Sortilin-related receptor

Overview
NameSortilin-related receptor
Smed IDSMED30025604
Length (bp)1827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sortilin-related receptor (SMED30025604) t-SNE clustered cells

Violin plots show distribution of expression levels for Sortilin-related receptor (SMED30025604) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sortilin-related receptor (SMED30025604) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sortilin-related receptor (SMED30025604) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025604

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 SmedASXL_010149SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 dd_Smed_v4_8864_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 dd_Smed_v4_8864_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 dd_Smed_v4_8864_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 dd_Smed_v6_8864_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 OX_Smed_1.0.13500ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 dd_Smed_v4_8864_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025604SMESG000043036.1 SMESG000043031.1 SMESG000040338.1 SMESG000040332.1 dd_Smed_v4_8864_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sortilin-related receptor vs. Ensembl Zebrafish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 55.0694 bits (131), Expect = 2.261e-7
Identity = 28/104 (26.92%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  196 QRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQV 507
            +++G+V   LN  E  ++C++ +N+++A ++C+ LGF  ++ +          G++ L+N++CTG ES +  C + G   Q      H  D  V C     P+ 
Sbjct:  460 RKEGRVEVFLN-GEWGSVCDHGWNDVNAAVVCRQLGFNGESKARPMGYFGAGKGTIHLSNVRCTGKESLLGECPSKG---QDSHVCKHGQDAGVVCDYEPEPEA 559          
BLAST of Sortilin-related receptor vs. Ensembl Zebrafish
Match: si:ch211-229d2.5 (si:ch211-229d2.5 [Source:ZFIN;Acc:ZDB-GENE-121214-200])

HSP 1 Score: 51.2174 bits (121), Expect = 2.308e-6
Identity = 51/199 (25.63%), Postives = 88/199 (44.22%), Query Frame = 1
Query: 1084 IKREYDPTYSLIAKTLTV----SCSFPKNISANNTFGFKGVTNIPI---NSTTNLKMEMTFYSDSGYSSQLL-SNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQS--TVPLYVL-CTTSLCYLRQDGNCPS---CRNRKKRSAKSS 1638
            + R +DPT   +     +    SC++P     NNT      ++I +   N +    + M  Y D  Y++ L+  NG I     +FV+V  +N      ++L  C+AS+    + + +N++   +   C       ++    S   RF F  ++ I Q   TV  Y L C T LC   +   CP+   CR RK+R  +++
Sbjct:  136 VVRSFDPTMGTVTYNAELKYIYSCAYPLEYLINNTQVDVSASSIAVRDNNGSFISTLSMQLYKDINYTTPLVFPNGGIELRTRIFVQVIAVNLTSQYYVLLDRCYASI----SPVPSNSTYFNLFVPCNQDPMTSMLENGESQRARFSFPAFRFIEQQNQTVSTYYLHCITRLC---ETTTCPTFKQCRKRKRREVQTT 327          
BLAST of Sortilin-related receptor vs. Ensembl Zebrafish
Match: loxl2a (lysyl oxidase-like 2a [Source:NCBI gene;Acc:565508])

HSP 1 Score: 50.0618 bits (118), Expect = 7.843e-6
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  232 NEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVP 501
            NE  T+C+ +F+  +A + C+ LGF        ++      G + L N+ CTG E++++ C ++G  V       H  DV V C Q ++P
Sbjct:   49 NEWGTVCDDDFSIEAAHVACRQLGFLGAVAWSPSAKFGQGEGRIWLDNVHCTGRENSLAACPSNGFGVSD---CRHSEDVGVICNQKRIP 135          
BLAST of Sortilin-related receptor vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 55.8398 bits (133), Expect = 2.007e-7
Identity = 36/142 (25.35%), Postives = 63/142 (44.37%), Query Frame = 1
Query:  232 NEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPND--GDTICNKTSSQYSFDRLLNKINVGLPRVNISGTFYPICNDDYS 651
             E  T+C+ +F+  +A I+C+ LG+        +S      G + L N+ C G E +I+ C ++G  V       H  DV V C   ++P     N+  G     +  +  S  R    +  G   V + G++  +CN ++S
Sbjct:   39 GEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKYGKGEGRIWLDNVNCNGREKSIASCGSNGWGVTD---CKHSEDVGVQCSDRRIPGFKVSNELPGQLEEVRIRAILSAYRKRVPVTEGFVEVKVQGSWRQVCNAEWS 177          
BLAST of Sortilin-related receptor vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 53.9138 bits (128), Expect = 6.372e-7
Identity = 35/146 (23.97%), Postives = 63/146 (43.15%), Query Frame = 1
Query:  232 NEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICNKTSSQYSFDRLLNK------INVGLPRVNISGTFYPICNDDYS 651
             E  T+C+ +F+  +A I+C+ LG+        +S      G + L N+ C G E +I+ C ++G  V       H  DV V C   ++P     N  +   N    +     +L+       +  G   V + G++  +CN ++S
Sbjct:   90 GEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKYGKGEGRIWLDNVNCNGREKSIASCGSNGWGVTD---CKHSEDVGVQCSDRRIPGFKVTNPTNNGLNIQVEEVRIRAILSAYRKRVPVTEGFVEVKVQGSWRQVCNAEWS 232          
BLAST of Sortilin-related receptor vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 51.9878 bits (123), Expect = 3.061e-6
Identity = 36/145 (24.83%), Postives = 63/145 (43.45%), Query Frame = 1
Query:  232 NEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVT----PNDGDTICN-KTSSQYSFDRLLNKINVGLPRVNISGTFYPICNDDYS 651
             E  T+C+ +F+  +A I+C+ LG+        +S      G + L N+ C G E +I+ C ++G  V       H  DV V C   ++P        P   + I   +  +  S  R    +  G   V + G++  +CN ++S
Sbjct:   68 GEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKYGKGEGRIWLDNVNCNGREKSIASCGSNGWGVTD---CKHSEDVGVQCSDRRIPGFKVSNELPGQLEVIEEVRIRAILSAYRKRVPVTEGFVEVKVQGSWRQVCNAEWS 209          
BLAST of Sortilin-related receptor vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 51.6026 bits (122), Expect = 3.435e-6
Identity = 35/145 (24.14%), Postives = 62/145 (42.76%), Query Frame = 1
Query:  232 NEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICN-----KTSSQYSFDRLLNKINVGLPRVNISGTFYPICNDDYS 651
             E  T+C+ +F+  +A I+C+ LG+        +S      G + L N+ C G E +I+ C ++G  V       H  DV V C   ++P     N+           +  +  S  R    +  G   V + G++  +CN ++S
Sbjct:   32 GEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKYGKGEGRIWLDNVNCNGREKSIASCGSNGWGVTD---CKHSEDVGVQCSDRRIPGFKVSNELPGQLEVIEEVRIRAILSAYRKRVPVTEGFVEVKVQGSWRQVCNAEWS 173          
BLAST of Sortilin-related receptor vs. Ensembl Xenopus
Match: loxl2 (lysyl oxidase like 2 [Source:NCBI gene;Acc:100216062])

HSP 1 Score: 51.2174 bits (121), Expect = 5.089e-6
Identity = 35/149 (23.49%), Postives = 63/149 (42.28%), Query Frame = 1
Query:  232 NEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINV---------GLPRVNISGTFYPICNDDYS 651
             E  T+C+ +F+  +A I+C+ LG+        +S      G + L N+ C G E +I+ C ++G  V       H  DV V C   ++P     N+        + Q    R+   ++          G   V + G++  +CN ++S
Sbjct:   79 GEWGTVCDDDFSMYAAHIVCRELGYQDAVSWSPSSKYGKGEGRIWLDNVNCNGREKSIASCGSNGWGVTD---CKHSEDVGVQCSDRRIPGFKVSNELPGQLEGLNIQVEEVRIRAILSAYRKRVPVTEGFVEVKVQGSWRQVCNAEWS 224          
BLAST of Sortilin-related receptor vs. TrEMBL
Match: A0A4S2M693 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002507 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.799e-22
Identity = 142/583 (24.36%), Postives = 247/583 (42.37%), Query Frame = 1
Query:   85 YLLSLCLWSFFNIVACEIL-IKSISFAQGTNLFTNDTIQRDGKVIAKLNTNEV-TTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGL---------ESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQ--------TQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINV-GLPRVNI--SGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIESVVMPYLNISIRNDSVRP---NCIKSGCQTSDLQSCF-----------TSSYIAGIKCGDEPQFIES----PPNVKCTNQNMTVIWPKQFFPSVNYTLVSLVTQ----CDSSTKNNSIGDAEIYIPFNDCTPTI-IGSSNYVNFSYTIKREY-DPTYSLIAK---TLTVSCSFPK-NISANNTFGFKGVTNIPINSTTNLKMEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSP-YKTISQSTVP----LYVLCTTSLCYL-------RQDGNCPSCRNRKKRSAKSSLEE 1647
            Y+L +C+  F  I+   I  IKS+ FA GTN++      RDG  + ++N N    T+CN+ F+E++A + C  +G   + ++I+NS     +  ++L+N  CTG           + +   V S     P  C +      + CL         T VP  +T    D  C++ SS  S  RL+   +  GL ++    +G +  IC D   + +   + +C  LC S        P L      D   P   + I+     +DL  C            T +   G++C   PQ I       P + CT  +  V + KQ  P +N ++++LV Q    C     +N     +  IP   C  ++ + + + +   + + R++  P+  +I+      +V+C  P+ N   +       V    + +T  +   +  Y D GYS  +     I   + ++VKV++++P     LIL +C A++  +  +    N   LI N C   +  + + P + TEV F F   Y   +  TVP    LY+ C T +C+        +Q    P+   R++R    +L E
Sbjct:    8 YMLIICIL-FQKIIGTTIAGIKSVRFASGTNIYEEG---RDG--VLEVNYNGTWGTVCNFGFDELAASVACFMMGLTPRGVAILNSPRRS-DSQMILSNFNCTGRLVLPSSSLSTATVHLGVCSFTDEIPEGCQDGSRQTSIICLDAFTKMTTTTPVPNYMTVAPVD--CSRPSS--SIIRLVGGTDREGLVQIQHPETGEWGTICAD--GVDIYAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPIHLSGIRCPEHATDLNQCTLGGGWGATRWCTHAMDVGLQCA-PPQIITPSISYAPQLSCTRTDARVTYDKQVNPDLNTSMITLVGQVPVGCQFRVVDNG-SHIQAIIPLEGCGGSLSLSNESDIAIKFELLRDFVAPSTGIISNLPVRFSVTCLIPRINRIPSEVIASPQVITDLVGATQAVAASLKLYQDPGYSISVRQGQSIRPGQSVYVKVSLVDPKPASKLILQDCWATINPERQSTPRQN---LIINRCIAYD-GLTVHPINLTEVGFSFPAFYLGTAGHTVPASASLYLHCDTRICHASETSTFCQQFCTTPTKLLRRRRRGVFALPE 571          
BLAST of Sortilin-related receptor vs. TrEMBL
Match: A0A074ZAP8 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_15346 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.468e-22
Identity = 141/584 (24.14%), Postives = 249/584 (42.64%), Query Frame = 1
Query:   88 LLSLCLWSFFNIVACEIL--IKSISFAQGTNLFTNDTIQRDGKVIAKLNTNEV-TTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGL---------ESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQ--------TQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINV-GLPRVNI--SGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIESVVMPYLNISIRNDSVRP---NCIKSGCQTSDLQSCF-----------TSSYIAGIKCGDEPQFIESP-----PNVKCTNQNMTVIWPKQFFPSVNYTLVSLVTQ----CDSSTKNNSIGDAEIYIPFNDCTPTI-IGSSNYVNFSYTIKREY-DPTYSLIAK---TLTVSCSFPK-NISANNTFGFKGVTNIPINSTTNLKMEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSP-YKTISQSTVP----LYVLCTTSLCYL-------RQDGNCPSCRNRKKRSAKSSLEE 1647
            LL +C+   F  + C  +  I+S+ FA GTN++      RDG  + ++N N    T+CN+ F+E++A + C  +G   + ++I+NS     +  ++L+N  CTG           + +   V S     P  C +      + CL         T VP  +T    D  C++ SS  S  RL+   +  GL ++    +G +  IC D   + +   + +C  LC S        P L      D   P   + I+     +DL  C            T +   G++C   P  I +P     P + CT  +  V + KQ  P +N ++++LV Q    C     +N     E  IP   C  ++ + + + +   + + R++  P+  +I+      +V+C  P+ N   +       V    + +T  ++  +  Y D GYS  +     I   ++++VKV++++P     LIL +C  ++  +  +    N   LI N C   +  + + P + TEV F F   Y   +  TVP    LY+ C T +C+        +Q    P+   R++R A  +L E
Sbjct:    1 LLIICI--LFQKIICTTIAGIQSVRFASGTNIYEEG---RDG--VLEVNYNGTWGTVCNFGFDELAASVACFMMGMKPRGVAILNSPRRS-DSQMILSNFNCTGRLVLPSFSLSTATVHLGVCSFTDEIPEGCQDSNRQTSIICLDDFMEITTTTPVPNYMTVAPVD--CSRPSS--SIIRLVGGTDREGLVQIQHPETGEWGTICAD--GVDIHAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPIHLSGIRCPEHATDLNQCTLGGGWGATRWCTHAMDVGLQCA--PPQITAPSISYAPQLSCTRTDAHVTYDKQVNPDLNTSMITLVGQVPVGCQFRVADNG-SHIEAIIPLEGCGGSLSLSNESDIAIKFELLRDFVAPSTGIISNLPVRFSVTCLIPRINRIPSEVIASPQVIADLVGATQEVEASLKLYQDPGYSISIRQGQFIRPGQNVYVKVSLVDPKPASKLILQDCWTTINPERQSTPRQN---LIINRCIAYD-GLTVHPINLTEVGFSFPAFYLGTAGHTVPASASLYLHCDTRICHASETSTFCQQFCTTPTKLLRRRRRAVFALPE 563          
BLAST of Sortilin-related receptor vs. TrEMBL
Match: A0A3R7CC15 (Deleted in malignant brain tumors 1 protein OS=Clonorchis sinensis OX=79923 GN=DMBT1 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 8.965e-22
Identity = 138/556 (24.82%), Postives = 238/556 (42.81%), Query Frame = 1
Query:   76 QNLYLLSLCLWSFFNIVACEIL-IKSISFAQGTNLFTNDTIQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGL---------ESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQ--------VPQVVTPNDGDTICNKTSSQYSFDRLLNKINV-GLPRVNI--SGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIESVVMPYLNISIRNDSVRP---NCIKSGCQTSDLQSCF-----------TSSYIAGIKCGDEPQFIESP-----PNVKCTNQNMTVIWPKQFFPSVNYTLVSLVTQ----CDSSTKNNSIGDAEIYIPFNDCTPTI-IGSSNYVNFSYTIKREY-DPTYSLIAK---TLTVSCSFPK--NISANNTFGFKGVTNIPINSTTNLKMEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSP-YKTISQSTVP----LYVLCTTSLCY 1575
            + LYLL +C+  F  I+   I  IKS+ FA GTNL+      RDG V+         T+CN+ F+E++A + C  +G   + ++I+NS     +  +LL+N  CTG           + +   V S     P  C +      + CL T         VP  +T    D  C+K SS  S  RL+   +  GL ++    +G +  IC D   + +   + +C  LC S        P L      D   P   + I+     +DL  C            T +   G++C   P  I +P     P + CT  +  V + KQ  P +  T+++LV Q    C     +N     E  IP   C  ++ + + + +   + + R++  P+  +I+      +V+C  P+   I +      + +T++ + +T  +   +  + D  YS  +     I   ++++VKV++++P     LIL +C A++  +  +    N   LI N C   +  + + P + TEV F F   Y   +   VP    LY+ C T +C+
Sbjct:   77 RALYLLIICIL-FQKIIDATIAGIKSVRFAPGTNLYEEG---RDG-VLEVYYNGTWGTVCNFGFDELAASVACFMMGLTPRGVAILNSPRRS-DSQMLLSNFNCTGRLVLPSSSLSTATVHLGVCSFTDEVPERCQDSSRQTSIICLDTYTEMTTTTPVPNYMTVAPVD--CSKPSS--SIIRLVGGTDREGLVQIQHPETGEWGTICAD--GVDIHAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPIHLSGIRCPEHATDLNQCTLGGGWGATRWCTHAMDVGLQCA--PPQITAPAISYSPQLSCTRTDARVTYDKQVNPDLKTTMITLVGQVPVGCQFRVADNG-SHIEAIIPLEGCGGSLSLSNESDIAIKFELLRDFVAPSTGIISNFPVRFSVTCLIPRINRIPSEVIASPQVITDL-VGATQAVAASLKLFLDPAYSISVRQGQSIRPGQNVYVKVSLVDPKPVSKLILQDCWATISPERQSTPRQN---LIINRCIAYD-GLTVHPINLTEVGFSFPAFYLGTAGHAVPASASLYLHCDTRICH 612          
BLAST of Sortilin-related receptor vs. TrEMBL
Match: A0A4S2M5W8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002507 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.958e-21
Identity = 144/591 (24.37%), Postives = 247/591 (41.79%), Query Frame = 1
Query:   85 YLLSLCLWSFFNIVACEIL-IKSISFAQGTNLFTNDTIQRDGKVIAKLNTNEV-TTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGL---------ESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQ--------TQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINV-GLPRVNI--SGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIESVVMPYLNISIRNDSVRP---NCIKSGCQTSDLQSCF-----------TSSYIAGIKCGDEPQFIES----PPNVKCTNQNMTVIWPKQFFPSVNYTLVSLVTQ----CDSSTKNNSIGDAEIYIPFNDCTPTI------IGS---SNYVNFSYTIKREY-DPTYSLIAK---TLTVSCSFPK-NISANNTFGFKGVTNIPINSTTNLKMEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSP-YKTISQSTVP----LYVLCTTSLCYL-------RQDGNCPSCRNRKKRSAKSSLEE 1647
            Y+L +C+  F  I+   I  IKS+ FA GTN++      RDG  + ++N N    T+CN+ F+E++A + C  +G   + ++I+NS     +  ++L+N  CTG           + +   V S     P  C +      + CL         T VP  +T    D  C++ SS  S  RL+   +  GL ++    +G +  IC D   + +   + +C  LC S        P L      D   P   + I+     +DL  C            T +   G++C   PQ I       P + CT  +  V + KQ  P +N ++++LV Q    C     +N     +  IP   C  ++       GS    + +   + + R++  P+  +I+      +V+C  P+ N   +       V    + +T  +   +  Y D GYS  +     I   + ++VKV++++P     LIL +C A++  +  +    N   LI N C   +  + + P + TEV F F   Y   +  TVP    LY+ C T +C+        +Q    P+   R++R    +L E
Sbjct:    8 YMLIICIL-FQKIIGTTIAGIKSVRFASGTNIYEEG---RDG--VLEVNYNGTWGTVCNFGFDELAASVACFMMGLTPRGVAILNSPRRS-DSQMILSNFNCTGRLVLPSSSLSTATVHLGVCSFTDEIPEGCQDGSRQTSIICLDAFTKMTTTTPVPNYMTVAPVD--CSRPSS--SIIRLVGGTDREGLVQIQHPETGEWGTICAD--GVDIYAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPIHLSGIRCPEHATDLNQCTLGGGWGATRWCTHAMDVGLQCA-PPQIITPSISYAPQLSCTRTDARVTYDKQVNPDLNTSMITLVGQVPVGCQFRVVDNG-SHIQAIIPLEGCGGSLSLQTRKFGSKSNESDIAIKFELLRDFVAPSTGIISNLPVRFSVTCLIPRINRIPSEVIASPQVITDLVGATQAVAASLKLYQDPGYSISVRQGQSIRPGQSVYVKVSLVDPKPASKLILQDCWATINPERQSTPRQN---LIINRCIAYD-GLTVHPINLTEVGFSFPAFYLGTAGHTVPASASLYLHCDTRICHASETSTFCQQFCTTPTKLLRRRRRGVFALPE 579          
BLAST of Sortilin-related receptor vs. TrEMBL
Match: A0A210PLV6 (Deleted in malignant brain tumors 1 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04711 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.673e-18
Identity = 128/546 (23.44%), Postives = 235/546 (43.04%), Query Frame = 1
Query:  139 LIKSISFAQGTNLF-TNDTIQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICNKT------SSQYSFD--RLL---NKINVGLPRVNISGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIE----SVVMPYLNISIRN----DSVRPNCIKS---GCQTS--DLQSCFTSSYIAGIKC------GDEPQFIESPPNVKCTNQNMTVIWPKQFFPSVNYTLVSLVTQ---CDSSTKNNSIGDAEIYIPFNDCTPTIIGSSNYVNFSYTIKREYDPTYSLIAKT----LTVSCSFPKNISANNTFGFKGVTNIPINSTTNLKMEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCTTSLCYLRQ-----DGNCPSC-----RNRKKRSAK 1632
            L K I F QG  L   N T Q +G+V  K N +   T+C  NF  + A ++C+ L F     +I +      +G + L N+ C G E  +S C  +   V      NH  D  V C     P  VTP    T    T      S+  + D  RL+   +K  VG   V  + T+  +C+D + + LD  + VC  LC++  +     S  + Y+  ++ +    D V+ +  +S    CQ +   + +C +  Y A + C      G E       P + C+++  T  + + + P + +  +++      C+   +NNS     + IPF DC  T+  +  ++ ++ TI   +     +I +     + + C+FP+N S ++         +   +     + M  Y D  +   L    +++ ++ L V + +      L L+L +C A+    +T+   +    L  N CPN +  V + P++ T   F+F  ++ I    V  Y+ CT+++C + +     D +C +        R++RS +
Sbjct:    7 LGKIIVF-QGIRLGGVNRTTQYEGRVEVKYN-DTWGTVCLDNFENVEAVVVCRELKF-GGGEAITDGRFGPGSGKIWLDNLNCDGTEQMLSVCQANNLGVHNCDQVNHTDDAGVIC---DNPSAVTPGPTTTRAPATAQPSNCSTNTNADNIRLIGPSDKTGVGFVEVKYNNTWGAVCDDHWDI-LD-ARVVCGSLCFNQTLALAGTSQTVDYVKSNVSSTFFLDDVKCDGTESDIFSCQHNPVGVHNCQSGEY-ASVTCVPINHTGSE----APEPLLSCSDEKFTASFSRDYDPYLMHRHLTISKPSNPCNVQFQNNS-AYIIMMIPFTDCGTTLTTNETHIFYTNTIHYNFTTRLGVITRKNSYIVELQCAFPRNQSNSDNIYIPVTQLVTQTAPGTFSVGMVMYGDDNFQDPLTVTPELTLNQPLSVSLTLNASLPRLKLVLRSCFATPTGSWTDKINH---FLFENSCPN-DTTVALVPWNETVEGFRFRVFRFIGHDNV--YLHCTSTVCEINEKSDICDRSCGATTPTPPTGRRRRSVR 532          
BLAST of Sortilin-related receptor vs. Ensembl Cavefish
Match: loxl2a (lysyl oxidase-like 2a [Source:NCBI gene;Acc:565508])

HSP 1 Score: 58.5362 bits (140), Expect = 1.520e-8
Identity = 43/160 (26.88%), Postives = 78/160 (48.75%), Query Frame = 1
Query:  202 DGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVP--QVV--TPNDGDTICNKTS-----SQYSFDRLLNKINVGLPRVNISGTFYPICNDDYSL 654
            +G+V    N NE  T+C+ +F+  +A ++C+ LG+        ++      G + L N+ CTG E++++ C ++G  V       H  DV V C Q ++P  Q +  T ND +T+  +       + YS  R    I  G   +   G +  IC++D+++
Sbjct:   39 EGRVEVLYN-NEWGTVCDDDFDMSAAHVVCRELGYLGAVSWSPSAKFGKGEGRIWLDNVHCTGRETSLADCPSNGLGVSD---CRHSEDVGVVCTQKRIPGFQFISSTSNDVETLDVRVEDVRIRATYS-QRKRVPITEGFVELKDGGKWRQICDEDWNM 193          
BLAST of Sortilin-related receptor vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 51.6026 bits (122), Expect = 2.004e-6
Identity = 28/103 (27.18%), Postives = 50/103 (48.54%), Query Frame = 1
Query:  196 QRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQ 504
            +++G+V   LN  E  ++C+  +N+++A ++C+ LGF   + +          G + LAN++CTG ES++  C   G          H  D  V C     P+
Sbjct:  371 RKEGRVEVFLN-GEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLANVRCTGKESSLGECPAKGSDSH---VCKHGQDAGVVCDYVPEPE 469          
BLAST of Sortilin-related receptor vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 51.6026 bits (122), Expect = 2.368e-6
Identity = 28/103 (27.18%), Postives = 50/103 (48.54%), Query Frame = 1
Query:  196 QRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQ 504
            +++G+V   LN  E  ++C+  +N+++A ++C+ LGF   + +          G + LAN++CTG ES++  C   G          H  D  V C     P+
Sbjct:  440 RKEGRVEVFLN-GEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLANVRCTGKESSLGECPAKGSDSH---VCKHGQDAGVVCDYVPEPE 538          
BLAST of Sortilin-related receptor vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 51.2174 bits (121), Expect = 2.857e-6
Identity = 23/77 (29.87%), Postives = 44/77 (57.14%), Query Frame = 1
Query:  196 QRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSG 426
            +++G+V   LN  E  ++C+  +N+++A ++C+ LGF   + +          G + LAN++CTG ES++  C   G
Sbjct:  413 RKEGRVEVFLN-GEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLANVRCTGKESSLGECPAKG 488          
BLAST of Sortilin-related receptor vs. Ensembl Sea Lamprey
Match: loxl3a (lysyl oxidase-like 3a [Source:NCBI gene;Acc:568839])

HSP 1 Score: 47.7506 bits (112), Expect = 6.309e-6
Identity = 43/178 (24.16%), Postives = 70/178 (39.33%), Query Frame = 1
Query:  202 DGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINVGLPRVNISGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIESVVMPYLN 735
            +G+V  +    E  T+C+  ++ +SA ++C+ LGF +   ++ +       G + +A +QCTG E +I  C +   S     C +H  D  V C    VP +         C K      F    N ++V L        F P+   D  L+        S  C    +    MP L 
Sbjct:  368 EGRVEVQ-RGGEWGTVCDQRWSTVSASVVCRELGFGSAKEALTSGRMGQAMGPIHMAMVQCTGQERSIFDCPHGNASDH--GCGHH-EDAAVRC---HVPAMGFEKRNFRQCAK-----GFHNSWNWVDVNL-------GFCPVRELDSGLSEGWGMLEASVACRQLGLGYASMPPLQ 526          
BLAST of Sortilin-related receptor vs. Ensembl Nematostella
Match: EDO30139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M8])

HSP 1 Score: 59.6918 bits (143), Expect = 1.644e-9
Identity = 48/171 (28.07%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  205 GKVIAKLNTNEVTTICN----YNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINVGLPRVNI--SGTFYPICNDDYSLTLDIVKFVCSQLCYS 699
            G+V          T+C+    +  NE  A +ICK+LG+P    S   +     NG++ L+N+ CTG ES++  C +SG     P C +H  DV V C+                    SS+    RL+        RV I   G +  +C+DD+   ++  + VC+ L Y 
Sbjct:  140 GRVELNFKGRGWGTVCDDGQQWGMNE--ANVICKSLGYPGAVASSSRARYGPGNGTIWLSNVTCTGAESSLQSCSHSGWGT--PSC-DHATDVGVSCI------------------PVSSRV---RLVGGSRPTEGRVEIFHQGVWGTVCDDDWD--INDARVVCTMLGYG 282          
BLAST of Sortilin-related receptor vs. Ensembl Nematostella
Match: EDO34781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SND8])

HSP 1 Score: 52.7582 bits (125), Expect = 7.748e-8
Identity = 27/96 (28.12%), Postives = 46/96 (47.92%), Query Frame = 1
Query:  196 QRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYC 483
            +R+G+V     +    TIC+Y +  + A ++C+ LG+P    +   +      G++ L ++QC G ESNI  C  S   ++      H  D  V C
Sbjct:  115 RREGRVEV-YYSRRWGTICDYQWGILDANVVCRQLGYPGALAAKREAFFGQGKGNIWLTDVQCKGRESNIGLCRRS--FLEHQQTCQHSEDAGVIC 207          
BLAST of Sortilin-related receptor vs. Ensembl Nematostella
Match: EDO39811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Y4])

HSP 1 Score: 49.6766 bits (117), Expect = 7.123e-7
Identity = 36/157 (22.93%), Postives = 67/157 (42.68%), Query Frame = 1
Query:  244 TICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINVGLPRVNISGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIES 714
            T+C+ +++   A ++C+ LG+P    S   ++    NG + + ++ C G E ++  C   G          H  D  V C QT+    + P     + N +S            N G   +  +GT+  +C+D + ++    + VC QL Y   + S
Sbjct:   24 TVCDDSWDISDAQVVCRQLGYPGAVSSPGRAHFGRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHN---CIHSEDAGVVC-QTRNTTAIPPRPTTWLVNGSS-----------FNEGRVEIYHNGTWGTVCDDSWDIS--DAQVVCHQLGYPGAVSS 163          
BLAST of Sortilin-related receptor vs. Ensembl Nematostella
Match: EDO39899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W0])

HSP 1 Score: 51.2174 bits (121), Expect = 9.154e-7
Identity = 45/170 (26.47%), Postives = 71/170 (41.76%), Query Frame = 1
Query:  232 NEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTICNKTSSQYSFDRLLNKINVGLPRVNI--SGTFYPICNDDYSLTLDIVKFVCSQLCYSNKIESVVMPYLN 735
             E  T+C+  ++   A ++CK+LGFPA       +      G +LL N++CTG E ++  C + G  VQ     +H  D  V C +T+   V T        ++T       RL+        RV +  +G +  +C+D +      V  VC  L Y        M Y  
Sbjct:  461 EEWGTVCDDEWDFNDANVVCKSLGFPAAKAFHRYARYGQGAGRILLDNVECTGSERSVVECPHQGWGVQN---CHHSEDAGVEC-RTENWTVPT--------HRT-------RLIGGSRPSEGRVEVFYNGAWGTVCDDLWDEADASV--VCKSLGYPGARSFKTMAYFG 609          
BLAST of Sortilin-related receptor vs. Ensembl Nematostella
Match: EDO36909 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH72])

HSP 1 Score: 49.6766 bits (117), Expect = 9.843e-7
Identity = 27/100 (27.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  202 DGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVP 501
            +G+V  K N  +  T+C+  ++   A ++C+ LG+P    + + +      GS+ L N++CTG ES +  C ++G  ++      H  D  V C +   P
Sbjct:  140 EGRVEIKHN-GQWGTVCDDLWDIKDADVVCRELGYPGALSAQVRAAWGGGAGSIWLDNLECTGNESRLVDCPHNGLGIEN---CRHSEDAGVVCRKADTP 235          
BLAST of Sortilin-related receptor vs. Ensembl Medaka
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101164651])

HSP 1 Score: 50.447 bits (119), Expect = 4.602e-6
Identity = 30/110 (27.27%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  172 NLFTNDTIQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVP 501
             L  +     +G+V    N  E  T+C+ +FN  +A ++C+ LG+        +S      G++   N+QCTG E  ++ C ++G  V       H  DV V C   ++P
Sbjct:   68 RLAGDKRKHNEGRVEVYYN-GEWGTVCDDDFNIHAAQVVCRELGYVEAVSWSPSSKYGKGEGTIWFDNLQCTGTEKTLALCRSNGIGVSD---CKHTEDVGVVCSDRRIP 173          
BLAST of Sortilin-related receptor vs. Ensembl Medaka
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101164651])

HSP 1 Score: 50.447 bits (119), Expect = 4.989e-6
Identity = 30/110 (27.27%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  172 NLFTNDTIQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVP 501
             L  +     +G+V    N  E  T+C+ +FN  +A ++C+ LG+        +S      G++   N+QCTG E  ++ C ++G  V       H  DV V C   ++P
Sbjct:   56 RLAGDKRKHNEGRVEVYYN-GEWGTVCDDDFNIHAAQVVCRELGYVEAVSWSPSSKYGKGEGTIWFDNLQCTGTEKTLALCRSNGIGVSD---CKHTEDVGVVCSDRRIP 161          
BLAST of Sortilin-related receptor vs. Ensembl Medaka
Match: loxl2b (lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101164651])

HSP 1 Score: 50.447 bits (119), Expect = 4.989e-6
Identity = 30/110 (27.27%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  172 NLFTNDTIQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVP 501
             L  +     +G+V    N  E  T+C+ +FN  +A ++C+ LG+        +S      G++   N+QCTG E  ++ C ++G  V       H  DV V C   ++P
Sbjct:   56 RLAGDKRKHNEGRVEVYYN-GEWGTVCDDDFNIHAAQVVCRELGYVEAVSWSPSSKYGKGEGTIWFDNLQCTGTEKTLALCRSNGIGVSD---CKHTEDVGVVCSDRRIP 161          
BLAST of Sortilin-related receptor vs. Planmine SMEST
Match: SMESG000040338.1 (SMESG000040338.1)

HSP 1 Score: 315.464 bits (807), Expect = 2.355e-105
Identity = 154/157 (98.09%), Postives = 156/157 (99.36%), Query Frame = 1
Query:   67 MKNQNLYLLSLCLWSFFNIVACEILIKSISFAQGTNLFTNDTIQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTIC 537
            MKNQNLYLLSLCLWSFFN+ ACEILIKSISFAQGTNLFTND+IQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTIC
Sbjct:    1 MKNQNLYLLSLCLWSFFNVFACEILIKSISFAQGTNLFTNDSIQRDGKVIAKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTIC 157          
BLAST of Sortilin-related receptor vs. Planmine SMEST
Match: SMESG000040332.1 (SMESG000040332.1)

HSP 1 Score: 299.286 bits (765), Expect = 2.565e-99
Identity = 148/148 (100.00%), Postives = 148/148 (100.00%), Query Frame = 1
Query: 1231 MEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCTTSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW 1674
            MEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCTTSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW
Sbjct:    1 MEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCTTSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW 148          
BLAST of Sortilin-related receptor vs. Planmine SMEST
Match: SMESG000043036.1 (SMESG000043036.1)

HSP 1 Score: 296.975 bits (759), Expect = 1.823e-98
Identity = 147/148 (99.32%), Postives = 147/148 (99.32%), Query Frame = 1
Query: 1231 MEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCTTSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW 1674
            MEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLC TSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW
Sbjct:    1 MEMTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCKTSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW 148          
BLAST of Sortilin-related receptor vs. Planmine SMEST
Match: SMESG000043036.1 (SMESG000043036.1)

HSP 1 Score: 292.738 bits (748), Expect = 8.864e-97
Identity = 145/146 (99.32%), Postives = 145/146 (99.32%), Query Frame = 1
Query: 1237 MTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCTTSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW 1674
            MTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLC TSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW
Sbjct:    1 MTFYSDSGYSSQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNNSVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCKTSLCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFW 146          
BLAST of Sortilin-related receptor vs. Planmine SMEST
Match: SMESG000043031.1 (SMESG000043031.1)

HSP 1 Score: 160.229 bits (404), Expect = 1.770e-46
Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
Query:  307 PAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTIC 537
            PAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTIC
Sbjct:   39 PAQALSIINSNTNMINGSVLLANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTPNDGDTIC 115          
The following BLAST results are available for this feature:
BLAST of Sortilin-related receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin-related receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin-related receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin-related receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-127m5.12.261e-726.92si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
si:ch211-229d2.52.308e-625.63si:ch211-229d2.5 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
loxl2a7.843e-630.00lysyl oxidase-like 2a [Source:NCBI gene;Acc:565508... [more]
back to top
BLAST of Sortilin-related receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
loxl22.007e-725.35lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl26.372e-723.97lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl23.061e-624.83lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl23.435e-624.14lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
loxl25.089e-623.49lysyl oxidase like 2 [Source:NCBI gene;Acc:1002160... [more]
back to top
BLAST of Sortilin-related receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin-related receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin-related receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M6932.799e-2224.36Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZAP83.468e-2224.14Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A3R7CC158.965e-2224.82Deleted in malignant brain tumors 1 protein OS=Clo... [more]
A0A4S2M5W82.958e-2124.37Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A210PLV61.673e-1823.44Deleted in malignant brain tumors 1 protein OS=Miz... [more]
back to top
BLAST of Sortilin-related receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
loxl2a1.520e-826.88lysyl oxidase-like 2a [Source:NCBI gene;Acc:565508... [more]
si:ch73-127m5.12.004e-627.18si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
si:ch73-127m5.12.368e-627.18si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
si:ch73-127m5.12.857e-629.87si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
back to top
BLAST of Sortilin-related receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
loxl3a6.309e-624.16lysyl oxidase-like 3a [Source:NCBI gene;Acc:568839... [more]
back to top
BLAST of Sortilin-related receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin-related receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO301391.644e-928.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347817.748e-828.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398117.123e-722.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398999.154e-726.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369099.843e-727.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sortilin-related receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
loxl2b4.602e-627.27lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101... [more]
loxl2b4.989e-627.27lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101... [more]
loxl2b4.989e-627.27lysyl oxidase homolog 2B [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Sortilin-related receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040338.12.355e-10598.09SMESG000040338.1[more]
SMESG000040332.12.565e-99100.00SMESG000040332.1[more]
SMESG000043036.11.823e-9899.32SMESG000043036.1[more]
SMESG000043036.18.864e-9799.32SMESG000043036.1[more]
SMESG000043031.11.770e-46100.00SMESG000043031.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025604 ID=SMED30025604|Name=Sortilin-related receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1827bp
ATTGTTAATTCATCTTATAGATTCAGTAAAAAGTATCATTTATAATAATT
TTGTCCGACATATAATATGAAAAATCAAAACTTGTACCTTTTATCATTAT
GCCTCTGGTCATTTTTTAATATAGTCGCTTGTGAAATACTTATAAAATCT
ATTTCCTTCGCACAAGGTACGAATTTATTTACAAATGACACTATTCAACG
AGATGGAAAAGTGATTGCGAAACTAAATACAAATGAAGTTACAACAATAT
GCAATTATAATTTTAATGAAATAAGTGCTGGTATTATTTGTAAAACTTTA
GGATTTCCAGCACAAGCTCTGTCTATCATCAATAGTAATACAAATATGAT
CAATGGCTCAGTGTTATTAGCTAATATTCAATGCACTGGTTTAGAATCAA
ATATTTCATATTGCGTGAATTCAGGGAGATCTGTTCAACCTCCTCCATGC
TCAAACCACATTATGGATGTGCATGTTTACTGCCTTCAAACTCAAGTTCC
CCAAGTTGTTACACCTAATGATGGTGATACAATTTGTAATAAAACAAGCT
CACAATACAGTTTTGATCGTCTATTAAATAAAATAAATGTTGGATTACCG
AGAGTAAATATAAGTGGAACTTTTTATCCAATTTGCAATGATGATTATTC
TCTTACCCTCGATATTGTCAAATTTGTCTGTAGTCAATTATGCTATTCTA
ACAAAATTGAATCGGTGGTTATGCCTTATCTTAATATTAGCATCAGAAAT
GATTCAGTTAGGCCAAATTGTATAAAAAGCGGGTGCCAGACATCCGATCT
TCAAAGTTGTTTCACGAGTTCTTATATTGCTGGAATTAAATGCGGAGATG
AGCCACAATTCATAGAAAGCCCACCAAACGTTAAATGCACCAACCAAAAT
ATGACAGTGATTTGGCCTAAACAATTCTTTCCTTCAGTTAATTATACACT
TGTATCTTTAGTAACTCAATGTGATTCATCAACCAAAAACAATTCCATCG
GTGATGCTGAAATTTATATACCATTTAATGATTGTACTCCCACAATCATC
GGTAGCTCCAATTATGTCAATTTCAGTTATACAATTAAGCGTGAATATGA
TCCAACTTATTCTCTAATAGCGAAAACTTTGACTGTCTCGTGTTCATTCC
CTAAAAATATTTCTGCGAATAATACTTTTGGATTTAAAGGAGTTACCAAT
ATTCCTATTAACTCTACTACGAATTTGAAAATGGAGATGACATTTTATAG
TGACAGCGGGTATAGTTCTCAATTGCTATCCAACGGACAAATCAGTAATG
ATAAAGATCTGTTTGTTAAGGTAAACGTAATAAATCCTCCAAAGAACCTC
AGTTTAATACTCATTAACTGCCACGCATCACTCGTCAATGATTTCACCAA
TATTTATACTAATAATAGTGTCGTTTTAATTAACAATGTATGCCCAAATT
CAAATTACAACGTGGTCATTTCTCCGTTTAGTAGCACAGAAGTTAGATTT
CAATTTTCGCCTTATAAAACCATATCACAAAGTACTGTTCCGTTATATGT
TCTTTGCACAACAAGCCTTTGTTATTTGAGGCAAGATGGAAATTGTCCAA
GCTGTAGGAACAGGAAAAAGCGTAGTGCTAAATCGAGTTTAGAAGAATAT
GAGGTCTATGGAGTTTTGTTTTGGTCATAACAAGTTGAATCTATTATTTC
TGAAAACACTTAGTGACATTTAAACAGGCATTTCATCACTTCTTTTTTGG
ATATTTATACTCTTTTATAACGAATAATTTATTATTAAATTAATATATAA
ATATAGTATTCGTAAATAAATTTTGAC
back to top

protein sequence of SMED30025604-orf-1

>SMED30025604-orf-1 ID=SMED30025604-orf-1|Name=SMED30025604-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=538bp
MKNQNLYLLSLCLWSFFNIVACEILIKSISFAQGTNLFTNDTIQRDGKVI
AKLNTNEVTTICNYNFNEISAGIICKTLGFPAQALSIINSNTNMINGSVL
LANIQCTGLESNISYCVNSGRSVQPPPCSNHIMDVHVYCLQTQVPQVVTP
NDGDTICNKTSSQYSFDRLLNKINVGLPRVNISGTFYPICNDDYSLTLDI
VKFVCSQLCYSNKIESVVMPYLNISIRNDSVRPNCIKSGCQTSDLQSCFT
SSYIAGIKCGDEPQFIESPPNVKCTNQNMTVIWPKQFFPSVNYTLVSLVT
QCDSSTKNNSIGDAEIYIPFNDCTPTIIGSSNYVNFSYTIKREYDPTYSL
IAKTLTVSCSFPKNISANNTFGFKGVTNIPINSTTNLKMEMTFYSDSGYS
SQLLSNGQISNDKDLFVKVNVINPPKNLSLILINCHASLVNDFTNIYTNN
SVVLINNVCPNSNYNVVISPFSSTEVRFQFSPYKTISQSTVPLYVLCTTS
LCYLRQDGNCPSCRNRKKRSAKSSLEEYEVYGVLFWS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0006898receptor-mediated endocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036772SRCR-like_dom_sf
IPR017448SRCR-like_dom
IPR001507ZP_dom
IPR001190SRCR
Vocabulary: molecular function
TermDefinition
GO:0005044scavenger receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001507Zona pellucida domainSMARTSM00241zp_4coord: 273..516
e-value: 0.0048
score: -42.6
IPR001507Zona pellucida domainPROSITEPS51034ZP_2coord: 273..520
score: 15.389
IPR017448SRCR-like domainSMARTSM00202SR_3coord: 51..140
e-value: 8.7E-4
score: 6.8
IPR036772SRCR-like domain superfamilyGENE3DG3DSA:3.10.250.10coord: 32..146
e-value: 1.3E-12
score: 49.6
IPR036772SRCR-like domain superfamilySUPERFAMILYSSF56487SRCR-likecoord: 47..143
NoneNo IPR availableGENE3DG3DSA:2.60.40.4100coord: 383..531
e-value: 2.6E-10
score: 41.9
NoneNo IPR availablePANTHERPTHR14002:SF27CUB AND ZONA PELLUCIDA-LIKE DOMAIN-CONTAINING PROTEIN 1coord: 269..526
NoneNo IPR availablePANTHERPTHR14002ENDOGLIN/TGF-BETA RECEPTOR TYPE IIIcoord: 269..526
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR001190SRCR domainPFAMPF00530SRCRcoord: 45..139
e-value: 1.6E-11
score: 44.6
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 167..275
score: 7.304
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 29..140
score: 13.745