Thyroglobulin

Overview
NameThyroglobulin
Smed IDSMED30025599
Length (bp)1109
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thyroglobulin (SMED30025599) t-SNE clustered cells

Violin plots show distribution of expression levels for Thyroglobulin (SMED30025599) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thyroglobulin (SMED30025599) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thyroglobulin (SMED30025599) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Thyroglobulin vs. Ensembl Human
Match: NID2 (nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389])

HSP 1 Score: 54.299 bits (129), Expect = 2.412e-7
Identity = 33/112 (29.46%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +P+C+  G + P+QC GS   C+C D  G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  960 IPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREV 1071          
BLAST of Thyroglobulin vs. Ensembl Human
Match: NID2 (nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389])

HSP 1 Score: 53.9138 bits (128), Expect = 3.019e-7
Identity = 37/143 (25.87%), Postives = 65/143 (45.45%), Query Frame = 1
Query:  628 CVEDTNAS--DCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVG--SVCFCVDKNGVQI 990
            C+ D+ +S   C ++    + +         +P+C+  G + P+QC GS   C+C D  G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  198 CIPDSTSSLTPCEQQQRHAQAQYAYPGARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREV 340          
BLAST of Thyroglobulin vs. Ensembl Human
Match: NID2 (nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389])

HSP 1 Score: 53.5286 bits (127), Expect = 4.090e-7
Identity = 37/143 (25.87%), Postives = 65/143 (45.45%), Query Frame = 1
Query:  628 CVEDTNAS--DCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVG--SVCFCVDKNGVQI 990
            C+ D+ +S   C ++    + +         +P+C+  G + P+QC GS   C+C D  G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  523 CIPDSTSSLTPCEQQQRHAQAQYAYPGARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREV 665          
BLAST of Thyroglobulin vs. Ensembl Human
Match: TG (thyroglobulin [Source:HGNC Symbol;Acc:HGNC:11764])

HSP 1 Score: 52.373 bits (124), Expect = 1.101e-6
Identity = 33/113 (29.20%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSVCYCADEVGVQISGY-VTPVEKSADKNCKCARKKRQ-IEKTRNVGVIIH---CDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKC 1038
            +P C  +G YE +QC    C+C +  G ++ G  V   +     +C+  R + Q +  ++  G  +    C   G++ PVQC  S C+CVD  G    +IP    A     KC
Sbjct:  617 VPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEG---QAIPGTRSAIGKPKKC 726          
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 63.1586 bits (152), Expect = 5.883e-11
Identity = 44/116 (37.93%), Postives = 58/116 (50.00%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC-KCARKKRQIEKTR------NVGV------IIHCDILGNYSPVQCVGSV--CFCVDKNGVQIASI 999
            +G  +P+C+ +GQY P+QC GS   C+C D  G + +G  TP   S  +NC +  R K   E+ R      N GV      I  CD  G Y P QC GS   C+CVD  G + A  
Sbjct:   71 VGAFIPQCDEEGQYRPLQCHGSTGHCWCVDNRGQERAGTRTPP-GSPPRNCDEPVRPKTHCEQHRDSLQSENGGVPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGT 185          
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Match: nid2b (nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-040724-143])

HSP 1 Score: 63.5438 bits (153), Expect = 1.993e-10
Identity = 41/114 (35.96%), Postives = 60/114 (52.63%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCK-----CARKKRQIEKTRNVGVIIH-------------CDILGNYSPVQCVG--SVCFCVDKNGVQI 990
            +PKC+  GQY+P+QCLGS   C+C D  G +  G  T +  +A  NC        R +   E+ R + ++ H             CD  GN+ PVQC G  + C+CVD++GV+I
Sbjct:  745 VPKCDDKGQYKPLQCLGSTGHCWCVDSRGQERVGTRT-MPGTAHANCDQPAALVPRVETVCERWR-LALMSHYNGQPSSQDYMPLCDAHGNFQPVQCYGNSAFCWCVDRHGVEI 856          
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 63.5438 bits (153), Expect = 2.230e-10
Identity = 43/114 (37.72%), Postives = 58/114 (50.88%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC-KCARKKRQIEKTRN-----------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNGVQIA 993
            +G  +P+C+ +GQY P+QC GS   C+C D  G + +G  TP   S  +NC +  R K   E+ R+           VG  I  CD  G Y P QC GS   C+CVD  G + A
Sbjct:  856 VGAFIPQCDEEGQYRPLQCHGSTGHCWCVDNRGQERAGTRTP-PGSPPRNCDEPVRPKTHCEQHRDSLQSENGGVPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERA 968          

HSP 2 Score: 61.2326 bits (147), Expect = 1.087e-9
Identity = 43/114 (37.72%), Postives = 56/114 (49.12%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC-KCARKKRQIEKTRN-----------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNGVQIA 993
            +G  +P+C+ +GQY P QC GS   C+C D  G + +G  TP   S   NC +  R K   E+ R+           VG  I  CD  G Y P QC GS   C+CVD  G + A
Sbjct: 1084 VGAFIPQCDEEGQYRPQQCHGSTGHCWCVDSRGQERAGTRTP-PGSPRVNCDQPVRSKTHCEQHRDSLQSGDGGVPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERA 1196          

HSP 3 Score: 60.8474 bits (146), Expect = 1.429e-9
Identity = 43/114 (37.72%), Postives = 56/114 (49.12%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC-KCARKKRQIEKTRN-----------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNGVQIA 993
            +G  +P+C+ +GQY P QC GS   C+C D  G + +G  TP   S   NC +  R K   E+ R+           VG  I  CD  G Y P QC GS   C+CVD  G + A
Sbjct: 1008 VGAFIPQCDEEGQYRPQQCHGSTGHCWCVDNRGQERAGTRTP-PGSPRVNCDQPVRPKTHCEQHRDSLQSGDGGIPVVGAFIPQCDEEGQYRPQQCHGSTGHCWCVDSRGQERA 1120          
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Match: tg (thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1])

HSP 1 Score: 61.2326 bits (147), Expect = 1.264e-9
Identity = 34/106 (32.08%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGV-------------IIHCDILGNYSPVQCVGSVCFCVDKNGVQIA 993
            LP+C  DG Y+ +QC GS C+C D  G+++ G  T   +         R   Q EK R + +             I  C+  G Y   QC+G  CFCVD++G ++ 
Sbjct:  606 LPQCTEDGLYQDVQCQGSECWCVDSRGLEVPGSRTTGSR--------PRCPSQCEKERQMAIAVKASSSAGSEVFIPKCETDGAYVARQCLGKSCFCVDRSGTKLG 703          
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Match: nid2b (nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-040724-143])

HSP 1 Score: 60.077 bits (144), Expect = 1.731e-9
Identity = 41/114 (35.96%), Postives = 60/114 (52.63%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCK-----CARKKRQIEKTRNVGVIIH-------------CDILGNYSPVQCVG--SVCFCVDKNGVQI 990
            +PKC+  GQY+P+QCLGS   C+C D  G +  G  T +  +A  NC        R +   E+ R + ++ H             CD  GN+ PVQC G  + C+CVD++GV+I
Sbjct:   96 VPKCDDKGQYKPLQCLGSTGHCWCVDSRGQERVGTRT-MPGTAHANCDQPAALVPRVETVCERWR-LALMSHYNGQPSSQDYMPLCDAHGNFQPVQCYGNSAFCWCVDRHGVEI 207          
BLAST of Thyroglobulin vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 79.337 bits (194), Expect = 2.300e-15
Identity = 49/146 (33.56%), Postives = 78/146 (53.42%), Query Frame = 1
Query:  607 GLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC----------KCARKKRQIE---KTRNVGVII-HCDILGNYSPVQCVGSV--CFCVDKNGVQI 990
            G +CT+I   +   + C +K   +  +  +  +G  +P+C+++G Y P+QC GS   C+C D++G +I+G  TP  + A  NC           C  K++Q+        VG  +  CD+ GNY P+QC GS   C+CVDK G +I
Sbjct:  912 GFQCTQILGPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPA-PNCGERGPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEI 1056          

HSP 2 Score: 67.0106 bits (162), Expect = 2.582e-11
Identity = 44/135 (32.59%), Postives = 70/135 (51.85%), Query Frame = 1
Query:  655 CFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC----------KCARKKRQIEKTRN-------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNGVQIA 993
            C +K   +  +  +  +G  +P+C+++G Y P+QC GS   C+C D++G +I+G  TP  + A  NC           C  +++Q+    +       VG  +  CD  GNY  +QC GS   C+CVDK G +IA
Sbjct: 1005 CLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPA-PNCGETGPEPLKTPCLERRQQLLGQLHPRGPRPAVGQFVPECDAEGNYVSLQCHGSTGHCWCVDKLGEEIA 1138          

HSP 3 Score: 60.4622 bits (145), Expect = 3.121e-9
Identity = 37/115 (32.17%), Postives = 58/115 (50.43%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP----------VEKSADKNCKCARKKRQI-----EKTRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +G  +P+C+ +G Y  +QC GS   C+C D++G +I+G  TP           E +      C R K+ +      K      +  CD  G++SP+QC G+   C+CVDK G +I
Sbjct: 1102 VGQFVPECDAEGNYVSLQCHGSTGHCWCVDKLGEEIAGTRTPPGRPGPNCGETEPTRRPQTVCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREI 1216          
BLAST of Thyroglobulin vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 74.7146 bits (182), Expect = 7.633e-14
Identity = 46/148 (31.08%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  607 GLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCK-----------CARKKRQI-----EKTRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            G +CT+I   +   + C +K   +  +  +  +G  +P+C+++G Y P+QC GS   C+C D++G +I+G  TP  + A  NC            C R K+ +      K      +  CD  G++SP+QC G+   C+CVDK G +I
Sbjct:  870 GFQCTQILGPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPA-PNCGERGPEPLKTPLCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREI 1016          
BLAST of Thyroglobulin vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 73.9442 bits (180), Expect = 1.237e-13
Identity = 48/151 (31.79%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  607 GLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC----------KCARKKRQIEKTRN-------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNGVQIA 993
            G +CT+I   +   + C +K   +  +  +  +G  +P+C+++G Y P+QC GS   C+C D++G +I+G  TP  + A  NC           C  +++Q+    +       VG  +  CD  GNY  +QC GS   C+CVDK G +IA
Sbjct:  912 GFQCTQILGPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPA-PNCGETGPEPLKTPCLERRQQLLGQLHPRGPRPAVGQFVPECDAEGNYVSLQCHGSTGHCWCVDKLGEEIA 1061          

HSP 2 Score: 60.8474 bits (146), Expect = 2.043e-9
Identity = 37/115 (32.17%), Postives = 58/115 (50.43%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP----------VEKSADKNCKCARKKRQI-----EKTRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +G  +P+C+ +G Y  +QC GS   C+C D++G +I+G  TP           E +      C R K+ +      K      +  CD  G++SP+QC G+   C+CVDK G +I
Sbjct: 1025 VGQFVPECDAEGNYVSLQCHGSTGHCWCVDKLGEEIAGTRTPPGRPGPNCGETEPTRRPQTVCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREI 1139          
BLAST of Thyroglobulin vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 70.0922 bits (170), Expect = 2.229e-12
Identity = 45/152 (29.61%), Postives = 75/152 (49.34%), Query Frame = 1
Query:  595 QCNYGLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCK-----------CARKKRQI-----EKTRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +CN G +       +   + C +K   +  +  +  +G  +P+C+++G Y P+QC GS   C+C D++G +I+G  TP  + A  NC            C R K+ +      K      +  CD  G++SP+QC G+   C+CVDK G +I
Sbjct:  874 RCNSGYEGDGFQCPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPA-PNCGERGPEPLKTPLCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREI 1024          
BLAST of Thyroglobulin vs. Ensembl Xenopus
Match: nid2 (nidogen 2 [Source:NCBI gene;Acc:100036716])

HSP 1 Score: 66.6254 bits (161), Expect = 2.980e-11
Identity = 40/116 (34.48%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCK-----------CARKKRQI-----EKTRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +G  +P+C+++G Y P+QC GS   C+C D++G +I+G  TP  + A  NC            C R K+ +      K      +  CD  G++SP+QC G+   C+CVDK G +I
Sbjct:  831 VGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEITGTRTPPGRPA-PNCGERGPEPLKTPLCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCHGNSGYCWCVDKEGREI 945          
BLAST of Thyroglobulin vs. Ensembl Mouse
Match: Nid2 (nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229])

HSP 1 Score: 53.9138 bits (128), Expect = 2.810e-7
Identity = 33/112 (29.46%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +P+C+  G + P+QC GS   C+C D  G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  988 IPQCDDQGNFVPLQCHGSTGFCWCVDRNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREL 1099          
BLAST of Thyroglobulin vs. Ensembl Mouse
Match: Nid2 (nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229])

HSP 1 Score: 52.373 bits (124), Expect = 7.932e-7
Identity = 33/112 (29.46%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +P+C+  G + P+QC GS   C+C D  G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  723 IPQCDDQGNFVPLQCHGSTGFCWCVDRNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREL 834          
BLAST of Thyroglobulin vs. Ensembl Mouse
Match: Tg (thyroglobulin [Source:MGI Symbol;Acc:MGI:98733])

HSP 1 Score: 51.6026 bits (122), Expect = 1.392e-6
Identity = 28/97 (28.87%), Postives = 43/97 (44.33%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNC--KCARKKRQIEKTRNVG------VIIHCDILGNYSPVQCVGSVCFCVDKNG 981
            +P C   G YE +QC    C+C D  G ++ G      +     C  KC +++ Q++   +         +  C   G + PVQC  S C+CVD  G
Sbjct:  617 VPSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRV---RGGRPRCPTKCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFNSECYCVDTEG 710          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|P31226|SAX_LITCT (Saxiphilin OS=Lithobates catesbeianus OX=8400 PE=1 SV=3)

HSP 1 Score: 56.225 bits (134), Expect = 2.885e-7
Identity = 48/146 (32.88%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  604 YGLKCTKICVEDTNASDCFKKHLDVRRK-IKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCKCAR-------KKRQIEKTRNVGV----IIHCDILGNYSPVQCVGSV--CFCVDKNGVQIA 993
            Y LK   I  E  +++   +K L  R++ + K  IG  +P+C+  G Y+P QC GS   C+C + +G +ISG  TP  ++      C R       K+RQ+    +  V    +  CD  GNY P Q  GS    +CV+  G +IA
Sbjct:   91 YNLK--PIIAEPYSSNRDLQKCLKERQQALAKKMIGHYIPQCDEKGNYQPQQCHGSTGHCWCVNAMGEKISGTNTPPGQT---RATCERHELPKCLKERQVALGGDEKVLGRFVPQCDEKGNYEPQQFHGSTGYSWCVNAIGEEIA 231          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|B5DFC9|NID2_RAT (Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 9.574e-7
Identity = 33/112 (29.46%), Postives = 55/112 (49.11%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +P+C+  G + P+QC GS   C+C D+ G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  981 IPQCDDQGNFVPLQCHGSTGFCWCVDQNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREL 1092          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|Q14112|NID2_HUMAN (Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3)

HSP 1 Score: 54.299 bits (129), Expect = 1.158e-6
Identity = 33/112 (29.46%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +P+C+  G + P+QC GS   C+C D  G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  960 IPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREV 1071          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|P01267|THYG_BOVIN (Thyroglobulin OS=Bos taurus OX=9913 GN=TG PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.570e-6
Identity = 31/97 (31.96%), Postives = 46/97 (47.42%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSVCYCADEVGVQISGY-VTPVEKSADKNCKCARKKRQ-IEKTRNVG---VIIHCDILGNYSPVQCVGSVCFCVDKNGVQI 990
            +P C  +G YE +QC    C+C D  G +++G  V          C+  R + Q +  ++  G    +  C   GN+ PVQC  S C+CVD  G  I
Sbjct:  616 VPACTAEGSYEEVQCFAGDCWCVDAQGRELAGSRVRGGRPRCPTECEKQRARMQSLLGSQPAGSSLFVPACTSKGNFLPVQCFNSECYCVDTEGQPI 712          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|O88322|NID2_MOUSE (Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 1.966e-6
Identity = 33/112 (29.46%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP-----------VEKSADKNCKCARKKRQIEK-----TRNVGVIIHCDILGNYSPVQCVGS--VCFCVDKNGVQI 990
            +P+C+  G + P+QC GS   C+C D  G ++ G  TP            E +      C R +  + +      R+   +  CD LG++ P+QC G    C+CVDK+G ++
Sbjct:  988 IPQCDDQGNFVPLQCHGSTGFCWCVDRNGHEVPGTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREL 1099          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A194AKI3 (Uncharacterized protein OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.391e-21
Identity = 57/168 (33.93%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  541 FGFSYKLE--EGVPCDGQTDQCNYGLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKC 1038
             G S K E   G+ CD +T +C  G     + +   + + C    L  +       +G P P C+ +G Y+P QC GS CYC  + G +ISGY   V ++    C+CAR + +   +  +G   +C   G+Y   QC G VCFC D NGV++   P+V+I+ V+K+ C
Sbjct:   73 LGVSMKAECAPGLHCDPKTLKCVQGFG--GLLLSRRDDAPCAAALLKAQNG--PSLLGAPTPSCDGEGYYQPKQCQGSQCYCVSKNGKEISGYTANVWEAQQMTCQCARDQAEYMASGLIGKFFYCTSDGSYQTYQCQGDVCFCADTNGVKMDHSPSVHISQVTKLNC 236          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A2T7PUN3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04128 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.714e-18
Identity = 52/140 (37.14%), Postives = 79/140 (56.43%), Query Frame = 1
Query:  631 VEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQ--YEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK 1044
            V  T A+ C ++ LD RR+   + IG  LP+C+      Y P+QC GSVCYC    G ++S Y + +      NC+CAR++ +  KT   G I +C   G YSP +C GS CFCV+++G ++      NI   S+ +C++
Sbjct:   16 VPATIAASC-QEELDSRRQ--NYAIGGFLPRCDAGNTALYSPLQCHGSVCYCVSSDGTRLSDY-SNIPIGTPGNCECAREEDEFRKTGMRGQIFNCAPDGTYSPTRCTGSRCFCVNRDGTRMQEYLEANIWEASECECAR 151          

HSP 2 Score: 70.8626 bits (172), Expect = 2.502e-10
Identity = 37/107 (34.58%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  724 CELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK 1044
            C  DG Y P +C GS C+C +  G ++  Y+      A + C+CAR K    + R  G+  +C+  G+Y   QC GS C CV +NG  I    + +IA+ S   C++
Sbjct:  107 CAPDGTYSPTRCTGSRCFCVNRDGTRMQEYLEANIWEASE-CECARAKADYAERRIRGLRFNCERDGSYGAKQCTGSTCRCVKRNGNPIPEFQSFHIAHSSDCGCAR 212          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A2T7PUS9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04132 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.752e-18
Identity = 52/140 (37.14%), Postives = 74/140 (52.86%), Query Frame = 1
Query:  631 VEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCEL--DGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK 1044
            V  T A+ C ++ LD RR+   + IG  LP+C+      Y P+QC GS CYC    G  +S Y + +      NC+CARK+ +  K R  G I +C   G YSP +C GS CFCV +NG ++      +I   S   C++
Sbjct:   16 VPATIAASC-QEELDSRRQ--NYAIGGFLPRCDAGNSALYSPIQCRGSACYCVSSDGTMLSDY-SNIPFGTPSNCECARKEYEFSKARMKGQIFNCAPDGTYSPTRCYGSRCFCVYRNGARMQEYQDRSIGQASTCACAR 151          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A1S3IF36 (uncharacterized protein LOC106163748 OS=Lingula unguis OX=7574 GN=LOC106163748 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.184e-17
Identity = 53/180 (29.44%), Postives = 87/180 (48.33%), Query Frame = 1
Query:  553 YKLEEGVPCDGQ-------TDQCNYGLKCTKICVEDTNASDCFKK-----------HLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKC 1038
            ++LEEG  C          + +C  GL C      D N S C ++            ++  R+  +  +G   P C+ DG Y   QC+ + C+C ++ G ++  Y     ++ D  C CAR + + +K   +G +  C+  GNY   QC GSVC+CVD+ G ++ S P V+I+ V  + C
Sbjct:   57 HQLEEGDSCSATLLLGSPPSSECGEGLFC------DINTSKCRRQTCAMSRALVLARIEESRRQGQPLLGATPPTCDADGTYSAKQCIEASCFCVNKDGDRLGDYSARFWEAKDMTCNCARDEDEYQKKGLIGKMYICNENGNYEKYQCTGSVCYCVDEKGSKLESTPPVSISAVKTLNC 230          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A1S3J5E7 (equistatin-like OS=Lingula unguis OX=7574 GN=LOC106170269 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.019e-16
Identity = 40/124 (32.26%), Postives = 66/124 (53.23%), Query Frame = 1
Query:  667 HLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKC 1038
             ++  R+  +  +G   P C+ DG Y   QC  + C+C ++ G ++  Y     ++ D  C CAR + + +K   +G +  C   GNY   QC GSVC+CVD+ G ++ S P V+I+ V  + C
Sbjct:    9 RIEESRRQGQPLLGATPPTCDADGTYSAKQCKEASCFCVNKDGDRLGDYSARFWEAKDMTCNCARDEDEYQKKGLIGKMYICKENGNYEKYQCTGSVCYCVDEKGSKLESTPPVSISAVKTLNC 132          
BLAST of Thyroglobulin vs. Ensembl Cavefish
Match: tg (thyroglobulin [Source:NCBI gene;Acc:103037495])

HSP 1 Score: 62.7734 bits (151), Expect = 3.282e-10
Identity = 35/108 (32.41%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGV-------------IIHCDILGNYSPVQCVGSVCFCVDKNGVQIASI 999
            LP+C  DGQY+ +QC GS C+CAD  G ++ G      +S     +C  +    EK R + +             I  C+  G Y  +QC+G  CFC+D+ GV+ +++
Sbjct:  626 LPQCTEDGQYQAVQCQGSECWCADSQGQEVMG-----SRSIGYRPRCPSR---CEKERMMAIAVKASSSAGSEVFIPKCEEDGEYVSLQCLGKSCFCLDQRGVRYSTL 725          

HSP 2 Score: 53.9138 bits (128), Expect = 2.099e-7
Identity = 31/97 (31.96%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQC-LGSVCYCADEVGVQISGYVTPVEKSADKNC--KCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSV--CFCVDKNGVQI 990
            +P+C  DG+Y  +QC  G  C+C +  G +I G     +      C   C  +++++  + + GV+  C   G Y PVQC G++  C+CVD  G++I
Sbjct:   80 IPQCSEDGRYRYVQCNRGGECWCVNSDGTEIPG---SRQNDTVVTCLTPCQLQRQRLLLSGDAGVVPRCLDSGEYEPVQCDGALGQCWCVDMEGMEI 173          
BLAST of Thyroglobulin vs. Ensembl Cavefish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 61.6178 bits (148), Expect = 7.867e-10
Identity = 40/108 (37.04%), Postives = 50/108 (46.30%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRN----------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNG 981
            +G  +P+C+  GQY P QC GS   C+C D  G +  G  TP          C R K Q E+ R+          VG  +  CD  G Y P QC GS   C+CVD  G
Sbjct:  867 VGAYVPQCDDQGQYRPQQCHGSTGHCWCVDSRGQERQGTRTP---PGSPRFNCDRPKTQCEQHRDSLQRGDGSPPVGAFVPECDEQGQYRPQQCHGSTGHCWCVDIRG 971          

HSP 2 Score: 60.077 bits (144), Expect = 2.060e-9
Identity = 42/108 (38.89%), Postives = 51/108 (47.22%), Query Frame = 1
Query:  706 GMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCKCA-RKKRQIEKTRN----------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNG 981
            G  +P+C+  GQY P QC GS   C+C D  G +  G  TP   S   NC    R K Q E+ R+          VG  +  CD  G Y P QC GS   C+CVD  G
Sbjct:  793 GAFVPECDEQGQYRPQQCHGSTGHCWCVDSRGQERQGTRTP-PGSPQFNCDAPERPKTQCEQHRDSLQRGDGSPPVGAYVPQCDDQGQYRPQQCHGSTGHCWCVDSRG 899          

HSP 3 Score: 58.5362 bits (140), Expect = 6.200e-9
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCKC-----ARKKRQIEKTRNVGVIIH-------------CDILGNYSPVQCVG--SVCFCVDKNGVQIA 993
            IG  +P+C+  GQY P QC GS   C+C D  G +  G  TP   ++  NC        R +   E+ R   ++ H             CD  G ++PVQC G  S C+CVD++G ++A
Sbjct: 1089 IGAYVPQCDEQGQYRPQQCHGSTGHCWCVDSRGQERQGTRTP-PGTSPYNCDAPVVPTQRPETVCERWR-ASLLEHYGGRPSPQQYLPQCDSAGEFNPVQCYGDSSYCWCVDRDGREVA 1205          

HSP 4 Score: 57.3806 bits (137), Expect = 1.535e-8
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCKCA-RKKRQIEKTRN----------VGVII-HCDILGNYSPVQCVGSV--CFCVDKNG 981
            +G  +P+C+  GQY   QC GS   C+C D  G +  G  TP   S   NC    R K Q E+ R+          +G  +  CD  G Y P QC GS   C+CVD  G
Sbjct: 1014 VGAYVPQCDDQGQYRQQQCHGSTGHCWCVDSRGQERQGTRTP-PGSPQFNCDAPERPKTQCEQHRDSLQRGDGSPPIGAYVPQCDEQGQYRPQQCHGSTGHCWCVDSRG 1121          
BLAST of Thyroglobulin vs. Ensembl Cavefish
Match: nid2b (nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-040724-143])

HSP 1 Score: 55.0694 bits (131), Expect = 8.075e-8
Identity = 36/112 (32.14%), Postives = 53/112 (47.32%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCK----CARKKRQIEKTRNV------------GVIIHCDILGNYSPVQCVG--SVCFCVDKNGVQI 990
            +P+C+  GQY+P+QCLGS   C+C D  G +  G  T +  +A  NC       R +   E+ R                +  CD  G++  VQC G  S C+CVD  G ++
Sbjct:  721 IPQCDEKGQYKPLQCLGSTGHCWCVDSRGQERVGTRT-LPGTAHANCDQPPLVPRAETLCERWRTTLLSHYGGQPDPQDYMPQCDARGHFLSVQCYGNSSYCWCVDSQGREV 831          
BLAST of Thyroglobulin vs. Ensembl Sea Lamprey
Match: tg (thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1])

HSP 1 Score: 60.8474 bits (146), Expect = 2.757e-10
Identity = 37/99 (37.37%), Postives = 50/99 (50.51%), Query Frame = 1
Query:  721 KCELDG-QYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCA---RKKRQI--EKTRNVGV---IIHCDILGNYSPVQCVGSVCFCVDKNGVQI 990
            +C  DG  YEP+QC G+ C+C D  G +I+G  T     A   C  A    + R +   + R VG    +  CD  G+Y PVQC G  CFCV   G ++
Sbjct:  609 RCGEDGGAYEPVQCHGAACWCVDAHGREIAG--TRAVGGAPPRCPSACEGERARALLARRGRPVGTPLFVPECDGAGDYRPVQCSGDRCFCVGAGGAEV 705          

HSP 2 Score: 50.8322 bits (120), Expect = 4.120e-7
Identity = 28/102 (27.45%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  703 IGMPL--PKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEK--SADKNCKCARKKRQIEKTRNVGVII--------------HCDILGNYSPVQCVGS 954
            +G PL  P+C+  G Y P+QC G  C+C    G ++ G   P+    +    C+ A     +++ R++G ++               CD  G + PVQC G+
Sbjct:  670 VGTPLFVPECDGAGDYRPVQCSGDRCFCVGAGGAEVPGTGRPLGDPVTCPTPCQAAAASELLQQLRHLGPVLRGDAPSSLPPLYVPRCDARGGWRPVQCDGA 771          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO40364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B5])

HSP 1 Score: 59.6918 bits (143), Expect = 1.725e-10
Identity = 42/135 (31.11%), Postives = 65/135 (48.15%), Query Frame = 1
Query:  610 LKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQC--LGSVCYCADEVGVQISGYVT------PVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQI 990
            +KCTK  V +T      K+ L+     K  F+    P+C+ DGQ+E +QC      C+C D  G++I G  T      P + ++   C+   +   +        +  C   G Y  VQC G+VC+CVDK G++I
Sbjct:   63 VKCTKQGVPETECQSQVKQALETPSG-KGRFV----PRCKADGQFEEVQCNEWTGQCWCVDNSGIEIQGTRTKDFVSCPGQTNSLTVCQYKHQVSSVNAAPGA-FVPQCRSDGGYDVVQCRGAVCYCVDKRGIEI 191          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO40372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7C3])

HSP 1 Score: 54.6842 bits (130), Expect = 6.701e-9
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  706 GMPLPKCELDGQYEPMQC--LGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGV---------IIHCDILGNYSPVQCVGSV--CFCVDKNGVQIASIPAVNIANVSK 1029
            G+ +P+CE DG +  +QC  L   C+C D  G  + G  T V    D + +      Q ++    GV         +  CD  G Y PVQC+ +   C+CVDK+G++I       +  V K
Sbjct:    1 GVNVPRCESDGSFSSVQCNELTGYCWCVDRQGNPVFG--TEVRGQPDCSARVGLTPCQKQRFNAYGVSESTPADRYVPRCDASGGYEPVQCLSTTGHCWCVDKDGIEIRGTRRRGVRPVCK 119          

HSP 2 Score: 51.6026 bits (122), Expect = 6.626e-8
Identity = 37/104 (35.58%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGY----VTPVEKSADKNCKCARKK-RQIEKT--RNVGVII-HCDILGNYSPVQC--VGSVCFCVDKNGVQI 990
            +P+C+  G YEP+QCL +   C+C D+ G++I G     V PV K    N  C R++ R +  T  R  G+ +  C   G+Y  VQC  +   C+CVD++G ++
Sbjct:   75 VPRCDASGGYEPVQCLSTTGHCWCVDKDGIEIRGTRRRGVRPVCKQG-YNTPCERERYRALGWTGLRVTGLWVPDCRPDGSYESVQCHALSGYCWCVDRSGHEL 177          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO39095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB04])

HSP 1 Score: 51.6026 bits (122), Expect = 4.896e-8
Identity = 34/97 (35.05%), Postives = 48/97 (49.48%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRN--VGVII-HCDILGNYSPVQCVGSV--CFCVD 972
            +G  LP C++ G YE +QC GS+  C+C D  G +I G       S D         +   ++R   +G  I  CD  G YS +QC GS   C+CV+
Sbjct:   79 VGRFLPSCDVKGAYEKIQCWGSIGFCWCVDSSGNEIKGTRVRGTPSCDTTPAPTASGKHWAQSRGPLIGAYIPQCDKDGRYSALQCHGSTGYCWCVN 175          

HSP 2 Score: 48.9062 bits (115), Expect = 5.301e-7
Identity = 31/111 (27.93%), Postives = 55/111 (49.55%), Query Frame = 1
Query:  703 IGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC-----KCARKKRQIEKTRNVGV------IIHCDILGNYSPVQCVGSV--CFCVDKNGVQI 990
            +G  +P+C  +G+Y+ +QC GS   C+C D++G  + G +       + +       C  K+    +    G+      +  CD+ G Y  +QC GS+  C+CVD +G +I
Sbjct:    4 VGKYIPQCTPEGEYKQVQCYGSTGYCWCVDQMGSPVLGTIVRGVPQCNSSAVGGMTNCQTKRAAALQGSQGGLQPVGRFLPSCDVKGAYEKIQCWGSIGFCWCVDSSGNEI 114          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO47797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL43])

HSP 1 Score: 50.447 bits (119), Expect = 1.605e-7
Identity = 35/120 (29.17%), Postives = 59/120 (49.17%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCL--GSVCYCADEVGVQISGYVT---PVEKSADKNCKCARKKRQIEKTRNVG-------VIIHCDILGNYSPVQCVGSV--CFCVDKNGVQIASIPAVNIANVSKI 1032
            LP+C+  G+YE +QC     +C+C DE G +I+   T   P    A K+ +C  ++R+    R+          +  C   G ++P+QC  +   C+CVD NG ++A        N ++I
Sbjct:   74 LPQCKPTGRYEEVQCHTGTGLCWCVDERGQEITRTRTWGYPRCHMAPKS-ECYNRRREAAHARSARRLSGFPFFVSQCQPDGGFTPLQCHSATGFCWCVDGNGNELAGTRVWGRNNCTEI 192          

HSP 2 Score: 47.3654 bits (111), Expect = 1.987e-6
Identity = 33/105 (31.43%), Postives = 50/105 (47.62%), Query Frame = 1
Query:  715 LPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVT----PVEKSADKNCKCARKKRQ----IEKTRNVGVIIHCDILGNYSPVQC-VGS-VCFCVDKNGVQIA 993
            +P C  DG +  +QC G    C+C D  G++I G VT    P  K A +   C R++        +  +   +  C   G Y  VQC  G+ +C+CVD+ G +I 
Sbjct:    2 IPTCRDDGSFAEVQCHGLTGQCWCVDMNGIEIPGSVTRGHRPDCKKAAQTTSCQRQRTAALGLTGRPNSARYLPQCKPTGRYEEVQCHTGTGLCWCVDERGQEIT 106          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO40366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B7])

HSP 1 Score: 50.447 bits (119), Expect = 1.643e-7
Identity = 38/120 (31.67%), Postives = 59/120 (49.17%), Query Frame = 1
Query:  706 GMPLPKCELDGQYEPMQC-LGS-VCYCADEVGVQISGYV---TPVEKSADKNCKCARKKRQIE--KTRNVGVIIHCDILGNYSPVQC--VGSVCFCVDKNGVQIASIPAVNIANVSKIKC 1038
            G+ +P+C+ DG YE MQC +G+ +C+C D  G +I G     +P  +SA       +K+RQI    T        C   G++  +QC  + + C+CVD+ G +I         N  K  C
Sbjct:    1 GLFVPECKPDGTYEGMQCHVGTGLCWCVDRWGHEIIGTRVKGSPDCRSAQAGLTMCQKERQIAIGWTGVAAPGSFCKQDGSFDSIQCHALSAECWCVDRRGTEIPGTRTKGRPNCEKPAC 120          

HSP 2 Score: 46.595 bits (109), Expect = 3.136e-6
Identity = 32/114 (28.07%), Postives = 56/114 (49.12%), Query Frame = 1
Query:  682 RKIKKHFIGMPLPK--CELDGQYEPMQC--LGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVG--VIIHCDILGNYSPVQC--VGSVCFCVDKNGVQIASI 999
            R+I   + G+  P   C+ DG ++ +QC  L + C+C D  G +I G  T    + +K   C +++      R +    +  C + G YSP+QC      C+CVD+ G ++ + 
Sbjct:   60 RQIAIGWTGVAAPGSFCKQDGSFDSIQCHALSAECWCVDRRGTEIPGTRTKGRPNCEKP-ACMQERMYAMGDRAIPGRYVPKCTVDGRYSPMQCHYSSGYCWCVDEFGREVPNT 172          
BLAST of Thyroglobulin vs. Ensembl Medaka
Match: nid2a (nidogen 2 [Source:NCBI gene;Acc:101173773])

HSP 1 Score: 51.2174 bits (121), Expect = 1.269e-6
Identity = 37/112 (33.04%), Postives = 53/112 (47.32%), Query Frame = 1
Query:  700 FIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTPVEKSADKNC--------KCARKKRQI-----EKTRNVGVII-HCDILGNYSPVQCVGSV--CFCVDKNG 981
             +G+ +P+C+  G+Y P QC  S   C+C D  G + +G  TP   SA  +C        +C R +  +     E   +VG  +  CD  G Y P QC  S   C+CVD  G
Sbjct:  783 LLGVYVPQCDESGKYLPQQCHDSTGYCWCVDSTGQERTGTRTP-PGSALVDCNEQPHYKTRCERHREHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMG 893          

HSP 2 Score: 49.2914 bits (116), Expect = 5.260e-6
Identity = 36/124 (29.03%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  661 KKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVT-PVEKSAD------KNCKCARKKRQIEKTRNVGVII------HCDILGNYSPVQCVGS--VCFCVDKNG 981
            ++H+    +  +  +G  +P+C+ +G+Y P QC  S   C+C D +G + SG  + P   S D          C R +  +  +   G  +       CD  G+Y P QC GS   C+CVD +G
Sbjct:  847 REHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMGQERSGTRSAPGSPSMDCSKPGAPKTPCERLRESVLASSAGGRPLAGAYAPQCDEDGHYVPRQCHGSSGYCWCVDSSG 970          
BLAST of Thyroglobulin vs. Ensembl Medaka
Match: nid2a (nidogen 2 [Source:NCBI gene;Acc:101173773])

HSP 1 Score: 51.2174 bits (121), Expect = 1.441e-6
Identity = 34/114 (29.82%), Postives = 51/114 (44.74%), Query Frame = 1
Query:  700 FIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVTP----------VEKSADKNCKCARKKRQI-----EKTRNVGVII-HCDILGNYSPVQCVGSV--CFCVDKNG 981
             +G+ +P+C+  G+Y P QC  S   C+C D  G + +G  TP           ++      +C R +  +     E   +VG  +  CD  G Y P QC  S   C+CVD  G
Sbjct:  859 LLGVYVPQCDESGKYLPQQCHDSTGYCWCVDSTGQERTGTRTPPGSALVDCSRTDEQPHYKTRCERHREHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMG 972          

HSP 2 Score: 50.8322 bits (120), Expect = 2.098e-6
Identity = 41/157 (26.11%), Postives = 67/157 (42.68%), Query Frame = 1
Query:  571 VPCDGQTDQCNYGLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSV--CYCADEVGVQISGYVT-PVEKSAD---------KNCKCARKKRQIEKTRNVGVII------HCDILGNYSPVQCVGS--VCFCVDKNG 981
            V C    +Q +Y  +C +            ++H+    +  +  +G  +P+C+ +G+Y P QC  S   C+C D +G + SG  + P   S D             C R +  +  +   G  +       CD  G+Y P QC GS   C+CVD +G
Sbjct:  907 VDCSRTDEQPHYKTRCER-----------HREHVLASEREDRPSVGAYVPQCDQNGEYVPQQCHTSTGYCWCVDGMGQERSGTRSAPGSPSMDCSKPDEALQPKTPCERLRESVLASSAGGRPLAGAYAPQCDEDGHYVPRQCHGSSGYCWCVDSSG 1052          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000016995.1 (SMESG000016995.1)

HSP 1 Score: 184.111 bits (466), Expect = 8.292e-58
Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 1
Query:  766 SVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK 1044
            SVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK
Sbjct:   22 SVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK 114          

HSP 2 Score: 46.9802 bits (110), Expect = 4.004e-12
Identity = 21/21 (100.00%), Postives = 21/21 (100.00%), Query Frame = 3
Query:  615 MHKDMRRRYECVRLFQETFGC 677
            MHKDMRRRYECVRLFQETFGC
Sbjct:    1 MHKDMRRRYECVRLFQETFGC 21          

HSP 3 Score: 42.743 bits (99), Expect = 4.004e-12
Identity = 19/44 (43.18%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  679 RRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQISG 810
            +R+I+K      +  C++ G Y P+QC+GSVC+C D+ GVQI+ 
Sbjct:   55 KRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIAS 98          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000016995.1 (SMESG000016995.1)

HSP 1 Score: 183.726 bits (465), Expect = 8.868e-58
Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 1
Query:  766 SVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK 1044
            SVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK
Sbjct:   18 SVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCSK 110          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000016992.1 (SMESG000016992.1)

HSP 1 Score: 175.637 bits (444), Expect = 9.967e-54
Identity = 80/164 (48.78%), Postives = 111/164 (67.68%), Query Frame = 1
Query:  547 FSYKLEEGVPCDGQTDQCNYGLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKC 1038
            FS  LEE   C+   + CNYGL C K+C EDT A DCFK+HL VRR+ K+H +G   P CE +G Y+ +QC+GSVCYC+D+ GV+ISG++TP+  SA+KNCKCA+++ +  K   +G    C  LGNY   QC GSVC+C D++G ++     V+I +  K+KC
Sbjct:   15 FSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHLAVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDKNGVEISGFITPIHLSANKNCKCAKERDEYHKKHLIGRFFRCSELGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKC 178          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000016993.1 (SMESG000016993.1)

HSP 1 Score: 175.252 bits (443), Expect = 1.780e-53
Identity = 80/164 (48.78%), Postives = 113/164 (68.90%), Query Frame = 1
Query:  547 FSYKLEEGVPCDGQTDQCNYGLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKC 1038
            FS  LEE   C+   + CNYGL C K+C EDT A DCFK+HL VRR+ K+H +G   P CE +G Y+ +QC+GSVCYC+D+ GV+ISG++TP+  SA+KNCKCA+++ +  K+  +G    C+ LGNY   QC GSVC+C D++G ++     V+I +  K+KC
Sbjct:   15 FSALLEEFEVCENNENVCNYGLSCDKVCKEDTEAPDCFKQHLSVRRRWKEHILGARAPSCEENGDYKALQCVGSVCYCSDKNGVEISGFITPIHLSANKNCKCAKERDEYLKSHLIGRYFGCNHLGNYEKAQCHGSVCYCADEDGKKVEGSQTVHIVDFDKLKC 178          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000016994.1 (SMESG000016994.1)

HSP 1 Score: 173.326 bits (438), Expect = 8.095e-53
Identity = 83/165 (50.30%), Postives = 109/165 (66.06%), Query Frame = 1
Query:  547 FSYKLEEGVPCDGQTDQCNYGLKCTKICVEDTNASDCFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQISGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGSVCFCVDKNGVQIASIPAVNIANVSKIKCS 1041
            F   LEE   C  + D+CNYGL C +IC ED  A DCFKKHLDVRRK+    IG+ LP CE +G Y+P+QCLGSVC+C D+ G +I G+ +P+ KS +K CKCA+ + + +K R +G    CD  GNY   QC GSVCFC D+NG + +  P VNI  + ++KC 
Sbjct:   15 FCEVLEEFQLCLNEEDKCNYGLFCNEICEEDEEAPDCFKKHLDVRRKLANKVIGIRLPNCEENGDYKPVQCLGSVCHCVDKHGERIEGFSSPIYKSTNKTCKCAKDRDEYQKLRLIGRYFGCDNQGNYKRTQCHGSVCFCADENGKKTSGSPTVNIGQLDQLKCE 179          
The following BLAST results are available for this feature:
BLAST of Thyroglobulin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NID22.412e-729.46nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389][more]
NID23.019e-725.87nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389][more]
NID24.090e-725.87nidogen 2 [Source:HGNC Symbol;Acc:HGNC:13389][more]
TG1.101e-629.20thyroglobulin [Source:HGNC Symbol;Acc:HGNC:11764][more]
back to top
BLAST of Thyroglobulin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nid2a5.883e-1137.93nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2b1.993e-1035.96nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2a2.230e-1037.72nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
tg1.264e-932.08thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1][more]
nid2b1.731e-935.96nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Thyroglobulin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nid22.300e-1533.56nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid27.633e-1431.08nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid21.237e-1331.79nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid22.229e-1229.61nidogen 2 [Source:NCBI gene;Acc:100036716][more]
nid22.980e-1134.48nidogen 2 [Source:NCBI gene;Acc:100036716][more]
back to top
BLAST of Thyroglobulin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nid22.810e-729.46nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229][more]
Nid27.932e-729.46nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229][more]
Tg1.392e-628.87thyroglobulin [Source:MGI Symbol;Acc:MGI:98733][more]
back to top
BLAST of Thyroglobulin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31226|SAX_LITCT2.885e-732.88Saxiphilin OS=Lithobates catesbeianus OX=8400 PE=1... [more]
sp|B5DFC9|NID2_RAT9.574e-729.46Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE... [more]
sp|Q14112|NID2_HUMAN1.158e-629.46Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=... [more]
sp|P01267|THYG_BOVIN1.570e-631.96Thyroglobulin OS=Bos taurus OX=9913 GN=TG PE=1 SV=... [more]
sp|O88322|NID2_MOUSE1.966e-629.46Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV... [more]
back to top
BLAST of Thyroglobulin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A194AKI32.391e-2133.93Uncharacterized protein OS=Pinctada fucata OX=5042... [more]
A0A2T7PUN34.714e-1837.14Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7PUS98.752e-1837.14Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3IF361.184e-1729.44uncharacterized protein LOC106163748 OS=Lingula un... [more]
A0A1S3J5E71.019e-1632.26equistatin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
back to top
BLAST of Thyroglobulin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tg3.282e-1032.41thyroglobulin [Source:NCBI gene;Acc:103037495][more]
nid2a7.867e-1037.04nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
nid2b8.075e-832.14nidogen 2b (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Thyroglobulin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tg2.757e-1037.37thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1][more]
back to top
BLAST of Thyroglobulin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403641.725e-1031.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403726.701e-930.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390954.896e-835.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477971.605e-729.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403661.643e-731.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thyroglobulin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nid2a1.269e-633.04nidogen 2 [Source:NCBI gene;Acc:101173773][more]
nid2a1.441e-629.82nidogen 2 [Source:NCBI gene;Acc:101173773][more]
back to top
BLAST of Thyroglobulin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016995.18.292e-58100.00SMESG000016995.1[more]
SMESG000016995.18.868e-58100.00SMESG000016995.1[more]
SMESG000016992.19.967e-5448.78SMESG000016992.1[more]
SMESG000016993.11.780e-5348.78SMESG000016993.1[more]
SMESG000016994.18.095e-5350.30SMESG000016994.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025599 ID=SMED30025599|Name=Thyroglobulin|organism=Schmidtea mediterranea sexual|type=transcript|length=1109bp
GGAAATTTAATATTATGTAAAAAAATTTCAAATTTTGCAATATGATGACA
CCATAATTTATACAATATTCATGTAATATTACATACTAACTCATGTATTA
TTACTAGACGAATTTGCGCAGTGGCAAGATTGTCCAGATGAAACTATTGT
ATTTCGTTTTCTGACTAGTTGTATATCGTCCCTTGGCCTTTGCTTCTCAA
AGATCGTTTCACATATTTACTAAAATAAATCCCAATTTTTTTGAACAAAT
AATATATTCAACACTTACTACGGACTTTTAAAGAACCTGTCAATGAGGTT
ACGATGGCGAAAAAATGAGTAAATAAGTTAATTCGATATGTTCCTTGATG
AGCTTTATCTCTTTCTGTGAAACGGTTTCACTCTCAATCTAAATAATCAA
TAACTAGAAGTGCAAAGTTCGATAAGAAATCTGCAGTTTTTCTAACTTTC
AGTCTTGGTGGCAAATATATAAACCAAATTACTCACAAATATTCACTTGA
TATCATGATAAAGGTTTTCATCGTTATTTCGATCATTTGTTTTGGTTTTA
GTTATAAATTAGAAGAAGGGGTTCCATGCGACGGACAAACTGATCAGTGC
AATTACGGATTGAAATGCACAAAGATATGCGTCGAAGATACGAATGCGTC
CGATTGTTTCAAGAAACATTTGGATGTAAGAAGAAAAATTAAAAAACATT
TCATTGGAATGCCCCTTCCAAAATGTGAACTGGATGGTCAATATGAGCCT
ATGCAATGCCTAGGTTCTGTTTGTTACTGTGCTGATGAAGTAGGGGTTCA
AATTTCCGGTTACGTCACTCCAGTTGAGAAATCCGCTGACAAAAACTGTA
AATGCGCTAGGAAAAAACGCCAAATTGAAAAAACACGAAATGTTGGTGTA
ATAATTCATTGCGATATCCTTGGAAATTATTCCCCGGTTCAGTGCGTCGG
ATCAGTCTGCTTTTGCGTAGACAAAAACGGAGTTCAAATTGCTTCAATTC
CAGCAGTGAACATAGCCAATGTCAGTAAAATAAAATGCTCGAAATAATAA
TTAAATTATGTTTTATTTATGTGAATTGAAATGTTAACTATTTACAATTT
ATGTATGAT
back to top

protein sequence of SMED30025599-orf-1

>SMED30025599-orf-1 ID=SMED30025599-orf-1|Name=SMED30025599-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=181bp
MIKVFIVISIICFGFSYKLEEGVPCDGQTDQCNYGLKCTKICVEDTNASD
CFKKHLDVRRKIKKHFIGMPLPKCELDGQYEPMQCLGSVCYCADEVGVQI
SGYVTPVEKSADKNCKCARKKRQIEKTRNVGVIIHCDILGNYSPVQCVGS
VCFCVDKNGVQIASIPAVNIANVSKIKCSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036857Thyroglobulin_1_sf
IPR000716Thyroglobulin_1
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007160cell-matrix adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000716Thyroglobulin type-1SMARTSM00211TY_2coord: 133..169
e-value: 0.022
score: 19.2
coord: 71..119
e-value: 1.4E-4
score: 31.2
IPR000716Thyroglobulin type-1PFAMPF00086Thyroglobulin_1coord: 120..165
e-value: 7.0E-9
score: 35.2
coord: 62..105
e-value: 1.0E-9
score: 37.9
IPR000716Thyroglobulin type-1PROSITEPS00484THYROGLOBULIN_1_1coord: 70..97
IPR000716Thyroglobulin type-1PROSITEPS51162THYROGLOBULIN_1_2coord: 48..115
score: 8.972
IPR000716Thyroglobulin type-1PROSITEPS51162THYROGLOBULIN_1_2coord: 116..178
score: 7.315
IPR000716Thyroglobulin type-1CDDcd00191TYcoord: 59..102
e-value: 3.14841E-7
score: 43.6065
IPR036857Thyroglobulin type-1 superfamilyGENE3DG3DSA:4.10.800.10coord: 116..175
e-value: 9.3E-11
score: 42.9
coord: 49..115
e-value: 3.6E-10
score: 41.0
IPR036857Thyroglobulin type-1 superfamilySUPERFAMILYSSF57610Thyroglobulin type-1 domaincoord: 34..116
IPR036857Thyroglobulin type-1 superfamilySUPERFAMILYSSF57610Thyroglobulin type-1 domaincoord: 132..169
NoneNo IPR availablePANTHERPTHR12352SECRETED MODULAR CALCIUM-BINDING PROTEINcoord: 44..120
coord: 113..163
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.649