQDMKLLPYGCLA+GKDSGIIEAVKDAKTVMSIQRS++ +AMQM+S SLYRWI++NN TCEQF KALETFTRSCAGYSVATFILGIRDRHPDNIMVN+KGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFI TIA+G D+P  S KFN+F VLCGKAYLKLREHSSLILTLYS+MIDSGLPELTKVQDLEYLRKTLSV+S E+ AL YFNRQF +AY GNWTTKIDWLSH+
Sbjct:    1 MIRSEVPLNYYSYSFLNNVSVMILLPNFSVEEFNVSKKVSLYELKDILMKELKTNPIYEKEYALNNFSSYIFCGVNREAEIEEYYDESQLLCNLNLMDFVLNCLERKGNKLESQLTSVINHCIGLNLDNIPKENDDLELLF---ARKSYLEVVHSEHENLLNNKNEVLLYQYGADYNEYTTLTIRQILQSMSNLYITSIISYKTTDKFKCIISISKEYTVKDTINKILYDKKECFEYDVNTDLRVWSSENASKYVLKFSSLDSYLIKPDDKLIYYEYVQSCLYNNEFPILSLYPISYLENISIIQFLIPSYFYQNMPQVKRKIQVDITNKYFSIFLKGAQLICKENSKIYIRAAMFNGINTRITSEQKSNLVPSDHPAWNETLNFDIECVNIPRNAKLCLSLIERNERGNNELVLGWRNINIFNYYGRLIEGSLDLNLWSCEKTPDNGYFHPSGSIHSIKT--NIIICLDILKIKNYYYQELPNIRIRTSPVLNVIQQRIKNIIDRDLLSELSEQDIDYLRTNLENCLWIPESLPRLAKSIRWNNAREVNTFYSLLSLWPKVSLESSLQLLGGNFFDEILRRFAVNNLRSILTNADVNLYLLQLIQALKYESYYFNDLAIYLIQSALRSKQLGQKFFWFLKSEMHNDTIKVYFAIINEAFCRGYWNFINIIRPQCIEIEKLIEISMILKNQRVELQLSTLKDYLRNDNFNEICKNVNSLLCLSEKQGNIIVDTCDVKKSKKRPIYLEWKNADIFSDLVNPTLKFIFKCGDDLRQDMLTLQILSIFDWIWKRQFQDMKLLPYGCLASGKDSGIIEAVKDAKTVMSIQRSHLSSAMQMDSFSLYRWIRSNNTTCEQFQKALETFTRSCAGYSVATFILGIRDRHPDNIMVNSKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIITIAEGCDKPSSSDKFNDFTVLCGKAYLKLREHSSLILTLYSLMIDSGLPELTKVQDLEYLRKTLSVDSTEEQALTYFNRQFYNAYTGNWTTKIDWLSHW 1021          
BLAST of pi3k-like protein vs. TrEMBL
Match: A0A2R5LMV6 (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 391/1046 (37.38%), Postives = 602/1046 (57.55%), Query Frame = 3
Query:  192 FSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIANPNDI---VIFQYGADYNEFTTSTARQILQS---MTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKIL-----LDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYLEN-ISINRFIIPPYFYQNIPQTKRRTRQD--SVSKMFSLLLISAQLI-CKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISK----VNYYYQEQ------SPVRIMG----SPIS---TTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQ---LSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQR-SNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
              N V V  LLP   + +   +R A+L  IKD L  + +   +Y  L   + SSYIF  + RDAE EE+YDES+ LC+L+L   +L  +E KGN +E +L S I   IG +         ++ + E+++ R+  L V K+  ++  A  ++     ++    + +    S     L     M C+++ T  + K  +  +       E  ++E I K L     L K++             A E    Y+LKV  ++ YLL     +  Y Y+++C+     P L L  +E + N I  + +  P Y  +N+  T+ ++      V  MF + +++A  +  K+  K+YVR  +++G  + + P +++  V+  +P W+E L FD+Y  +IPR+A+LC S+   ++R   E    + W NI++F+Y   L+ G ++L+LWP  K  D    NP GS  S  NR +  L I I +    V +   EQ      S +R+      +P +   +  ++I  +I RD L E+SEQ+   L      C  V +SLP+L  +++WN+   V   Y LL++WP+++ E++L+LL   + D  +R+ AV+ L   L++  ++ YLLQLVQ LKYE Y  NDL  FL++ +L N  +G  FFW LKSEMH+ ++ + F L+LE FCRG    +  +  Q   +EKL +++  LK +++D Q   L  L E     DF +  +   S LN S   G ++V  C +  S K+P++L W+N D   E  +   + IFK GDDLRQD+LTLQ++ I D IW+ +  D++++PY CL+TGK  G+IE V++A+TVM+IQ+    +AA Q++S+ L++WI+  N+  +++ +A+ETFT SCAGY VATFILGI DR+PDNIMVN +GQ+FHIDFGH L + KKKFG+NRERVPFVLTEDF+  IA G++ P  S +F  F  LCGKAYL L  H++L++TL+++M+ +G+PEL  + D+ YLRKTL VE  E+ AL YF  QF +AY G WTTK+DW  H
Sbjct:   14 MPNTVMVDCLLPTGVIIQLNCARDATLESIKDDLWDKAQRYPLYRRL--GDPSSYIFVSITRDAEREEFYDESRRLCDLHLFQPILKIVEPKGNTEEKKLNSEIRLAIGGSAHEF----DDMKEHEVVDFRRGILAVCKEAVDTRDAGSDECRACYVYPPEIESSSRLPSNLENKLDKGVVMVCVWVLTDTNGKQTHTLEVHKDTHPENVIREAILKKLQKCSKLSKEEQLAR---------AEECQKHYLLKVCGVNQYLLKSY-PLSQYKYIRNCIAKGNMPQLMLMHKEAVYNAIPRSHYNTPSYMRRNVSTTQPQSTISLYRVDAMFGVKILNASYVNVKDVDKIYVRTGIYHGTES-LCPYRETQHVAHTNPKWDELLEFDLYIPDIPRSARLCVSICAVSQRKKREERCAIAWGNISLFDYKSVLLSGKVNLHLWPVPKGMDE-LLNPIGSIGSNPNREAPCLVIEIERFSGQVVFPTMEQIEEYVNSIIRLQSQTEKNPETWNESEKEQIHDVIKRDPLSEISEQEKMLLWKMRYYCFSVSDSLPKLLDALKWNSRDHVAQLYILLNQWPQVSPETALELLDCKYADLFVRKHAVRWLDQSLSDELLSRYLLQLVQVLKYEPYLENDLGKFLIKRSLLNYNIGHFFFWHLKSEMHDPAVALRFGLLLEGFCRGIGTHLKSVVKQVGALEKLTQLTDSLKERKDDTQKERLRFLMEQFSKPDFLDALQEFPSPLNNSCILGKLVVTECKILDSAKKPLWLLWKNPDYSVEHILEHHEIIFKNGDDLRQDMLTLQVIRIMDSIWQNEGLDLRMMPYACLSTGKHVGMIEVVRNARTVMNIQKKGGRMAAFQVDSTQLHKWIREKNKG-KRYKQAIETFTLSCAGYCVATFILGIGDRNPDNIMVNEEGQIFHIDFGHFLGHFKKKFGINRERVPFVLTEDFLYVIAKGAENPRKSKEFQSFQELCGKAYLLLHRHANLLITLFTMMLSTGIPELQSIDDISYLRKTLQVEKTEEQALEYFQNQFFEAYGGAWTTKVDWFFH 1040          
BLAST of pi3k-like protein vs. TrEMBL
Match: A0A131YXN4 (Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 395/1043 (37.87%), Postives = 591/1043 (56.66%), Query Frame = 3
Query:  192 FSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG---FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN---PNDIVIFQYGADYNEFTTSTARQILQS--MTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQN--IPQTKRRTRQDSVSKMFSLLLISAQLI-CKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISK----VNYYYQEQ--------SPVRIMG--SPISTT---IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLK---EYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQR-SNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
              N + V  LLP   +     SR A+L  IK+ L +  +   +Y  L     SSYIF  + R+ + EE+YDE + LC+L+L   +L  +E KGN +E +L S I   +G      DN+       +   +L+  K  ++      E   A+   P +I          E   +  R++ +   M C++  +    K  +  +       E  ++E I K L   + S E   +M     A E+   Y+LKV  ++ YLL     +  Y Y+++C+   E P L L  ++ + + I  + +I P Y  +N  +  T+       V + F + ++ A  +  K+  K+YVRV +++G    + P + +  VS  +P W+E L F +Y  +IPR+A+LC S+   ++R   E    + W N+++F+Y   L+ G ++L+LWP  K  D    NP GST S  NR +  L I + +    V +   EQ        SP+  MG  SP + T     +I  II RD L E+ EQ+   L      C  VP SLP+L  + +WN    V   Y LL KW R++ E++L+LL   + D  +R++AV+ L   L++  ++ YLLQLVQ LKYE Y  NDL  FL++ +L N  +G  FFW LKSEMH+ S+ + F L+LE FCRG    +  +  Q   +EKL +++  LK +++D     LK   E     DF E  ++  S LN S   G++IV  C +  S K+P++L W+N D  +E  +   + IFK GDDLRQD+LTLQ++ I D IW+++  D++++PY CL+TGK  G+IE V++AKTVM+IQ+    +AA Q++S+ L++WI+  N+  +++ +A+ETFT SCAGY VATFILGI DR+PDNIMVN +GQ+FHIDFGH L + KKKFG+NRERVPFVLTEDF+  IA G + P  S +F  F  LCGKAYL L  H++L++TL+++M+ +G+PEL  + D+ YLRKTL VE  E+ AL YF  QF +AY G WTTK+DW  H
Sbjct:   14 MPNTIVVDCLLPTGIIIPLTCSRDATLESIKEDLWENAQKYPLYRHL--GEPSSYIFVSITREGDKEEFYDEYRRLCDLHLFQPILKVVEPKGNTEEKKLNSEIRLAVGGCAHEFDNMKDSEVIDFRRNILSVCKDAVDTRNTGSEECRASYVYPPEI------ESSEELPANLERKLDKGLVMVCVWGLSETGEKQKHTLEVHKDTVPEAVIREAILKKLKCSRHSREEQVAM-----AQEHQHNYLLKVCGVNQYLLKSY-PLCRYKYIRTCIAKGEIPQLMLMLKDAVYKAIPPSNYITPSYVRRNPSLSATQPTVSLYKVDESFRVKILGASYVNVKDVDKIYVRVGIYHGTEA-LCPFRDTEHVSHSNPKWDELLEFQMYIPDIPRSARLCVSICAVSQRKKREERCAIAWGNVSLFDYKSVLLSGRVNLHLWPVPKGMDE-LLNPLGSTGSNPNREAPCLVIELDRFSGQVVFPTMEQIEEYASFVSPLESMGEESPENWTENDKDQIHEIIKRDPLSEILEQEKMLLWRMRYYCYTVPNSLPKLLDASKWNCRDHVAQLYRLLKKWKRVSPETALELLDCKYADMFVRKYAVEWLDG-LSDELLSQYLLQLVQVLKYEPYLENDLGKFLIRRSLLNYNIGHFFFWHLKSEMHDPSVAVRFGLLLEGFCRGIGTHLKSVVRQVGALEKLTQLTDSLKERKDDTPKERLKFLIEQFSKPDFLEALQHFPSPLNNSCILGDLIVNECRILDSAKKPLWLLWKNPDHLAEQILDHHEIIFKNGDDLRQDMLTLQVIRIMDSIWQKEGLDLRMMPYACLSTGKHVGMIEVVRNAKTVMNIQKKGGRMAAFQVDSTQLHKWIRDKNKG-DRYKQAIETFTLSCAGYCVATFILGIGDRNPDNIMVNEEGQIFHIDFGHFLGHFKKKFGINRERVPFVLTEDFLHVIARGQENPRKSKEFQSFQELCGKAYLLLHRHANLLITLFTMMLSTGIPELQSIDDIGYLRKTLQVEKPEEQALEYFQNQFFEAYGGAWTTKVDWFFH 1038          
BLAST of pi3k-like protein vs. TrEMBL
Match: A0A1E1XFL8 (Putative phosphatidylinositol 3-kinase vps34 involved in signal transduction (Fragment) OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 390/1043 (37.39%), Postives = 593/1043 (56.86%), Query Frame = 3
Query:  192 FSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG---FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN---PNDIVIFQYGADYNEFTTSTARQILQS--MTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQN--IPQTKRRTRQDSVSKMFSLLLISAQLI-CKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISK----VNYYYQEQ--------SPVRIMGSPISTTI-----QRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDL---QLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQR-SNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
              N + V  LLP   +     SR A+L  IK+ L +  +   +Y  L     SSYIF  + RD + EE+YDE + LC+L+L   +L  +E KGN +E +L S I   +G      DN+       +   +L+  K  ++      E   A+   P +I          E   +  R++ +   M C++  +    K  +  +       E  ++E I K L   + + E   ++     A E+   Y+LKV  ++ YLL     +  Y Y+++C+   + P L L  ++ + + I  + +I P Y  +N  +  T+       V + F + ++ A  +  K+  K+YVRV +++G  + + P + +  V   +P W+E L F +Y  +IPR+A+LC S+   ++R   E    + W N+++F+Y   L+   ++L+LWP  K  D    NP GST S  NR +  L I + +    V +   EQ        SP++ +G     T      ++++ II RD L E+SEQD   L      C  VP SLP+L  + +WN+   V   Y LL KW R++ E++L+LL   + D  +R++AV+ L   L++  ++ YLLQLVQ LKYE Y  NDL  FL++ +L N  +G  FFW LKSEMH+ S+ + F L+LE FCRG    +  +  Q   +EKL +++  LK +++D    +L  L E     DF E  ++  S LN S   G++IV  C +  S K+P++L W+N D  +E  +   + IFK GDDLRQD+LTLQ++ I D IW+++  D++++PY CL+TGK  G+IE V++AKTVM+IQ+    +AA Q++S+ L++WI+  NR  +++ +A+ETFT SCAGY VATFILGI DR+PDNIMVN +GQ+FHIDFGH L + KKKFG+NRERVPFVLTEDF+  IA G + P  S +F  F  LCGKAYL L  H++L++TL+++M+ +G+PEL  + D+ YLRKTL VE  E+ AL YF  QF +AY G WTTK+DW  H
Sbjct:   15 MPNTIMVDCLLPTGIIIPLSCSRDATLESIKEELWENAQKYPLYRHL--GEPSSYIFVSITRDGDKEEFYDEYRRLCDLHLFQPILKVVEPKGNTEEKKLNSEIRLAVGGCAHEFDNMKDSEVIDFRRNILSVCKDAVDTRNTGSEECRASYVYPPEI------ESSEELPANLERKLDKGLVMVCVWGLSDSGEKQKHTLEVHKDTVPEAVIREAILKKLKCSRLAREEQVAL-----AQEHQHHYLLKVCGVNQYLLKTY-PLCRYKYIRTCIAKGDIPQLMLMLKDAVYKAIPPSNYITPSYVRRNPSLSATQPTVSLYKVDESFRVKILGASYVNVKDVDKIYVRVGIYHGTES-LCPFRDTEHVVHSNPKWDETLEFQMYIPDIPRSARLCVSICAVSQRKKREERCAIAWGNVSLFDYKSVLLSSRVNLHLWPVPKGMDE-LLNPLGSTGSNPNREAPCLVIELDRFSGQVVFPSMEQIEEYASFVSPLQSLGEENPETWTEVEKEQVQEIIKRDPLSEISEQDKMLLWKMRYYCYTVPNSLPKLLDASKWNSRDHVAQLYRLLRKWKRVSPETALELLDCKYADMFVRKYAVEWLDG-LSDELLSQYLLQLVQVLKYEPYLENDLGKFLIRRSLLNYNIGHFFFWHLKSEMHDPSVAVRFGLLLEGFCRGIGTHLKSVVRQVGALEKLTQLTDSLKERKDDTPKERLKYLTEQFSKPDFLEALQHFPSPLNNSCILGDLIVNECRILDSAKKPLWLLWKNPDHLAEQILDHHEIIFKNGDDLRQDMLTLQVIRIMDSIWQKEGLDLRMMPYACLSTGKHVGMIEVVRNAKTVMNIQKKGGRMAAFQVDSTQLHKWIKEKNRG-DRYKQAIETFTLSCAGYCVATFILGIGDRNPDNIMVNEEGQIFHIDFGHFLGHFKKKFGINRERVPFVLTEDFLHVIAKGQENPRKSKEFQSFQELCGKAYLLLHRHANLLITLFTMMLSTGIPELQSIDDIGYLRKTLQVEKSEEQALEYFQNQFFEAYGGAWTTKVDWFFH 1039          
BLAST of pi3k-like protein vs. Ensembl Cavefish
Match: zgc:158659 (phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform [Source:NCBI gene;Acc:103032909])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 386/1061 (36.38%), Postives = 588/1061 (55.42%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKK---EHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTC------LYITTLISYKSVNPF-KCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL----LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVN---YYYQEQS--------PVRIMG--------------SPISTT-IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V   LPN  +      R+A L  +K  L  E +   +Y   LL   S YIF GV ++AE EE+YDE++ LC+L L   +L  +E  GN +E     ++N  IGF +     E+  + D E+ + R+S L V ++   E E   A+   + ++         +  ++ Q+ Q + C      L +T  +     N   K  + I+ +   ++ I + +  K  S     +    +   E   +Y+LKV   D YLL     +  Y Y++SC+   + P L L  ++ L   +  + F+ P Y  +  PQ          S   SL     L+  +L+C        ++  K+YVR  +++G    +     +  V   +P WNE L +DIY +++PR+A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + L LWP     ++   NP G   S  N+ +  + +  S  N    +  EQ           R +G              S IS   +++++++  RD LYELSEQ+ D+L  +   C+ +PESLP+L  +++WN+  EV+  Y LL  WP +  ES+L+LL  NF D ++R+FA++ L   LT+  I+ YLLQLVQ LKYE Y  N L+ FL++ AL N+++G  FFW LKSEMHN+++   F L+LEAFCR    ++  +  Q   ++KLV ++  LK +++D     Q+  L E++   D+ E  +   S LN   + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE VK++ T+M IQ +  +  A+Q NS++L+ WI+  N+  E + KA++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G      + +F  F  +C KAYL +R+H+SL + L+S+++  G+PEL    D+ YLRKTL++E  ++ AL YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCCLPNGMLVSLECLREAPLISVKQQLFAEARKYPLYH--LLQEESCYIFVGVTQEAEREEFYDETRRLCDLRLFHPILKVIEPLGNREEK----ILNREIGFAIGMPICEFELVKDPEVQDFRRSILSVCREAMEEREGGGAHTQALYVYPP-------SVESSPQLPQHIYCKLDKGRLIVTIWVVVSPSNAKQKYTLKIAHDCLPEQLIAEAIRKKTRSMHLS-AQQLRLCVQEYQGQYILKVCGCDEYLLEKY-PLSQYKYIRSCITVGKLPHLMLVSKDSLYSQLPASGFVAPSY-SRRTPQPSPCPGGSDPSPPRSLWAFNTLLRVRLLCATYVNVNIRDIDKIYVRTGIYHG-GEPLCDNVNTQRVPCSNPRWNEWLTYDIYLTDLPRSARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYKDTLVSGKVALGLWPVPHGLED-LLNPIGVAGSNPNKETPCVELEFSSFNQMVVFPDEQQIEEHANWIVSRELGYNYSLSLSNRLACDSTISQAELEQLRSLCSRDPLYELSEQEKDFLWRHRHYCVNIPESLPKLLLAVKWNSRDEVSQMYCLLRDWPLMQPESALELLDCNFPDPMVREFALRCLIQGLTDDKISQYLLQLVQVLKYEMYLDNPLARFLIKKALTNQRIGHFFFWHLKSEMHNKTVSRRFGLLLEAFCRACGMYLKHLNRQVEAMDKLVNLTDTLKHEKKDETQKTQMKFLVEHMSRPDYMEALQGFVSPLNPVHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFTNNEVIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVKNSYTIMQIQCKGGLKGALQFNSNTLHHWIKEKNKG-EGYDKAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGMQECTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLLLGCGMPELQSFDDIAYLRKTLALEKSQQEALEYFTKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Cavefish
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:103041606])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 377/1058 (35.63%), Postives = 579/1058 (54.73%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG-----FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY---------------------YYQEQSPVRIMGSPISTT--IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVK-FNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   +SYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L   I   IG     F+L   P+           + R++ L V K   E    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       +    +   E   KY+LKV   D YLL     I  Y YV+SC+     P L L  ++ L   + ++ F +P Y  +    T     + S   ++++   +  +++C        ++  K+YVR  +++G   ++     +  V   +P WNE L +D+Y  +IPR A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +      S V +                     Y Q     R+    I T   I +++ + +RD L E++EQ+ D+L  + + C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  D+ +  ++ +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NSS+L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G  +     + F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDLVKDPEVQ---------DFRRNILNVCKDSVELRDVNGPHSRALYVYPPNV-ESSPELPKHIFGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAEQLKMCVQEYQGKYILKVCGCDEYLLEKY-PISQYKYVRSCIMLGRMPNLMLMSKDSLYSQLPMDNFTMPSYSRRISTATPYMNGEVSSKALWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGIYHG-GEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYTHTLVAGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDYFSSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRLARDHIITEADIDQLRQLANRDPLSEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKRALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKG-ETYDMAVDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Cavefish
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:103041606])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 377/1058 (35.63%), Postives = 579/1058 (54.73%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG-----FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY---------------------YYQEQSPVRIMGSPISTT--IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVK-FNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   +SYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L   I   IG     F+L   P+           + R++ L V K   E    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       +    +   E   KY+LKV   D YLL     I  Y YV+SC+     P L L  ++ L   + ++ F +P Y  +    T     + S   ++++   +  +++C        ++  K+YVR  +++G   ++     +  V   +P WNE L +D+Y  +IPR A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +      S V +                     Y Q     R+    I T   I +++ + +RD L E++EQ+ D+L  + + C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  D+ +  ++ +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NSS+L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G  +     + F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDLVKDPEVQ---------DFRRNILNVCKDSVELRDVNGPHSRALYVYPPNV-ESSPELPKHIFGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAEQLKMCVQEYQGKYILKVCGCDEYLLEKY-PISQYKYVRSCIMLGRMPNLMLMSKDSLYSQLPMDNFTMPSYSRRISTATPYMNGEVSSKALWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGIYHG-GEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYTHTLVAGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDYFSSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRLARDHIITEADIDQLRQLANRDPLSEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKRALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKG-ETYDMAVDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Cavefish
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:103041606])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 377/1058 (35.63%), Postives = 579/1058 (54.73%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG-----FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY---------------------YYQEQSPVRIMGSPISTT--IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVK-FNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   +SYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L   I   IG     F+L   P+           + R++ L V K   E    N P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK       +    +   E   KY+LKV   D YLL     I  Y YV+SC+     P L L  ++ L   + ++ F +P Y  +    T     + S   ++++   +  +++C        ++  K+YVR  +++G   ++     +  V   +P WNE L +D+Y  +IPR A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +      S V +                     Y Q     R+    I T   I +++ + +RD L E++EQ+ D+L  + + C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  D+ +  ++ +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NSS+L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G  +     + F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDLVKDPEVQ---------DFRRNILNVCKDSVELRDVNGPHSRALYVYPPNV-ESSPELPKHIFGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAEQLKMCVQEYQGKYILKVCGCDEYLLEKY-PISQYKYVRSCIMLGRMPNLMLMSKDSLYSQLPMDNFTMPSYSRRISTATPYMNGEVSSKALWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGIYHG-GEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYTHTLVAGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDYFSSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRLARDHIITEADIDQLRQLANRDPLSEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKRALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKG-ETYDMAVDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1061          
BLAST of pi3k-like protein vs. Ensembl Cavefish
Match: pik3ca (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:103041606])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 289/712 (40.59%), Postives = 436/712 (61.24%), Query Frame = 3
Query: 1188 KLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY---------------------YYQEQSPVRIMGSPISTT--IQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVK-FNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            K+YVR  +++G   ++     +  V   +P WNE L +D+Y  +IPR A+LC S+   K  +G  E    L W N+N+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +      S V +                     Y Q     R+    I T   I +++ + +RD L E++EQ+ D+L  + + C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  N+ D ++R FAV+ L   LT+  ++ YL+QLVQ LKYE Y  N L  FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E ++  D+ +  ++ +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NSS+L++W++  N+  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G  +     + F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:  271 KIYVRTGIYHG-GEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNVNLFDYTHTLVAGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFDYFSSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRLARDHIITEADIDQLRQLANRDPLSEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKRALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKG-ETYDMAVDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFH 979          

HSP 2 Score: 65.0846 bits (157), Expect = 4.244e-10
Identity = 40/106 (37.74%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGF 521
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   +SYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L   I   IG 
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGM 123          
BLAST of pi3k-like protein vs. Ensembl Sea Lamprey
Match: pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta [Source:ZFIN;Acc:ZDB-GENE-040426-1128])

HSP 1 Score: 358.992 bits (920), Expect = 7.940e-114
Identity = 186/440 (42.27%), Postives = 276/440 (62.73%), Query Frame = 3
Query: 1917 TNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEI-----SRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            ++ +++ YLLQLVQ LKYE Y  +DL+ FLL+ AL N+ +G   FW L+SEMH  ++ + F LMLEA+CRG +  +  +  Q   + K+  I     S  +K+  +   +  +   L+   + E    + S L        + VE C    SK +P+++ + +     E  +     IFK GDDLRQD+LTLQ+L + D +WK+Q  D++++PYGCL+TG  +G+IE V+ A+T+ +IQ  +SNI A    N  +L  W++A N   +   +A+E FT SCAGY VAT++LGI DRH DNIM+   GQLFHIDFGH L N K KFG+ RERVPF+LT DF+  I +G  +  +S KF+ F   C +AYL LR++  L L L+S M+ +GLPELT  +D++YL++TL++E  E  AL +F ++F +A R +W TK+ W++H
Sbjct:    1 SDDELSQYLLQLVQVLKYEPYLDSDLAKFLLERALANRCIGHFLFWHLRSEMHVPAVSLQFGLMLEAYCRGSIAHVRSLMKQCEALTKMRAINDLVKSSSMKSNNKAKVIDAMHASLRQTSYTEALTGLQSPLKPCVILSQLNVEKCKFMNSKMKPLWMVYSD-----EEGLEPTGAIFKNGDDLRQDMLTLQMLKLMDNMWKQQGLDLRIVPYGCLSTGDKTGLIEMVRRAETIANIQLDKSNIAATAAFNKDALLNWLKAKNHR-DALERAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRETGQLFHIDFGHFLGNFKSKFGIKRERVPFILTYDFVHVIQEG--KTTNSEKFDRFRRYCERAYLILRKNGHLFLNLFS-MLAAGLPELTSPKDIQYLKETLALEKREDDALKHFCQKFNEALRESWKTKVMWMAH 431          
BLAST of pi3k-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002453.1 (pep scaffold:Pmarinus_7.0:GL482029:21191:33947:1 gene:ENSPMAG00000002221.1 transcript:ENSPMAT00000002453.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 357.066 bits (915), Expect = 2.678e-106
Identity = 234/726 (32.23%), Postives = 376/726 (51.79%), Query Frame = 3
Query: 1182 NSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSL----------------IEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQ---DNGYFNPGGSTDSYKNRNSVI----------LSINISKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESS--LQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMH-NESIKIYFALMLEAFCRG-----YLNFMTVIRP----QSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSE-KQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQ-----ANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF 3218
            ++++YV+  +++G   R+A    S     +   W + L F I   ++P  A L  SL                +    R     LL + N+ + ++   L +G   L +WP ++ Q   D      G + +  + R +V+          +++  S+   ++  +   R      S   + +K +++ D L  +   ++  L    ++     +SLPRL +++ W ++  V   +  L  W   + + S  ++LL GNF D  +R+ AV+ L A   N +I L+LLQLVQALK+E Y+ + L+ FL+Q ALR+K+LG  FFWFL+SE+      +  FA++LEA+ RG       NF+  ++     + +G +  +++  +         ++     L+       C  V   L +         +E C V  SKK+P++LE+  AD  S      +K IFK GDDLRQD+L LQ L+I D IW  +  D+ LLPYGC+ATG ++G+IE V +A TV SIQ       +  N   L  W+      A  R  EQ  +A+E F  SCAGY +AT++LGI DRH +NIM+   G LFHIDFGHIL N KK +GV+RERVPFVLT DF+  +    ++   ++ F  F+  C +AYL LR H +L++TL+++M  +G+PE+T  +D+E++R+ L V + E  A  +   +        WT +++W  H 
Sbjct:  357 DAEVYVQAGVYHG-KVRLASVMTSKRPLQEEIVWGDWLEFGIRMKDLPLGACLNLSLYSVRSQSCCDRRWSGLLPSGSRSLEARLLHYVNMTLIDHRSLLRQGEFVLYMWPLQQGQRAPDPSALPSGANPE--QERAAVVSVLLDTYDCPVALPRSQAGVFHMPERAKRFFAEG-SVQDEFLKHLVNVDPLSPVEAPELALLWQMRDSLSRTAQSLPRLLRAVDWGSLECVRETHGFLQHWSMTDFDLSIAMELLDGNFVDGFVRRMAVERL-AASGNDEILLFLLQLVQALKFEPYHDSPLARFLIQRALRSKRLGHFFFWFLRSEIAVCAQSRARFAVLLEAYLRGCGRATLHNFVQQVKLIDSLRIVGDKMQLQLGNLYNVPPNGAPIAPCPPLLRTRVHLHICACVCVPLYVHTCAYTCACIEKCKVLASKKKPLWLEFHRADSTS-LDDSNVKLIFKNGDDLRQDMLILQTLNIMDSIWDSEGLDLCLLPYGCIATGYNTGVIEVVPNAHTVASIQVEK--GGIPRNEGYLKTWLDEQMPLAGQR--EQNLQAVEKFMHSCAGYCMATYVLGIGDRHNENIMITKNGNLFHIDFGHILGNIKKFWGVSRERVPFVLTPDFLCILGAHKNK---NLYFQRFVDTCCRAYLALRRHKNLLITLFNMMATTGMPEVTP-RDIEHMREALVVRATEADAEAHIRSEIEHCIDKGWTVQVNWWMHL 1068          
BLAST of pi3k-like protein vs. Ensembl Sea Lamprey
Match: pik3c2a (phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha [Source:ZFIN;Acc:ZDB-GENE-030328-39])

HSP 1 Score: 269.626 bits (688), Expect = 4.442e-76
Identity = 198/675 (29.33%), Postives = 332/675 (49.19%), Query Frame = 3
Query: 1293 LNFDIYYSNIPRNAKLCFSL---IEKTERGGNE---------VLLGWANINIFNYFGKLIEGSIDLNLWP------FEKIQDNGYFNPGG---STDSYKNRNSVILSINISK---VNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHN-----ESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETC-KNV-SSLLNLSEKQG--NIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNR-ERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +N  +  S +PR   L  SL    + +  GG+            LGWA + +FN+   L  G+  L L P                 P       D    +  +I    +++   + Y +++  P          T + +  I+ +D +  L E D   L     +      +LP L  S      + +   Y+LL  WP ++   +L LL  NF D+ +R+ AV+ + A +++ ++  YL QL+QALK+E Y  N L  FLL  ++ N ++    +W LK  + +      S ++  AL+    C G       +  Q+  +  L  ++  ++      + + L+E +  +   +TC +N  SS L +        +  + C    S   P+ + + NAD   E     ++ +FK GDDLRQD+LTLQ++ I D IW ++  DM+++ + C++TGK+ G++E V  + T+  IQ  + +         L  W+Q +N T +++ KA+E F  SCAG  VAT++LGI DRH DNIM+ T G +FHIDFG  L + +    + R +R PFVLT D    I +G +RP  + +F  F+ LC +AY  +R+H++L L L  +M+ SG+PEL  VQDL+Y+ + L  ++ +  A   F R   ++  G+  TK+++  H
Sbjct:    1 VNLPVQVSQLPRETVLRVSLQGVPQPSASGGSPDSSKQRRSPEQLGWATMPLFNFRQVLTSGTQLLCLGPPSQASYAASCSAAHLLQPDSVILQLDFPPTKLDIIFPTPMARGLWLQYNFEDMDP---------DTRKSLHTIMSKDSVLGLGEDDKVLLWEKRHHLHAQANALPWLLASAPSWQCSALPDVYALLGHWPALSPVHALMLLHSNFADQEVRRTAVEWI-ACVSDDELADYLPQLLQALKHECYLDNALMRFLLGRSMSNIRIAHYLYWLLKDTLEDGHFGGRSHRVLGALLC---CCGR-TLRHDLESQTRLVHTLATVAEKVRQATGSTRQAMLQEGM--EKVQQTCFRNAGSSRLPICPSLAIRGVNQKACSFFNSNAVPLKVSFLNADPSGE----DIQVMFKVGDDLRQDMLTLQMIKIMDKIWLQEGLDMRMVLFKCISTGKERGMVELVLASDTLRKIQVEHGVTG-SFKDKPLAEWLQKHNPTEQEYEKAVENFIYSCAGCCVATYVLGICDRHNDNIMLRTTGHMFHIDFGKFLGHAQMFGNIKRCDRAPFVLTSDMAYVI-NGGERP--TSRFQHFVDLCCQAYNLIRKHTNLFLNLLGLMMSSGIPELADVQDLKYVYEALMPQATDTEATAQFTR-LIESSLGSMATKVNFFIH 650          
BLAST of pi3k-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010071.1 (pep scaffold:Pmarinus_7.0:GL484237:218:13057:-1 gene:ENSPMAG00000009114.1 transcript:ENSPMAT00000010071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 6.709e-52
Identity = 91/239 (38.08%), Postives = 146/239 (61.09%), Query Frame = 3
Query: 2439 KCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFN 3155
            + GDDLRQD+LTLQ++ + + +W ++  DM+++ + CL+TGK  G++E V  A+T+  IQ  + +       + L  W++ +N + +Q+ +A+E F  SCAG  VAT++LGI DRH DNIM+ T G +FH+DFG  L + +    + R+R PFVLT D +  + +G DRP  S  F +F+ LC +AY  +R+H+ L+  L  ++ D G P    ++ L Y+R  L  ++ E  A   F 
Sbjct:    4 QTGDDLRQDMLTLQVMRVMESVWLQEGLDMRMVRFRCLSTGKQRGMVELVPGAETLRRIQGEHGVTG-SFKDTPLALWLRKHNPSEQQYQQAVENFIYSCAGCCVATYVLGICDRHNDNIMLRTTGHMFHVDFGKFLGHAQMFGNIKRDRTPFVLTAD-MAYVMNGGDRPTSS--FQQFVELCCQAYNAIRKHAGLLFNLLGLVSDGGEPGAVHMEGLVYVRDALRPQATEAEAAELFT 238          
BLAST of pi3k-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008978.1 (pep scaffold:Pmarinus_7.0:GL477391:15964:91650:-1 gene:ENSPMAG00000008040.1 transcript:ENSPMAT00000008978.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.890e-29
Identity = 81/266 (30.45%), Postives = 136/266 (51.13%), Query Frame = 3
Query: 2433 IFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHI--DFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKL--REHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF 3218
            IFK GDD RQD+L LQ++ +F  I++    D+ + PY  +AT    G+IE + D K+   + R   I   +      Y   Q  + + E F KA   F RS A YS+  F+L I+DRH  NIM++++G L HI  DFG +  +     G N    P +   D +  I  G    +++  F  FM +C + YL +  R +   +++L ++M+D+GLP   + Q ++ L++  +    E+ A NY  +   + +  N +   D + ++
Sbjct: 1852 IFKVGDDCRQDMLALQIIGLFKNIFQLVGMDLFVFPYRVVATSPGCGVIECIPDCKSRDQLGRQTDIGMYE------YFRNQYGDESTEAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDSQGHLIHIVLDFGFMFESSP---GGNLGWEPDIKLTDEMVMIMGGK---MEATPFKWFMEMCVRGYLAVSNRPYMDAVISLVALMLDTGLPCF-RGQTIKLLKQRFAPNQSERDAANYMIKIIQNCFLSNRSKTYDMIQYY 2104          
BLAST of pi3k-like protein vs. Ensembl Yeast
Match: VPS34 (Phosphatidylinositol (PI) 3-kinase that synthesizes PI-3-phosphate; forms membrane-associated signal transduction complex with Vps15p to regulate protein sorting; activated by the GTP-bound form of Gpa1p; a fraction is localized, with Vps15p, to nuclear pores at nucleus-vacuole junctions and may facilitate transcription elongation for genes positioned at the nuclear periphery [Source:SGD;Acc:S000004230])

HSP 1 Score: 142.895 bits (359), Expect = 3.641e-35
Identity = 157/620 (25.32%), Postives = 276/620 (44.52%), Query Frame = 3
Query: 1497 NPGGSTD-SYKNRNSVILSINIS-KVNYYYQEQSPVRIMGSPISTTIQRIK-----AIIDRDWLYELSEQD-----IDY-----LRSNLENCLWV--------PESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLL-----------------------------------------------QLVQALKYES---------YYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAF-------CRGYLN----FMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSI--QRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPEL 3074
            NPG STD    NRN   + I++  K +   +   P +    PI    +R++     A +D+    ++ ++D     I+Y     L ++ +  +W          ++L +L +S      +E      L+  W  I+++ +L+LL   F +  +R +AV  L+   ++ ++ LYLL                                               +L++++  ES            + L+ FL++ AL N +LG  F+W+LKSE  +   K Y   +L +F        R  LN     + V+R     I++L + +    A++ +L +  L+  ++        + ++  L+      ++  ET  V KS   P+ + ++     +  + P    +FK GDDLRQD L +Q++S+ + + K +  D+KL PY  LATG   G IE + +  T+ SI  +   I+  ++++           N T       L+ F +SCAGY V T+ILG+ DRH DN++V   G  FH DFG+IL    K F     ++P  + E F      G+    +S  +++F   C  AY  LR ++ LIL L+ +M  S +P++
Sbjct:  235 NPGLSTDLREPNRNDPQIKISLGDKYHSTLKFYDPDQPNNDPIEEKYRRLERASKNANLDKQVKPDIKKRDYLNKIINYPPGTKLTAHEKGSIWKYRYYLMNNKKALTKLLQSTNLREESERVEVLELMDSWAEIDIDDALELLGSTFKNLSVRSYAVNRLKKA-SDKELELYLLQLVEAVCFENLSTFSDKSNSEFTIVDAVSSQKLSGDSMLLSTSHANQKLLKSISSESETSGTESLPIVISPLAEFLIRRALVNPRLGSFFYWYLKSESED---KPYLDQILSSFWSRLDKKSRNILNDQVRLINVLRECCETIKRLKDTT----AKKMELLVHLLETKVRP---LVKVRPIALPLDPDVLICDVCPETSKVFKSSLSPLKITFK-----TTLNQP-YHLMFKVGDDLRQDQLVVQIISLMNELLKNENVDLKLTPYKILATGPQEGAIEFIPN-DTLASILSKYHGILGYLKLHYPD-------ENATLGVQGWVLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPP-LMKLPPQIIEAF-----GGA----ESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDI 819          
BLAST of pi3k-like protein vs. Ensembl Yeast
Match: STT4 (Phosphatidylinositol-4-kinase; functions in the Pkc1p protein kinase pathway; required for normal vacuole morphology, cell wall integrity, and actin cytoskeleton organization [Source:SGD;Acc:S000004296])

HSP 1 Score: 134.806 bits (338), Expect = 2.862e-32
Identity = 81/240 (33.75%), Postives = 122/240 (50.83%), Query Frame = 3
Query: 2433 IFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQA--NNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVE-SDEKAAL 3143
            IFK GDD RQD+L LQL+S+F  IW     D+ + PY   AT    G+I+ + ++ +   + R  +        + LY +  +   N +  +F  A   F +S AGYSV +++L  +DRH  NIM + +G   HIDFG I +      G+  E VPF LT++ +K +      P     + +F  LC KAYL  R H   I+   + M+ SGLP     + +  LR     + +D +AAL
Sbjct: 1645 IFKVGDDCRQDVLALQLISLFRTIWSSIGLDVYVFPYRVTATAPGCGVIDVLPNSVSRDMLGREAV--------NGLYEYFTSKFGNESTIEFQNARNNFVKSLAGYSVISYLLQFKDRHNGNIMYDDQGHCLHIDFGFIFDIVPG--GIKFEAVPFKLTKEMVKVMGGSPQTP----AYLDFEELCIKAYLAARPHVEAIIECVNPMLGSGLPCFKGHKTIRNLRARFQPQKTDHEAAL 1870          
BLAST of pi3k-like protein vs. Ensembl Yeast
Match: PIK1 (Phosphatidylinositol 4-kinase; catalyzes first step in the biosynthesis of phosphatidylinositol-4,5-biphosphate; may control cytokinesis through the actin cytoskeleton; may control nonselective autophagy and mitophagy through trafficking of Atg9p [Source:SGD;Acc:S000005211])

HSP 1 Score: 98.9821 bits (245), Expect = 2.266e-21
Identity = 81/298 (27.18%), Postives = 147/298 (49.33%), Query Frame = 3
Query: 2358 KKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRS---NIIAAMQMNS----SSLY-RWIQA-NNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIM--------IDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKI 3200
            +K   Y  +EN D+ S         I K GDDLRQ+    Q++     IW ++  D+ +     L T  ++G++E + +A +V SI+++    +I   +++     +SL   +++A  N    ++ +A + F  S A YSV  ++L ++DRH  NIM++ +G + HIDFG +L+N     G   E  PF LT ++I+ +       ++   F +F+ L   ++  LR+++  I+++  IM         D+G  E T VQ    LR+   ++  EK   ++          G+  T+I
Sbjct:  777 RKTSEYGHFENWDLCS--------VIAKTGDDLRQEAFAYQMIQAMANIWVKEKVDVWVKRMKILITSANTGLVETITNAMSVHSIKKALTKKMIEDAELDDKGGIASLNDHFLRAFGNPNGFKYRRAQDNFASSLAAYSVICYLLQVKDRHNGNIMIDNEGHVSHIDFGFMLSNSPGSVGF--EAAPFKLTYEYIELLGG-----VEGEAFKKFVELTKSSFKALRKYADQIVSMCEIMQKDNMQPCFDAG--EQTSVQ----LRQRFQLDLSEKEVDDFVENFLIGKSLGSIYTRI 1053          
BLAST of pi3k-like protein vs. Ensembl Yeast
Match: TOR1 (PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that controls growth in response to nutrients by regulating translation, transcription, ribosome biogenesis, nutrient transport and autophagy; involved in meiosis; TOR1 has a paralog, TOR2, that arose from the whole genome duplication [Source:SGD;Acc:S000003827])

HSP 1 Score: 63.5438 bits (153), Expect = 1.638e-10
Identity = 55/201 (27.36%), Postives = 91/201 (45.27%), Query Frame = 3
Query: 2427 KFIFKCGDDLRQDILTLQLLSIFDWIWK------------RQFQDMKLLP-YGCLATGKDSG----IIEAVKDAKTV-----------MSIQRSNII----------AAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVN-TKGQLFHIDFGHILNNR--KKKFGVNRERVPFVLT 2906
            K++ K  +D+RQD L +QL  + + + K            +Q+  + L P  G L    +S     +I   +DAK +           M+    N+           A        LY+ +   +R+ E + +   T+TRS A  S+  +ILG+ DRHP N+M++   G++ HIDFG        ++K+    E+VPF LT
Sbjct: 2120 KYVLKGHEDIRQDSLVMQLFGLVNTLLKNDSECFKRHLDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQKIEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKYP---EKVPFRLT 2317          
BLAST of pi3k-like protein vs. Ensembl Yeast
Match: TOR2 (PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that regulates growth in response to nutrients and TORC2, a complex that regulates cell-cycle dependent polarization of the actin cytoskeleton; involved in meiosis; TOR2 has a paralog, TOR1, that arose from the whole genome duplication [Source:SGD;Acc:S000001686])

HSP 1 Score: 63.5438 bits (153), Expect = 1.797e-10
Identity = 51/201 (25.37%), Postives = 89/201 (44.28%), Query Frame = 3
Query: 2427 KFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQ----DMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAA-----------MQM-----------------------NSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVN-TKGQLFHIDFGHILNNR--KKKFGVNRERVPFVLT 2906
            K++ K  +D+RQD L +QL  + + + +   +     + +  Y  +     SG++  V ++ T   + R +  A            +QM                           LY+ +   +R+ E + +   T+TRS A  S+  +ILG+ DRHP N+M++   G++ HIDFG        ++KF    E+VPF LT
Sbjct: 2124 KYVLKGHEDIRQDSLVMQLFGLVNTLLQNDAECFRRHLDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHREAKKIPLNIEHWVMLQMAPDYDNLTLLQKVEVFTYALNNTEGQDLYKVLWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKFP---EKVPFRLT 2321          
BLAST of pi3k-like protein vs. Ensembl Nematostella
Match: EDO42011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J3])

HSP 1 Score: 505.368 bits (1300), Expect = 1.189e-161
Identity = 348/1059 (32.86%), Postives = 548/1059 (51.75%), Query Frame = 3
Query:  177 YYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLI-----SYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSF----EFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSV-SKMFSLLLISAQLICKENSK----------LYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLI--------EKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNS---VILSINISKVNYYY----------QEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYL-RSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQ---LSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIA-AMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + + S    V V  LLP   +    V  +A+L EIK+ L +E  +  ++   LL   SSY+F  VN   + EE  DE++ L ++     +L  +E+KG+ +E  L+S I+  IG NL    +      D         Y+E + KE   L      +  +    + +E T +   Q L       I+  I     S K ++ F     +S + T  E +  ++L K+ +     +FD   D           YVLK+   +SYLL     ++ Y Y+  C+   + P LSL  R  L    +N  ++       I           V S   SL  I  QL  K  S           + VR A+++G N  ++  +++   S + P WNE +N +I   +IPR A+LC  L          + ++  + + L W N+ +F++ G L +G + ++ WP  +   +   NP G+  S  N ++   +++       N  Y           E +   I        +++++ +IDR+ L  + E D +++ R+ +E   + P SL RL   ++WN   +V     LL  WP ++ E +L+LL  N+ D+ +R+FAV+ +   + ++D+  Y+LQLVQ LKYESY   +L+ FLL+  L N+ LG + FW L++EMHN  + + F LMLEA+CRG    M  ++ Q   + K+  IS +L+    D +   L T+KE L+   + +    ++S LN S +   + V+ C    SK RP++L++EN   F E   P +K IFK GDDLRQD+LTLQL+ I D +WK+   D++++PYGCL+TG   G+IE V +++T+  IQ   + A     N + +  W+   N + E   +A   F  SCAGY VAT++LG+ DRH DNIMV+  GQLFHIDFGH L N K KFG+ RERVPFVLT+ F+  I  G+D   ++  F EF  +C +A+L LR   SL++ L+ +M+ +G+PEL  + D+ YLRKTL++   E+ AL YFNR+F +A   +W T I+W  H
Sbjct:   10 WASLSACTPVDVDCLLPTGVLIPIEVRIEATLGEIKNKLWREAASYPLFN--LLKEMSSYVFVCVNLQGKQEELVDENRQLIDVRPFRPMLKLIEKKGDREEKLLSSKISVLIGKNLHEFDQMKNPEVDEFRRRY-AEYVEGIAKERSKLDWEGRAMYAYPVEIEQSEETPAYVAQKLNENRRFLISVAIRNNRASMKDMHAF----NVSAD-TFPEELLVLVLKKRGAIMGVQDFDNPKD-----------YVLKIVGRESYLLGEY-SLLRYRYISECIAQGKRPQLSLVRRVSL---GVNE-LMDVSGKSGIQHRPPPPLPPKVESAELSLWSIETQLRVKILSADNINVGDVMMVGVRGAIYHG-NEVLSDIKQTKPQSGNKPLWNEFINLNILVCDIPRMARLCLVLFGVYVKAAARRKKKNLDYIPLAWVNVTLFDFRGNLRQGPLTIHAWPVPETMPD-LLNPIGTVVSNINTSTSPCLVIEFQRYANNVVYPAYDKILQLAAETTDQEIFKKTGDNELEQLRQVIDREPLAPIFELDKEFVWRARMECRDYYPHSLGRLLSCVKWNCKEDVAQMQVLLQIWPEMHPELALELLDCNYADQKVREFAVRCIEK-MGDSDLMHYMLQLVQVLKYESYLDCELARFLLKRTLNNQNLGHELFWLLRAEMHNPEVSVRFGLMLEAYCRGSPAHMKSLQKQLEALNKMKTISSLLQHVDRDKRAQGLQTMKECLQQKTYQDALSRLTSPLNPSYRLKQLKVDNCKYMDSKMRPLWLDFEN---FDELGEP-VKIIFKSGDDLRQDMLTLQLIRIMDRLWKKDGLDLEMIPYGCLSTGDHVGMIEVVTNSETIAKIQMKQMGAITGAFNKTCILDWLADRNGSKEALVEATHRFMLSCAGYCVATYVLGVGDRHSDNIMVHENGQLFHIDFGHFLGNFKNKFGIRRERVPFVLTDHFVHVITRGND---NTEGFQEFRRICEQAFLVLRRRGSLLINLFVMMLSAGIPELRSLDDIGYLRKTLNLNVSEEKALEYFNRKFNEAVDNSWKTSINWAIH 1034          
BLAST of pi3k-like protein vs. Ensembl Nematostella
Match: EDO45977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA6])

HSP 1 Score: 292.738 bits (748), Expect = 3.169e-82
Identity = 216/664 (32.53%), Postives = 337/664 (50.75%), Query Frame = 3
Query: 1281 WNEKLNFDIYYSNIPRNAKLCFSLI-EKTERGGN---EVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGS-TDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDI-DYLRSNLENCLW--------VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIG-----IEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            W + L FDI    +PR ++LC +L   K    GN      LGW  + +FN+ G L+ G+  L LWP  K       NP GS T +  + NSV+L +   +   Y  E         P    +       D     E+  +D+ + L+ N  + LW        VP +LP +  S     +  +   Y LL  W  ++   +++LL  NF D+ +R  AV+ + A  ++ ++  YL QLVQALKYE Y+ + L+ FL++ AL N +L    FWFLK ++        F ++L     G LN     + +        + +L++++R +K+ ++  + + L++ L        C     +    E  G + V +C    S   P+ L + N D F E     +  IFK GDD+RQD LT+QL+ I + IW ++  D+K++ Y C+ATG   G+IE V D++T+  I     +        S+ RW+   N   +++ +A+E FT SCAGY VAT++LGI DRH DNIM++  G LFHIDF  IL + +      R+R PFVLT D    I +G  RP  S +F  F+ LC +A+  +R HS+L L L S+M++SG+  L  V DL Y+R +L  +  E  A   F R   ++   +W T++++  H
Sbjct:  370 WGDWLKFDIPVKRLPRESRLCLTLYGTKPSSKGNPSARSALGWVALQLFNFNGVLLTGTQILGLWPDSKA------NPVGSCTSNLLHPNSVLLLVTFER---YLSEIVFPDCSDFPGFDDMDHCIPEADYGLFEEILMKDLFNELKPNERSILWEHRFYCRSVPRALPLVLSSAPSWEIQSLPEIYKLLHTWSPMSPVDAMELLKVNFPDRHVRSMAVRWM-ANFSDDELCDYLPQLVQALKYEIYHDSALTRFLVRRALGNVRLMHLLFWFLKDKISEPQFGQRFQVILG----GLLNICGEAQKEEFTFQDDLVTELIKVARKVKSAKDSARNNILQQELAALAGKLCCVFRLPITPSLEVVG-MDVRSCGYFTSNSAPLRLVFRNVDPFGE----NVNVIFKMGDDMRQDTLTMQLVGIMNKIWLQEGLDLKIITYQCMATGPGMGMIEIVSDSQTLREIHTEFGLTG-SFKDESINRWLLKFNPDEKEYRRAVENFTASCAGYCVATYVLGICDRHNDNIMIHRSGHLFHIDFSKILGHAQMFGNFKRDRAPFVLTPDMAYVI-NGGYRP--SPRFQHFIDLCSRAFNLIRRHSNLFLNLLSLMLNSGIGSLGNVSDLRYIRDSLLPQESEAEATAAFTR-LIESSLSSWFTQVNFFIH 1009          
BLAST of pi3k-like protein vs. Ensembl Nematostella
Match: EDO42545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S165])

HSP 1 Score: 139.043 bits (349), Expect = 4.095e-33
Identity = 126/476 (26.47%), Postives = 226/476 (47.48%), Query Frame = 3
Query: 1884 QFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEM-------HNESI--------------------KIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSS----LLNLSEKQGNII-VETCDVKKS-KKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKI 3200
            Q+A++ L++   ++ I +Y+ QLVQA +Y++  F  ++ +++ +A  ++ L  +  W +K+ M       H +S                     + ++    E F +   N   VI+P   G E+     R L   R +    L  +     L+ D  + T    ++    L     K+  I  +E+ +VKK           EN +++ + +I      FK GDD+RQD+L LQ++S+F  I+++   D+ L PY  +AT    G+IE V D+K+   + R   +   +      Y      + +   F +A   F +S A YS+ +F+L I+DRH  N+M++ +G + HIDFG +  +     G N    P +     +  I  G+   ++S  F  FM LC K+YL +R +   +++L ++M+D+GLP   + + L+ LR   S    EK A  Y ++   D+Y  N+ T++
Sbjct: 1219 QYAIRVLQSFPPDS-ILIYIPQLVQATRYDALGF--VTEYIIWAAQHSQLLAHQLIWNMKTNMFVDEEGLHKDSQIGDHLDQLIGRITSTVSGPERDFYTREFEFFDK-VTNISAVIKPFPKGPERKEACLRALGDIRAEKGVYLPSNPEAMVLEIDQTSGTPMQSAAKAPFLAKFKVKRMGIAELESINVKKDFPCDSDEANQENPNVYWQAAI------FKVGDDVRQDMLALQVISLFKNIFEQVGLDVYLKPYRVVATSPGCGVIECVPDSKSRDQLGRQTEVDLYE------YYLKTYGDESTPAFQQARSNFIKSMAAYSIVSFLLQIKDRHNGNLMLDREGHIIHIDFGFMFESSP---GGNLGFEPDMKISHEMVMIMGGT---MESPPFRWFMDLCVKSYLAVRPYQEALVSLVALMLDTGLPCF-RGETLKRLRARFSPAQSEKEAATYMSKVIRDSYL-NYRTRV 1670          
BLAST of pi3k-like protein vs. Ensembl Nematostella
Match: EDO45547 (Phosphatidylinositol 3-kinase [Source:UniProtKB/TrEMBL;Acc:A7RSD9])

HSP 1 Score: 125.176 bits (313), Expect = 4.051e-29
Identity = 112/409 (27.38%), Postives = 188/409 (45.97%), Query Frame = 3
Query: 1947 QLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFL----KSEMHNESIKIYFALMLE---AFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLST--------LKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFA-----KALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELT--------KVQD 3089
            Q +  +K  S    DL+ FL+  A ++  +   F+W+L    K +  ++   +Y  +M +   A  +G  ++   +R   +G ++   I  I++  +E  Q S         L+E L   D  E  +     L L      + V    + KS   P  L       F + +      IFK GDDLRQD L LQ++ + D +  ++  D+KL PY  LAT    G+++ ++          SN +A +     S+  + +  +  CE        + ++T+ +SCAGY V T++LG+ DRH DN+++   G LFHIDFG+IL          R+  P        K + +G     +   +  F   C  A+L LR H++LIL L+ +M+D+ +P++         KVQD
Sbjct:  460 QELDEVKSSSLKTADLASFLITRACKSDTVANYFYWYLLVECKEDKDSKVANMYRNIMRKFSKALMKG--SWECKVRRNMLGKQQQF-IDHIVRLMKEVSQFSGNRSRKIHRLRELL---DTPELTRFGPLPLPLDPDVRIMEVVKAWLFKSHLMPAKL------TFRDINEQEYVVIFKNGDDLRQDQLILQMIRLMDKLLMKENLDLKLTPYKVLATSASHGLVQFIE----------SNAVAEVLDKDGSIQNYFR-KHAPCETGPNGISPEVMDTYVKSCAGYCVITYLLGVGDRHLDNLLLTKSGNLFHIDFGYIL---------GRDPKPLPPPMKLSKEMVEGMGG-ANGECYQAFRKQCYTAFLHLRRHANLILNLFGLMVDASVPDIALEPDKTVKKVQD 835          

HSP 2 Score: 52.373 bits (124), Expect = 1.196e-6
Identity = 42/149 (28.19%), Postives = 64/149 (42.95%), Query Frame = 3
Query: 1107 RRTRQDSVSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEK-TERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYF---NPGGSTDSYKNRNSV 1541
            +R RQ     +   LL  + L   E S LYV   ++        P   S    S    WNE L   I Y ++PRNA+L F++ +    R    V  G   +++F  +G L  G  DL +WP   ++ +G      PG +T +    N +
Sbjct:   32 KRDRQGHKELLDDPLLRYSGLYQSECSDLYVTCTIYADDRPLSLPTGTSYRPFSTRWNWNEWLKLPIKYPDLPRNAQLAFTIWDVYGPRKSTPV--GGTTVSLFGKYGTLRHGMHDLKVWP--GVEADGKMPTSTPGKTTATEDQMNRL 176          
BLAST of pi3k-like protein vs. Ensembl Nematostella
Match: EDO27738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8E9])

HSP 1 Score: 80.4925 bits (197), Expect = 3.410e-16
Identity = 69/227 (30.40%), Postives = 98/227 (43.17%), Query Frame = 3
Query: 2433 IFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELT--------KVQD 3089
            IFK GDDLRQD L LQ++ + D +  R F      PY   A GK                                  R   ++        K L T   S +GY V T++LG+ DRH DN+++   G LFHIDFG+IL          R+  P        K + +G     +   +  F   C  A+L LR H++LIL L+ +M+D+ +P++         KVQD
Sbjct:  108 IFKNGDDLRQDQLILQMIRLMDKV--RIFG-----PYS--ACGK---------------------------------IRSTFSDFAPPPPQEKILGTGLLSVSGYCVITYLLGVGDRHLDNLLLTKSGNLFHIDFGYIL---------GRDPKPLPPPMKLSKEMVEGMGGA-NGECYQAFRKQCYTAFLHLRRHANLILNLFGLMVDASVPDIALEPDKTVKKVQD 282          
BLAST of pi3k-like protein vs. Ensembl Medaka
Match: pik3ca (phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform [Source:NCBI gene;Acc:101168152])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 379/1058 (35.82%), Postives = 592/1058 (55.95%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIG-----FNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQI---LQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSL-LLISAQLIC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSI-----------------------NISK---VNYYYQEQSPVRIMGSPISTTI-QRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  +K  L KE +   +Y   LL   SSYIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E  L+  I   IG     F+L   P+           + R++ L V K+  +    N P+   ++ Y  +  E +T   R I   L     + +  +I   S +  K  + IS +  V E +    + KK            +   E   KY+LKV   D YLL     +  Y YV+SC+     P L L  ++ L   +  + F +P Y  +    T     + S   ++++  ++  +++C        ++  K+YVR  +++G   ++     +  V   +P WNE L++D+Y   IPR A+LC S+   K  +G  E    L W NIN+F+Y   L+ G + LNLWP     ++   NP G T S  N+ +  L +                       NIS+    NY +   S      +P++    ++++ + +RD L E++EQ+ D+L  +  +C+ +PE LP++  +++WN+  EV   Y LL  WP I  E +++LL  NF D ++R+FAVK L   LT+  ++ YL+QLVQ LKYE Y  N L+ FLL+ AL N+++G  FFW LKSEMHN+++   F L+LE++CR    ++  +  Q   +EKL+ ++ +LK +++D    +Q+  L E ++  D+ +  ++ +S LN + + GN+ +E C +  S KRP++L WEN D+ SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+++ T+M IQ +  +  A+Q NS +L++WI+  N+  E + +A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ G+     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL+++  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 IVVDCLLPNGMILSLECLREATLVTVKHELFKEARKYPLYH--LLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILSREIGFAIGMPICEFDLVKDPEVQ---------DFRRNILNVCKEAVDLRDNNGPHSRALYVYPPNV-ESSTDLPRHIYNKLDKGQIIVVIWVIISPSNDKQKYTLKISHD-CVPEQVIAEAIRKKTRSMLLSQEQLKMCVQEYQGKYILKVCGCDEYLLEKY-PLSQYKYVRSCIMLGRMPNLMLMSKDSLYSQLPSDNFTMPSYARRISTATSYMNGETSSKNLWTINGMLKIRILCATYVNVNIRDIDKIYVRTGIYHG-GEQLCDNVNTLRVPCSNPRWNEWLSYDMYILEIPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTHTLVAGKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFEQFSSPVKFPDMAYVEEHANWNISRELGFNYSHTGLSNRLARDNPLTDNDNEQLRQVCNRDPLSEITEQEKDFLWRHRHSCINIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAMELLDCNFPDPMIREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLKQEKKDEAQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLWLNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWIKDKNKG-EMYDQAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKEDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. Ensembl Medaka
Match: PIK3CA (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:101161626])

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 383/1055 (36.30%), Postives = 581/1055 (55.07%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSM-TCLYITTLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQL----IC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINI----SKVNY-------YYQEQSPVRIMGSPISTTIQ----------------RIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   + YIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K   E   AN P+   ++ Y  +  E +    + I   +     I  +    S N  K   T+      V E +    + KK            +   E   KY+LKV       L     I  Y Y++SC+     P L L  ++ L   +  + F++P Y  + I         ++  K  SL  IS  L    +C        ++  K+YVR  +++G   ++     +  V   +P WNE LN+D+Y  +IPR A+LC S+   K  +G  E    L W NIN+F+Y   L+   + LNLWP     ++   NP G T S  N+ +  L +      S V Y        +   +  R +G   +T+ Q                ++K + +RD L E++EQ+ D+L  +   C+ +PE LP++  +++WN+  EV   Y LL +WP I  E +++LL  N+ D ++R FAV+ L   L +  ++ YL+QLVQ LKYE Y  N L+ FLL+ AL N+++G  FFW LKSEMHN+++   F L+LEA+CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E +K  D+ +  +N +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NS++L++W++  NR  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ GS     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL++E  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETCYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFAIGMPVCEFDLVKDFEVQDFRRNILNVCKDAVELRDANGPHSRALYVYPPNV-ESSQDLPKHIYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLKMCVQEYQGKYILKV-CGCDEYLLEKYPISQYKYIRSCIMLGRLPNLMLMAKDSLYSQLPTDSFVMPSYC-RRISTATSYMNGEAAPK--SLWTISGGLRIRILCATYVNVNIRDIDKIYVRTGIYHG-GEQMCDNVNTQRVPCSNPRWNEWLNYDMYILDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYNHTLVANKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFEHFSSPVKYPDMNAVEEHANWTISRELGFNYNTSGQSNRVARDHALTDSDSEQLKQLSNRDPLSEITEQEKDFLWRHRHYCMNIPEILPKILLAVKWNSRDEVAQMYCLLKEWPSIRPEQAMELLDCNYPDPMVRHFAVRCLDKFLADDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMRFLVEQMKRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSEMLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSLGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNRG-EMYDMAVDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGSQECTKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALEKGEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1060          
BLAST of pi3k-like protein vs. Ensembl Medaka
Match: PIK3CA (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha [Source:NCBI gene;Acc:101161626])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 368/1032 (35.66%), Postives = 557/1032 (53.97%), Query Frame = 3
Query:  204 VTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIAN-PNDIVIFQYGADYNEFTTSTARQILQSMTCLYIT-----TLISYKSVNPFKCVVTIS-KEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYL-ENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQL----IC--------KENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIE-KTERGGNE--VLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQRED----LQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ-RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            + V  LLPN  +      R+A+L  IK  L KE +   ++   LL   + YIF  V ++AE EE+YDE++ LC+L L    L  +E  GN +E     ++N  IGF +     E+  + D E+ + R++ L V K   E   AN P+   ++ Y  +  E +    + I   +   ++T      +    S N  K   T+      V E +    + KK            +   E   KY+LKV       L     I  Y Y++SC+     P L L  ++ L   +  + F++P Y  + I         ++  K  SL  IS  L    +C        ++  K+YVR  +++G   ++     +  V   +P WNE LN+D+Y  +IPR A+LC S+   K  +G  E    L W NIN+F+Y   L+   + LNLWP     ++   NP G T S  N+ +  L +     +      SPV+     ++   +     I R       E   +Y  S   N         R+A+    + +T+ +       KWP I  E +++LL  N+ D ++R FAV+ L   L +  ++ YL+QLVQ LKYE Y  N L+ FLL+ AL N+++G  FFW LKSEMHN+++   F L+LEA+CR    ++  +  Q   +EKL+ ++ ILK +++D    +Q+  L E +K  D+ +  +N +S LN + + GN+ +E C +  S KRP++L WEN DI SE      + IFK GDDLRQD+LTLQ++ I + IW+ Q  D+++LPYGCL+ G   G+IE V+ + T+M IQ +  +  A+Q NS++L++W++  NR  E +  A++ FTRSCAGY VATFILGI DRH  NIMV   GQLFHIDFGH L+++KKKFG  RERVPFVLT+DF+  I+ GS     + +F  F  +C KAYL +R+H++L + L+S+M+ SG+PEL    D+ Y+RKTL++E  E+ AL+YF +Q  DA+ G WTTK+DW+ H
Sbjct:   20 ILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH--LLQEETCYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREE----KILNREIGFAIGMPVCEFDLVKDFEVQDFRRNILNVCKDAVELRDANGPHSRALYVYPPNV-ESSQDLPKHIYSKLDKGWVTGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLKMCVQEYQGKYILKV-CGCDEYLLEKYPISQYKYIRSCIMLGRLPNLMLMAKDSLYSQLPTDSFVMPSYC-RRISTATSYMNGEAAPK--SLWTISGGLRIRILCATYVNVNIRDIDKIYVRTGIYHG-GEQMCDNVNTQRVPCSNPRWNEWLNYDMYILDIPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYNHTLVANKMALNLWPVPHGLED-LLNPIGVTGSNPNKETPCLELEFEHFS------SPVKY--PDMNAVEEHANWTISR-------ELGFNYNTSGQSN---------RVARD---HALTDSDSEQLKQLKWPSIRPEQAMELLDCNYPDPMVRHFAVRCLDKFLADDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLINLTDILKQEKKDETQKVQMRFLVEQMKRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLWLNWENPDIMSEMLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLSLGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNRG-EMYDMAVDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGSQECTKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALEKGEQEALDYFMKQMNDAHHGGWTTKMDWIFH 1010          
BLAST of pi3k-like protein vs. Ensembl Medaka
Match: pik3cb (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:NCBI gene;Acc:101165660])

HSP 1 Score: 446.047 bits (1146), Expect = 1.622e-138
Identity = 290/818 (35.45%), Postives = 450/818 (55.01%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFPILSLYPREYL------ENISINRFI-------IPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLI-CKENSKLYVRVAMFNGINTRIAPEQKS-SLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSL---IEKTER-----------------GGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGST--DSYKNRNSVILSINISKVNYYYQEQSP--------VRIMGSPISTTIQR--------IKAIIDRDWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY----------LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I Y Y++SCL   E P L+L     +      EN +I   +         P   +    T+ +T    VS+ F ++L+    +   EN+K+ VR  +F+G      P   S S   S+H   N  L F+I   ++PR  +LCF++   +EK ++                 G     + W N  +F+Y G+L  G + L+ W     +     NP G+   + Y   N+  L I+      +     P          I GS  ST I R        +K I++RD L +L E + D + +   +C    P+SLP+L  S++W+   ++    +LL  WP+++   +L+LL  N+ D+ +R++AV  LR  +++ ++  YLLQLVQ L+YE YY   L+ FLL+ A +N+++G   FW L+SE+H  ++ I FAL+LEA+CRG +  + V++ Q   + KL  ++ ++K        S  KE           LK   ++E   ++ S LN +    +I VE C    SK +P+++ + N  + S+    TL  IFK GDDLRQD+LTLQ+L + D +WK    D++++PYGCLATG  +G+IE V  A T+ +IQ   SN+ AA   N  +L  W++  N + +   +A+E FT SCAGY VAT++LGI DRH DNIMV + GQLFHIDFGHIL N K KFG+ RERVPF+LT DFI  I  G     +  KF  F   C +AYL LR++ +L +TL+++M+ +GLPELT V+D++YL+ +L++   ++ AL  F ++F +A R +WTTK++W++H
Sbjct:  262 LIQYKYIRSCLQAKESPHLTLVHINAVKTIFDKENAAIGAVVSRKSSNPPLPLPPKKRAPTQVQTCVWDVSRPFKVVLVKGSTVNADENAKVQVRAGLFHGTELLCKPAVSSESSGRSNHSLENNTLEFEISVCDLPRMTRLCFAIYAIMEKVKKKSYKNPHINKYQTIRKAGKVHYPIAWVNTMVFDYKGQLKTGDMILHCWSSFPDELEEMLNPIGTVRINPYPE-NATALHIHFPDYGPHPIVFPPFDKILEKAAEIAGSSDSTPIGRGGKKFHIELKEIMERDPLSQLCENEKDLIWTLRLDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQIWPKLSPRDALELLDFNYPDQYVREYAVSCLRD-MSDEELLQYLLQLVQVLRYEPYYDCALTHFLLERAQKNRKIGHFLFWHLRSEIHMPAVSIQFALILEAYCRGSIPHIEVLKKQVEALSKLKSVNELIKLGTIKNTRSKTKEAMLTKEAMITCLKQSGYSEALSDLHSPLNPNVLLSDINVEKCRYMDSKMKPLWIVYNNKLMSSD----TLGIIFKNGDDLRQDMLTLQILRLMDLLWKEANLDLRIVPYGCLATGDRAGLIEVVSSADTIANIQLTSSNVAAAAAFNKDALLNWLKERN-SGDALERAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGIKRERVPFILTHDFIHVIQQGKTGYTE--KFGSFRQYCEEAYLVLRKNGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSDEEALKQFRQKFDEALRESWTTKVNWMAH 1070          
BLAST of pi3k-like protein vs. Ensembl Medaka
Match: pik3cb (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:NCBI gene;Acc:101165660])

HSP 1 Score: 435.261 bits (1118), Expect = 1.075e-134
Identity = 282/804 (35.07%), Postives = 437/804 (54.35%), Query Frame = 3
Query:  960 IIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKS-SLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSL---IEKTER-----------------GGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGST--DSYKNRNSVILSINISKVNYYYQEQSP--------VRIMGSPISTTIQR--------IKAIIDRDWLYELSEQDIDYLRSNLENCLW-VPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY----------LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQ--RSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            +I Y Y++SCL   E P L+L     ++ I         +  +N       +R+ S   +       A  +        VR  +F+G      P   S S   S+H   N  L F+I   ++PR  +LCF++   +EK ++                 G     + W N  +F+Y G+L  G + L+ W     +     NP G+   + Y   N+  L I+      +     P          I GS  ST I R        +K I++RD L +L E + D + +   +C    P+SLP+L  S++W+   ++    +LL  WP+++   +L+LL  N+ D+ +R++AV  LR  +++ ++  YLLQLVQ L+YE YY   L+ FLL+ A +N+++G   FW L+SE+H  ++ I FAL+LEA+CRG +  + V++ Q   + KL  ++ ++K        S  KE           LK   ++E   ++ S LN +    +I VE C    SK +P+++ + N  + S+    TL  IFK GDDLRQD+LTLQ+L + D +WK    D++++PYGCLATG  +G+IE V  A T+ +IQ   SN+ AA   N  +L  W++  N + +   +A+E FT SCAGY VAT++LGI DRH DNIMV + GQLFHIDFGHIL N K KFG+ RERVPF+LT DFI  I  G     +  KF  F   C +AYL LR++ +L +TL+++M+ +GLPELT V+D++YL+ +L++   ++ AL  F ++F +A R +WTTK++W++H
Sbjct:  262 LIQYKYIRSCLQAKESPHLTLVHINAVKTI---------FDKENAAIGAVVSRKSSNPPLPLPPKKRAPTV-------QVRAGLFHGTELLCKPAVSSESSGRSNHSLENNTLEFEISVCDLPRMTRLCFAIYAIMEKVKKKSYKNPHINKYQTIRKAGKVHYPIAWVNTMVFDYKGQLKTGDMILHCWSSFPDELEEMLNPIGTVRINPYPE-NATALHIHFPDYGPHPIVFPPFDKILEKAAEIAGSSDSTPIGRGGKKFHIELKEIMERDPLSQLCENEKDLIWTLRLDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQIWPKLSPRDALELLDFNYPDQYVREYAVSCLRD-MSDEELLQYLLQLVQVLRYEPYYDCALTHFLLERAQKNRKIGHFLFWHLRSEIHMPAVSIQFALILEAYCRGSIPHIEVLKKQVEALSKLKSVNELIKLGTIKNTRSKTKEAMLTKEAMITCLKQSGYSEALSDLHSPLNPNVLLSDINVEKCRYMDSKMKPLWIVYNNKLMSSD----TLGIIFKNGDDLRQDMLTLQILRLMDLLWKEANLDLRIVPYGCLATGDRAGLIEVVSSADTIANIQLTSSNVAAAAAFNKDALLNWLKERN-SGDALERAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGIKRERVPFILTHDFIHVIQQGKTGYTE--KFGSFRQYCEEAYLVLRKNGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSDEEALKQFRQKFDEALRESWTTKVNWMAH 1040          
BLAST of pi3k-like protein vs. Planmine SMEST
Match: SMESG000011425.1 (SMESG000011425.1)

HSP 1 Score: 2027.68 bits (5252), Expect = 0.000e+0
Identity = 1017/1023 (99.41%), Postives = 1022/1023 (99.90%), Query Frame = 3
Query:  150 MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVINHCIGFNLDNLPKXXXXXXXXXXXNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVXXXXXXXXXXXXKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPISTTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF 3218
            MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNS+YEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVI+HCIG NLDNLPKEYYELYDLELLNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVSSLDSYLLNLNDKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMF+LLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPIS+TIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVI+PQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF
Sbjct:    1 MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLKELKTNSVYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVLNCLERKGNEDESQLTSVISHCIGLNLDNLPKEYYELYDLELLNARKSYLEVVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLISYKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENSIKYVLKVSSLDSYLLNLNDKIIFYDYVQSCLYNNEFPILSLYPREYLENISINRFIIPPYFYQNIPQTKRRTRQDSVSKMFTLLLISAQLICKENSKLYVRVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSLIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPISSTIQRIKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYFALMLEAFCRGYLNFMTVIKPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSHF 1023          
BLAST of pi3k-like protein vs. Planmine SMEST
Match: SMESG000012105.1 (SMESG000012105.1)

HSP 1 Score: 282.722 bits (722), Expect = 1.939e-79
Identity = 213/723 (29.46%), Postives = 366/723 (50.62%), Query Frame = 3
Query: 1179 ENSKLYVRVAMFNGINTRIAPEQKS-SLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSL--------IEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSV--ILSIN-ISKVNYY----YQEQSPVRIMGSPI---------STTIQR--IKAIIDRDWLYE-LSEQDI-----DYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWP-RINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHN-ESIKIYFALMLEAF-------CRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKK--KFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            ++ K+ +   +F+G  +   P+ +  SL S   P     + F +   N+PR  + CF+L        ++       +  +GW N  I+++ G L    I   LW    ++ N   NP GS  S  +   +  +L+I  + K++ +    Y  +  + + G  +         ST  ++  IK  +  D+  + + EQ+I      Y+R+  +      +SLP++  S  WN+   +++ + ++  WP   ++  +L+LL  NF D   R  AV +L  I    +I+LYLLQ+ Q LKYESY  ++   +LL+  + N ++ Q  F+F+K E+   E  K+ FA +L  +       C   L          +  + L++++  L+ +R++  L   +  L++D+       ++  L+ + K   +    C    SK RPI L W+   + +EF+   +  I+K GDDLRQD L LQ++ I D IW+R+  D+KL PY  LA  K  G I+ VK+A+T+ +I R+          S +  W++  N T ++    ++ FTRS A Y VATFILGI DRH DNIM+   G  FHIDFGHIL N K+  +  V+RE   F+L ++F+  +    D          F  LC   Y+ +R+HS+LI +L+  M+++G+PE++ ++DL YL++TL +   ++ A +YF   + D  +      ++W +H
Sbjct:  391 KDQKIVIVAGLFHGGKSLCEPQYREWSLDSLCCP-----IVFTLPLWNLPRMTRFCFALAVVKQTLPLKDIANNTQKKFIGWGNTMIYDHKGILKSDEIRYRLW--SSVKPN--LNPTGSVYSNPDGQLIAPLLAIQFVPKLSKFKKIVYPAKEKLILEGGYLFNNAHTNEPSTENEKEDIKKYLQADFSDDAMQEQEILWKYRYYIRNTYQ------DSLPKILNSKPWNSFENISMMHHVMCGWPIDKDIIIALELLGSNFPDCDTRLMAVDSLSRI-DWQEISLYLLQICQCLKYESYLNSNFIQWLLKIMISNAKIAQTIFYFMKVELSTCEWCKVLFATILYNYLHYSRTRCDSLLKQYYATNELGLQNKTLLQLTS-LEGERKNQALQKFRRSLESDESQRLFNELTCPLDCNIKLKTLDASHCKFMDSKMRPIRLTWK---VSTEFATEYM-IIYKNGDDLRQDSLVLQIMHIMDTIWQRKDLDLKLHPYDVLACSKTEGYIQVVKNAETIANISRT----------SKILNWLKEFN-TEKEMEIVVKNFTRSLAAYCVATFILGIGDRHNDNIMLTKNGHFFHIDFGHILGNFKRIMRGMVSREWTKFILVQEFLDVVESEDD----------FRNLCCDGYIAIRDHSNLIFSLFKAMVNAGIPEISSIEDLNYLKETLQIGKGDEEARSYFQNVYADTRKKEVFITMNWGAH 1071          
BLAST of pi3k-like protein vs. Planmine SMEST
Match: SMESG000012105.1 (SMESG000012105.1)

HSP 1 Score: 282.722 bits (722), Expect = 2.890e-79
Identity = 215/728 (29.53%), Postives = 368/728 (50.55%), Query Frame = 3
Query: 1170 ICKENSKLYVRVAMFNGINTRIAPEQKS-SLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFSL--------IEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRN----SVILSIN-ISKVNYY----YQEQSPVRIMGSPI---------STTIQR--IKAIIDRDWLYE-LSEQDI-----DYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWP-RINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHN-ESIKIYFALMLEAF-------CRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADIFSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKK--KFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNYFNRQFCDAYRGNWTTKIDWLSH 3215
            I  ++ K+ +   +F+G  +   P+ +  SL S   P     + F +   N+PR  + CF+L        ++       +  +GW N  I+++ G L    I   LW    ++ N   NP GS   Y N +    + +L+I  + K++ +    Y  +  + + G  +         ST  ++  IK  +  D+  + + EQ+I      Y+R+  +      +SLP++  S  WN+   +++ + ++  WP   ++  +L+LL  NF D   R  AV +L  I    +I+LYLLQ+ Q LKYESY  ++   +LL+  + N ++ Q  F+F+K E+   E  K+ FA +L  +       C   L          +  + L++++  L+ +R++  L   +  L++D+       ++  L+ + K   +    C    SK RPI L W+   + +EF+   +  I+K GDDLRQD L LQ++ I D IW+R+  D+KL PY  LA  K  G I+ VK+A+T+ +I R+          S +  W++  N T ++    ++ FTRS A Y VATFILGI DRH DNIM+   G  FHIDFGHIL N K+  +  V+RE   F+L ++F+  +    D          F  LC   Y+ +R+HS+LI +L+  M+++G+PE++ ++DL YL++TL +   ++ A +YF   + D  +      ++W +H
Sbjct:  405 IILKDQKIVIVAGLFHGGKSLCEPQYREWSLDSLCCP-----IVFTLPLWNLPRMTRFCFALAVVKQTLPLKDIANNTQKKFIGWGNTMIYDHKGILKSDEIRYRLW--SSVKPN--LNPTGSV--YSNPDGQLIAPLLAIQFVPKLSKFKKIVYPAKEKLILEGGYLFNNAHTNEPSTENEKEDIKKYLQADFSDDAMQEQEILWKYRYYIRNTYQ------DSLPKILNSKPWNSFENISMMHHVMCGWPIDKDIIIALELLGSNFPDCDTRLMAVDSLSRI-DWQEISLYLLQICQCLKYESYLNSNFIQWLLKIMISNAKIAQTIFYFMKVELSTCEWCKVLFATILYNYLHYSRTRCDSLLKQYYATNELGLQNKTLLQLTS-LEGERKNQALQKFRRSLESDESQRLFNELTCPLDCNIKLKTLDASHCKFMDSKMRPIRLTWK---VSTEFATEYM-IIYKNGDDLRQDSLVLQIMHIMDTIWQRKDLDLKLHPYDVLACSKTEGYIQVVKNAETIANISRT----------SKILNWLKEFN-TEKEMEIVVKNFTRSLAAYCVATFILGIGDRHNDNIMLTKNGHFFHIDFGHILGNFKRIMRGMVSREWTKFILVQEFLDVVESEDD----------FRNLCCDGYIAIRDHSNLIFSLFKAMVNAGIPEISSIEDLNYLKETLQIGKGDEEARSYFQNVYADTRKKEVFITMNWGAH 1088          
BLAST of pi3k-like protein vs. Planmine SMEST
Match: SMESG000073245.1 (SMESG000073245.1)

HSP 1 Score: 187.578 bits (475), Expect = 6.798e-48
Identity = 178/683 (26.06%), Postives = 314/683 (45.97%), Query Frame = 3
Query: 1248 KSSLVSSDHPTWNEKLNFD--IYYSNIPRN---AKLCFSL------IEKTERGG-NEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINIS--KVNYYYQEQSPVRIMGSPISTTIQR----IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWP-RINLESSLQLLSGNFFDK-------VLRQFAVKNLRAILTNADINLYLLQLVQALKYE-SYYFNDLSVFLLQSALRNKQLGQKFFWFLKS----EMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIY--------LEWENADIFSEFSIPT-----------LKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMV-LCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVE-SDEKAA 3140
            + S+ +  HP + + + F+  I + N+  N    + C S+      I  ++    +E L+GW  + +F+  G L +G + + LW         +     S  S + + + +L I +    +   Y   S ++I   P     Q+    ++  I+  WL        D +  N+ + LW  +    L  S R      + L  SL+S WP  I  ++   LLS  + D+        +R++AV+ L+ I  ++ I++ +  LV+ALKY+ +   + L   LL  ++ N       FW L S    ++H     +   +++        +   +       ++K  E  +  K    D ++ TL              N+  L +L  KQ     +  D      R  Y        LE ++   F+ F++P             + +FK GDDLRQDIL LQL  + D IW  +  +++++ Y  + TG  SG++E V D  T+  IQ S  IAA   + S +  W++  N T   + K++  F  +CA Y V+T++LGI DRH DNIM+ T G +FHIDF  IL + +   G+ R+RVPFVLT+D +  + D    P D     + ++  C +AY  +R H + ++++ S+   + +P +   + ++Y+ K L ++ SD +A+
Sbjct:  528 QESIATKIHPKFPKCITFNATISFDNLSMNYLTMETCLSIEVFGRRISSSDSPKISEELIGWTEMALFDSAGMLKQGKMLIGLWV-------NHRKLKSSHGSNRQKAAPVLQIELPDFHIPVKYICDSSLKINEIPYLKPTQKESNLLEKFINNMWL-----DSNDKVAQNVCDMLW--KHRGHLLDSPR----KYIALCLSLVSLWPNEIQSDNKDFLLS--YLDRWPHMPLIKIRRWAVEALQKIGPDSCISI-IPWLVEALKYDLNLNSSGLENLLLDFSIMNINFATNLFWQLNSINATDIHGYDAILLLGMLMSLVNNAIFDMWNLQLEMVNHLKKTAESVKAYKGSTIDRKI-TLH------------TNLEELYDLISKQKQSQADEGDHPLCTYRIPYHPGLAIHKLEMKDCSYFNSFTLPLRIVFKGIDEILFEVMFKSGDDLRQDILVLQLFKLMDDIWTNEGLNLRMVHYQVMNTGVRSGLVELVGDCTTLRKIQESKGIAAPLTSISGISEWLKCQNTTKAAYIKSVNNFLLTCAAYCVSTYLLGIGDRHNDNIMIQTSGCIFHIDFAKILGDAQTFAGIRRDRVPFVLTQDMVHVLEDYQPHPDDRRTGMQLLIDKCCEAYNIIRRHWTSLISVLSMAAAANIPGVNN-KTIQYVVKMLRLDYSDIQAS 1175          
BLAST of pi3k-like protein vs. Planmine SMEST
Match: SMESG000073245.1 (SMESG000073245.1)

HSP 1 Score: 184.496 bits (467), Expect = 6.619e-47
Identity = 179/698 (25.64%), Postives = 313/698 (44.84%), Query Frame = 3
Query: 1248 KSSLVSSDHPTWNEKLNFD--IYYSNIPRN---AKLCFSL------IEKTERGG-NEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFNPGGSTDSYKNRNSVILSINIS--KVNYYYQEQSPVRIMGSPISTTIQR----IKAIIDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFYSLLSKWPR------------------INLESS-----LQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQLVQALKYE-SYYFNDLSVFLLQSALRNKQLGQKFFWFLKS----EMHNESIKIYFALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEYLKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIY--------LEWENADIFSEFSIPT-----------LKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGCLATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCEQFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHILNNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMV-LCGKAYLKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVE-SDEKAA 3140
            + S+ +  HP + + + F+  I + N+  N    + C S+      I  ++    +E L+GW  + +F+  G L +G + + LW         +     S  S + + + +L I +    +   Y   S ++I   P     Q+    ++  I+  WL        D +  N+ + LW  +    L  S R      + L  SL+S WP                    NL+ S     L LL  +     +R++AV+ L+ I  ++ I++ +  LV+ALKY+ +   + L   LL  ++ N       FW L S    ++H     +   +++        +   +       ++K  E  +  K    D ++ TL              N+  L +L  KQ     +  D      R  Y        LE ++   F+ F++P             + +FK GDDLRQDIL LQL  + D IW  +  +++++ Y  + TG  SG++E V D  T+  IQ S  IAA   + S +  W++  N T   + K++  F  +CA Y V+T++LGI DRH DNIM+ T G +FHIDF  IL + +   G+ R+RVPFVLT+D +  + D    P D     + ++  C +AY  +R H + ++++ S+   + +P +   + ++Y+ K L ++ SD +A+
Sbjct:  528 QESIATKIHPKFPKCITFNATISFDNLSMNYLTMETCLSIEVFGRRISSSDSPKISEELIGWTEMALFDSAGMLKQGKMLIGLWV-------NHRKLKSSHGSNRQKAAPVLQIELPDFHIPVKYICDSSLKINEIPYLKPTQKESNLLEKFINNMWL-----DSNDKVAQNVCDMLW--KHRGHLLDSPR----KYIALCLSLVSLWPNEIQSDNKDFLLSYLDRCDFNLKDSSFIEILYLLGPHMPLIKIRRWAVEALQKIGPDSCISI-IPWLVEALKYDLNLNSSGLENLLLDFSIMNINFATNLFWQLNSINATDIHGYDAILLLGMLMSLVNNAIFDMWNLQLEMVNHLKKTAESVKAYKGSTIDRKI-TLH------------TNLEELYDLISKQKQSQADEGDHPLCTYRIPYHPGLAIHKLEMKDCSYFNSFTLPLRIVFKGIDEILFEVMFKSGDDLRQDILVLQLFKLMDDIWTNEGLNLRMVHYQVMNTGVRSGLVELVGDCTTLRKIQESKGIAAPLTSISGISEWLKCQNTTKAAYIKSVNNFLLTCAAYCVSTYLLGIGDRHNDNIMIQTSGCIFHIDFAKILGDAQTFAGIRRDRVPFVLTQDMVHVLEDYQPHPDDRRTGMQLLIDKCCEAYNIIRRHWTSLISVLSMAAAANIPGVNN-KTIQYVVKMLRLDYSDIQAS 1192          
The following BLAST results are available for this feature:
BLAST of pi3k-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIK3CA0.000e+035.86phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
PIK3CA1.150e-16634.83phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
PIK3CB1.345e-14938.39phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
PIK3CB1.096e-14835.95phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
PIK3CB1.096e-14835.95phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
age-16.962e-9429.21Phosphatidylinositol 3-kinase age-1 [Source:UniPr... [more]
piki-12.949e-4323.37Phosphatidylinositol 3-kinase piki-1 [Source:UniP... [more]
vps-342.225e-4226.82Phosphatidylinositol 3-kinase catalytic subunit ty... [more]
vps-347.685e-4226.82Phosphatidylinositol 3-kinase catalytic subunit ty... [more]
vps-348.184e-4226.82Phosphatidylinositol 3-kinase catalytic subunit ty... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi3K92E3.738e-12735.99gene:FBgn0015279 transcript:FBtr0083940[more]
Pi3K92E3.738e-12735.99gene:FBgn0015279 transcript:FBtr0083941[more]
Pi3K92E3.738e-12735.99gene:FBgn0015279 transcript:FBtr0334643[more]
Pi3K68D9.322e-5926.73gene:FBgn0015278 transcript:FBtr0076087[more]
Pi3K68D9.322e-5926.73gene:FBgn0015278 transcript:FBtr0301816[more]
back to top
BLAST of pi3k-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1586590.000e+035.99zgc:158659 [Source:ZFIN;Acc:ZDB-GENE-070112-492][more]
pik3ca0.000e+035.22phosphatidylinositol-4,5-bisphosphate 3-kinase, ca... [more]
pik3ca0.000e+035.22phosphatidylinositol-4,5-bisphosphate 3-kinase, ca... [more]
pik3ca0.000e+035.22phosphatidylinositol-4,5-bisphosphate 3-kinase, ca... [more]
zgc:1586594.325e-16842.97zgc:158659 [Source:ZFIN;Acc:ZDB-GENE-070112-492][more]
back to top
BLAST of pi3k-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3ca0.000e+035.99phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3ca2.457e-16435.31phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
slc27a61.177e-14235.39solute carrier family 27 member 6 [Source:Xenbase;... [more]
slc27a65.472e-14234.75solute carrier family 27 member 6 [Source:Xenbase;... [more]
slc27a61.849e-14034.11solute carrier family 27 member 6 [Source:Xenbase;... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pik3ca0.000e+035.58phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
Pik3ca0.000e+035.58phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
Pik3ca0.000e+038.82phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
Pik3cb2.427e-14735.46phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
Pik3cd2.041e-14135.90phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
back to top
BLAST of pi3k-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0G2K344|PK3CA_RAT0.000e+035.77Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
sp|P42336|PK3CA_HUMAN0.000e+035.86Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
sp|P32871|PK3CA_BOVIN0.000e+035.77Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
sp|P42337|PK3CA_MOUSE0.000e+035.58Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
sp|Q9Z1L0|PK3CB_RAT6.854e-14935.23Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
back to top
BLAST of pi3k-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2DJU40.000e+099.41Phosphatidylinositol 3-kinase catalytic subunit ty... [more]
A0A222C6810.000e+076.51Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
A0A2R5LMV60.000e+037.38Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
A0A131YXN40.000e+037.87Phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
A0A1E1XFL80.000e+037.39Putative phosphatidylinositol 3-kinase vps34 invol... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1586590.000e+036.38phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
pik3ca0.000e+035.63phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3ca0.000e+035.63phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3ca0.000e+035.63phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3ca4.244e-1040.59phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3cd7.940e-11442.27phosphatidylinositol-4,5-bisphosphate 3-kinase, ca... [more]
ENSPMAT00000002453.12.678e-10632.23pep scaffold:Pmarinus_7.0:GL482029:21191:33947:1 g... [more]
pik3c2a4.442e-7629.33phosphatidylinositol-4-phosphate 3-kinase, catalyt... [more]
ENSPMAT00000010071.16.709e-5238.08pep scaffold:Pmarinus_7.0:GL484237:218:13057:-1 ge... [more]
ENSPMAT00000008978.11.890e-2930.45pep scaffold:Pmarinus_7.0:GL477391:15964:91650:-1 ... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
VPS343.641e-3525.32Phosphatidylinositol (PI) 3-kinase that synthesize... [more]
STT42.862e-3233.75Phosphatidylinositol-4-kinase; functions in the Pk... [more]
PIK12.266e-2127.18Phosphatidylinositol 4-kinase; catalyzes first ste... [more]
TOR11.638e-1027.36PIK-related protein kinase and rapamycin target; s... [more]
TOR21.797e-1025.37PIK-related protein kinase and rapamycin target; s... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420111.189e-16132.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459773.169e-8232.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425454.095e-3326.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455474.051e-2927.38Phosphatidylinositol 3-kinase [Source:UniProtKB/T... [more]
EDO277383.410e-1630.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of pi3k-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3ca0.000e+035.82phosphatidylinositol 4,5-bisphosphate 3-kinase cat... [more]
PIK3CA0.000e+036.30phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
PIK3CA0.000e+035.66phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3cb1.622e-13835.45phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3cb1.075e-13435.07phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
back to top
BLAST of pi3k-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011425.10.000e+099.41SMESG000011425.1[more]
SMESG000012105.11.939e-7929.46SMESG000012105.1[more]
SMESG000012105.12.890e-7929.53SMESG000012105.1[more]
SMESG000073245.16.798e-4826.06SMESG000073245.1[more]
SMESG000073245.16.619e-4725.64SMESG000073245.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025635
GenBankACT98281.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025635 ID=SMED30025635|Name=pi3k-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3274bp
GCTGAACTCAATATGATCTTTTAAAATTATTAAATAAAGATTTTGAAATA
TTTGATATTTTTATTATATAATTATTATAATATGGTGATTTATGTTCGTG
TTTGTATTTTAGAATAATTTTTTATATAATTTTTATTTTATACTTTCAAA
TGAAAAGATCTGATGTACCCCTTAATTATTATACTTATTCATTTTCTAAT
GATGTTACTGTTATGATATTATTACCAAATTTTTCTGTCGAAGAATTTGT
TGTCAGTCGAAAAGCGTCTCTTTTTGAAATTAAGGATATTTTATTAAAAG
AATTAAAAACTAATTCAATATATGAAGAATTGCTACTGAATAATTTTTCA
TCTTATATATTTTGTGGAGTTAATCGTGATGCTGAAATTGAAGAATATTA
TGATGAATCACAACTTTTATGCAATTTAAATCTTATAGATTTTGTCTTAA
ATTGTCTTGAACGTAAAGGAAATGAAGATGAATCTCAATTAACGTCAGTT
ATAAATCATTGTATAGGATTTAATTTGGATAATCTACCTAAAGAATATTA
TGAATTATATGATTTAGAGTTGCTAAATGCCAGAAAGTCGTACTTAGAAG
TAGTTAAAAAAGAACATGAAAGTTTAATAGCAAATCCAAATGATATTGTG
ATATTTCAATATGGTGCTGACTACAATGAATTTACAACTTCGACAGCAAG
ACAAATACTTCAATCAATGACTTGTTTGTACATCACCACATTAATAAGTT
ATAAAAGTGTCAATCCATTTAAATGTGTTGTAACAATATCTAAAGAGTTT
ACTGTAAAAGAAACTATTTTTAAAATTCTTTTAGATAAAAAAGACTCGTT
TGAATTTGACGGTAGTATGGATCCAAATATTTGGGCGTCTGAAAATTCTA
TTAAATACGTTTTAAAAGTATCTTCACTTGATTCTTATTTATTAAATCTA
AATGATAAAATAATTTTTTATGACTACGTTCAATCTTGTTTGTATAACAA
TGAATTTCCGATTTTAAGTCTATATCCCAGAGAATATCTAGAAAACATAT
CAATTAATCGATTTATAATTCCTCCATACTTTTATCAAAATATTCCGCAA
ACAAAGCGTCGAACTAGACAAGACAGTGTCAGTAAAATGTTTTCACTACT
TTTGATCAGTGCTCAATTAATTTGTAAAGAAAATTCTAAATTATATGTCC
GAGTTGCTATGTTTAATGGAATAAATACTCGGATAGCCCCAGAACAAAAG
AGTAGTTTGGTATCCAGTGACCATCCGACTTGGAATGAGAAACTTAACTT
CGATATCTATTACTCTAATATACCGAGAAATGCAAAGTTATGTTTTTCAC
TGATTGAGAAAACCGAGCGAGGTGGCAATGAAGTACTTCTTGGTTGGGCT
AATATTAATATTTTCAATTATTTCGGCAAATTGATTGAAGGTTCGATTGA
CTTAAATCTGTGGCCGTTCGAAAAAATTCAAGACAACGGTTATTTCAATC
CCGGCGGCTCGACTGATTCTTATAAAAATCGAAATAGTGTCATTTTGTCG
ATCAATATTTCAAAAGTTAACTATTACTATCAAGAGCAATCCCCAGTTAG
AATCATGGGCAGCCCGATTTCAACCACAATTCAACGGATTAAAGCCATTA
TCGACCGAGATTGGTTGTATGAGCTATCAGAACAGGATATCGATTATTTG
AGAAGTAATCTCGAAAATTGTCTTTGGGTTCCCGAAAGTCTTCCGAGATT
AGCAAAATCTATCCGATGGAATAATGTAACGGAAGTTAATCTATTTTATA
GCTTGCTATCTAAATGGCCGAGAATCAATTTGGAATCATCTCTACAGCTA
TTAAGCGGAAACTTTTTCGATAAGGTACTGCGACAATTTGCTGTCAAAAA
CTTGAGAGCTATCCTAACCAATGCCGACATAAACTTATATTTACTGCAAT
TAGTCCAGGCATTAAAGTACGAATCGTATTATTTCAATGATTTATCGGTT
TTTCTACTGCAAAGCGCTTTGAGAAACAAACAACTCGGACAGAAATTCTT
TTGGTTTCTCAAATCCGAAATGCACAATGAATCGATAAAAATCTATTTCG
CTCTGATGTTAGAGGCGTTCTGTAGGGGATATTTGAATTTTATGACGGTA
ATTAGGCCTCAGAGTATCGGAATAGAAAAACTAGTGGAAATAAGCAGAAT
TTTAAAGGCTCAACGAGAAGATTTGCAATTATCGACTTTGAAAGAATATT
TGAAAAACGATGATTTCAACGAGACCTGCAAAAATGTCAGTTCGCTATTG
AATCTGAGTGAGAAACAGGGAAACATTATCGTTGAGACCTGTGATGTTAA
GAAATCGAAAAAACGACCGATTTATCTCGAGTGGGAAAATGCGGATATTT
TCTCTGAGTTTTCCATTCCAACTTTGAAATTTATTTTCAAGTGCGGCGAT
GATTTGCGGCAGGATATTCTCACTTTGCAGTTGCTTTCGATATTTGACTG
GATTTGGAAACGGCAATTTCAAGACATGAAGTTGCTCCCGTACGGTTGCC
TAGCAACTGGTAAGGACTCGGGAATTATCGAAGCTGTCAAGGATGCAAAA
ACCGTTATGTCCATTCAAAGGAGCAATATAATAGCGGCTATGCAAATGAA
TTCATCGTCTTTGTATCGGTGGATTCAGGCTAACAACAGAACCTGCGAAC
AATTTGCAAAAGCATTGGAAACGTTTACTCGAAGTTGTGCTGGATATTCG
GTTGCGACTTTTATTTTGGGTATTCGAGACCGTCATCCCGACAATATAAT
GGTGAACACGAAAGGTCAACTTTTCCATATCGATTTTGGTCACATATTAA
ATAATCGAAAGAAAAAATTCGGTGTTAATCGGGAGCGTGTTCCGTTTGTT
TTAACGGAAGATTTCATTAAAACTATAGCAGATGGTTCTGACAGACCATT
GGATAGCGTGAAATTCAATGAATTTATGGTTCTTTGTGGGAAAGCCTATT
TAAAATTGCGAGAACATTCATCATTGATTTTAACACTATATTCCATAATG
ATCGATAGTGGATTACCGGAGTTGACTAAAGTTCAAGACCTAGAGTACTT
GAGAAAGACTTTGAGTGTAGAAAGTGATGAAAAGGCAGCTTTAAATTATT
TTAATAGGCAATTTTGTGATGCTTATAGAGGAAATTGGACAACAAAAATT
GATTGGTTAAGCCATTTTCTAAATAACTGATTTTTATAAAAATTGACTTT
CCAATTATTAGATTTGCAAGATCG
back to top

protein sequence of SMED30025635-orf-1

>SMED30025635-orf-1 ID=SMED30025635-orf-1|Name=SMED30025635-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1027bp
MKRSDVPLNYYTYSFSNDVTVMILLPNFSVEEFVVSRKASLFEIKDILLK
ELKTNSIYEELLLNNFSSYIFCGVNRDAEIEEYYDESQLLCNLNLIDFVL
NCLERKGNEDESQLTSVINHCIGFNLDNLPKEYYELYDLELLNARKSYLE
VVKKEHESLIANPNDIVIFQYGADYNEFTTSTARQILQSMTCLYITTLIS
YKSVNPFKCVVTISKEFTVKETIFKILLDKKDSFEFDGSMDPNIWASENS
IKYVLKVSSLDSYLLNLNDKIIFYDYVQSCLYNNEFPILSLYPREYLENI
SINRFIIPPYFYQNIPQTKRRTRQDSVSKMFSLLLISAQLICKENSKLYV
RVAMFNGINTRIAPEQKSSLVSSDHPTWNEKLNFDIYYSNIPRNAKLCFS
LIEKTERGGNEVLLGWANINIFNYFGKLIEGSIDLNLWPFEKIQDNGYFN
PGGSTDSYKNRNSVILSINISKVNYYYQEQSPVRIMGSPISTTIQRIKAI
IDRDWLYELSEQDIDYLRSNLENCLWVPESLPRLAKSIRWNNVTEVNLFY
SLLSKWPRINLESSLQLLSGNFFDKVLRQFAVKNLRAILTNADINLYLLQ
LVQALKYESYYFNDLSVFLLQSALRNKQLGQKFFWFLKSEMHNESIKIYF
ALMLEAFCRGYLNFMTVIRPQSIGIEKLVEISRILKAQREDLQLSTLKEY
LKNDDFNETCKNVSSLLNLSEKQGNIIVETCDVKKSKKRPIYLEWENADI
FSEFSIPTLKFIFKCGDDLRQDILTLQLLSIFDWIWKRQFQDMKLLPYGC
LATGKDSGIIEAVKDAKTVMSIQRSNIIAAMQMNSSSLYRWIQANNRTCE
QFAKALETFTRSCAGYSVATFILGIRDRHPDNIMVNTKGQLFHIDFGHIL
NNRKKKFGVNRERVPFVLTEDFIKTIADGSDRPLDSVKFNEFMVLCGKAY
LKLREHSSLILTLYSIMIDSGLPELTKVQDLEYLRKTLSVESDEKAALNY
FNRQFCDAYRGNWTTKIDWLSHFLNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:00163031-phosphatidylinositol-3-kinase activity
GO:0046934phosphatidylinositol-4,5-bisphosphate 3-kinase activity
GO:0052812phosphatidylinositol-3,4-bisphosphate 5-kinase activity
GO:0016301kinase activity
GO:0005515protein binding
GO:0005488binding
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0036092phosphatidylinositol-3-phosphate biosynthetic process
GO:0016310phosphorylation
GO:0046854phosphatidylinositol phosphorylation
GO:0048015phosphatidylinositol-mediated signaling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR008290PI3K_Vps34
IPR036940PI3/4_kinase_cat_sf
IPR035892C2_domain_sf
IPR042236PI3K_accessory_sf
IPR015433PI_Kinase
IPR001263PI3K_accessory_dom
IPR003113PI3K_adapt-bd_dom
IPR002420PI3K_C2_dom
IPR000403PI3/4_kinase_cat_dom
IPR000008C2_dom
IPR018936PI3/4_kinase_CS
IPR000341PI3K_Ras-bd_dom
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
IPR016024ARM-type_fold
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001263Phosphoinositide 3-kinase, accessory (PIK) domainSMARTSM00145pi3k_hr2_4coord: 484..669
e-value: 1.2E-41
score: 154.4
IPR001263Phosphoinositide 3-kinase, accessory (PIK) domainPFAMPF00613PI3Kacoord: 493..660
e-value: 3.4E-39
score: 134.2
IPR001263Phosphoinositide 3-kinase, accessory (PIK) domainPROSITEPS51545PIK_HELICALcoord: 483..660
score: 28.328
IPR002420Phosphatidylinositol 3-kinase, C2 domainSMARTSM00142pi3k_hr3_6coord: 322..422
e-value: 2.5E-7
score: 40.3
IPR002420Phosphatidylinositol 3-kinase, C2 domainPFAMPF00792PI3K_C2coord: 346..442
e-value: 3.3E-19
score: 69.2
IPR002420Phosphatidylinositol 3-kinase, C2 domainPROSITEPS51547PI3K_C2coord: 327..478
score: 37.886
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainSMARTSM00146pi3k_hr1_6coord: 760..1026
e-value: 2.7E-92
score: 322.6
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainPFAMPF00454PI3_PI4_kinasecoord: 760..976
e-value: 1.2E-50
score: 172.7
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainPROSITEPS50290PI3_4_KINASE_3coord: 759..1026
score: 62.73
IPR003113Phosphatidylinositol 3-kinase adaptor-binding (PI3K ABD) domainSMARTSM00143pi3k_nt_2coord: 30..109
e-value: 1.5E-4
score: 29.6
IPR003113Phosphatidylinositol 3-kinase adaptor-binding (PI3K ABD) domainPFAMPF02192PI3K_p85Bcoord: 35..108
e-value: 4.6E-13
score: 48.7
IPR003113Phosphatidylinositol 3-kinase adaptor-binding (PI3K ABD) domainPROSITEPS51544PI3K_ABDcoord: 15..106
score: 33.229
IPR008290Phosphatidylinositol 3-kinase, Vps34 typePIRSFPIRSF000587PI3K_Vps34coord: 609..1024
e-value: 7.4E-62
score: 207.2
coord: 491..612
e-value: 2.7E-12
score: 43.2
coord: 316..475
e-value: 7.0E-10
score: 35.3
IPR036940Phosphatidylinositol 3-/4-kinase, catalytic domain superfamilyGENE3DG3DSA:1.10.1070.11coord: 815..1026
e-value: 7.1E-75
score: 253.4
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 328..468
e-value: 4.0E-30
score: 106.0
IPR042236Phosphoinositide 3-kinase, accessory (PIK) domain superfamilyGENE3DG3DSA:1.25.40.70coord: 469..661
e-value: 6.1E-51
score: 174.7
NoneNo IPR availableGENE3DG3DSA:3.30.1010.10coord: 663..814
e-value: 6.0E-40
score: 138.6
NoneNo IPR availableGENE3DG3DSA:3.10.20.770coord: 6..327
e-value: 6.0E-60
score: 205.3
NoneNo IPR availablePANTHERPTHR10048:SF103PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE, CATALYTIC SUBUNIT ALPHAcoord: 19..1024
NoneNo IPR availableCDDcd05165PI3Kc_Icoord: 665..1026
e-value: 0.0
score: 573.812
NoneNo IPR availableCDDcd08380C2_PI3K_likecoord: 344..473
e-value: 7.66784E-35
score: 128.248
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 341..468
IPR015433Phosphatidylinositol kinasePANTHERPTHR10048PHOSPHATIDYLINOSITOL KINASEcoord: 19..1024
IPR018936Phosphatidylinositol 3/4-kinase, conserved sitePROSITEPS00916PI3_4_KINASE_2coord: 862..882
IPR018936Phosphatidylinositol 3/4-kinase, conserved sitePROSITEPS00915PI3_4_KINASE_1coord: 763..777
IPR000341Phosphatidylinositol 3-kinase Ras-binding (PI3K RBD) domainPROSITEPS51546PI3K_RBDcoord: 190..293
score: 17.323
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 492..660
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 107..295
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 705..1020