Ca(2 )/calmodulin-responsive adenylate cyclase

Overview
NameCa(2 )/calmodulin-responsive adenylate cyclase
Smed IDSMED30025596
Length (bp)7516
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ca(2 )/calmodulin-responsive adenylate cyclase (SMED30025596) t-SNE clustered cells

Violin plots show distribution of expression levels for Ca(2 )/calmodulin-responsive adenylate cyclase (SMED30025596) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ca(2 )/calmodulin-responsive adenylate cyclase (SMED30025596) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ca(2 )/calmodulin-responsive adenylate cyclase (SMED30025596) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025596

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025596SMESG000023584.1 dd_Smed_v4_4439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025596SMESG000023584.1 dd_Smed_v4_4439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025596SMESG000023584.1 dd_Smed_v4_4439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025596SMESG000023584.1 dd_Smed_v4_4439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025596SMESG000023584.1 dd_Smed_v4_4439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025596SMESG000023584.1 Contig37792newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025596SMESG000023584.1 Contig37792uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30025596SMESG000023584.1 dd_Smed_v4_4439_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Human
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 126.716 bits (317), Expect = 3.201e-28
Identity = 119/477 (24.95%), Postives = 219/477 (45.91%), Query Frame = 3
Query:  621 MAILTIIPLVHINCQQCMRPQHMAFLKFSGF-ILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTI-FXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETIT------------KIYKAYPLLTNLLDGNESGKY------SQKI-NQNSFS 1973
            +A+L +  +  +   Q  +   +A L    F +LCC   +              +    G+W+   L++T   +  +   +LLA+    +  +  ++    +V +K+P    + W  L  N LLF+   + G  +  L ++  R AFL AR    SC+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T   L   Y+V+       P      +S   ++ ++T+++ P H ++        LI+SD   ++  +  T            K++KA    +N++   +  K       S+K+ N++SFS
Sbjct:  103 LALLVVTNVRSLQVPQLQQVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQ--LLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTATLVPAKRP----RLWRTLGANALLFVGVNMYGVFVRILTERSQRKAFLQAR----SCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVE-------PGYGHERNSFLKTHNIETFFIVPSHRRK----IFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFS 553          

HSP 2 Score: 106.301 bits (264), Expect = 4.898e-22
Identity = 80/325 (24.62%), Postives = 155/325 (47.69%), Query Frame = 3
Query: 2868 TLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDG--VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            TLPL +   +    K++++ G           T  ++  E S   R+ G  V  +    IV+ + F+  +   +R ++   RL + W  +   +RE+  K+ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++ME   Y+ I KI+T G T   A+G+ P    ++    S  ++ L   A  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   +I VT   +  +     + F   G + V   G++++
Sbjct:  738 TLPLAIFFRVSSLPKMILLSG---------LTTSYILVLELSGYTRTGGGAVSGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQS-YNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEE-VHRLLRRCPYHFVCRGKVSVKGKGEMLT 1051          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Human
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 113.235 bits (282), Expect = 6.863e-26
Identity = 74/241 (30.71%), Postives = 123/241 (51.04%), Query Frame = 3
Query: 1002 LIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            + G  +  L ++  R AFL AR    SC+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T   L   Y+V+ G
Sbjct:    1 MYGVFVRILTERSQRKAFLQAR----SCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPG 232          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Human
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 113.235 bits (282), Expect = 6.863e-26
Identity = 74/241 (30.71%), Postives = 123/241 (51.04%), Query Frame = 3
Query: 1002 LIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            + G  +  L ++  R AFL AR    SC+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T   L   Y+V+ G
Sbjct:    1 MYGVFVRILTERSQRKAFLQAR----SCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPG 232          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Human
Match: ADCY6 (adenylate cyclase 6 [Source:HGNC Symbol;Acc:HGNC:237])

HSP 1 Score: 112.849 bits (281), Expect = 5.998e-24
Identity = 79/293 (26.96%), Postives = 137/293 (46.76%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATS 1829
            W  L  N LLF+ + +IG    Y  +   R AF   R ++ + +  +  N + +RLL  V+P  +  E+K+ I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++++T   L   Y+V+ G               G+ N     YL+ +HI+   IL  S
Sbjct:  286 WKQLGANVLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLA-----SQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPG-------------RGGERN----AYLKEQHIETFLILGAS 556          

HSP 2 Score: 96.2857 bits (238), Expect = 6.952e-19
Identity = 97/417 (23.26%), Postives = 180/417 (43.17%), Query Frame = 3
Query: 2631 MKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLL-----------------CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVL---------------GTVICTCVIIFGTHELIFTEFSKTYRSDG--------VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSR---LMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            ++ +S  IVRS   S  + I + L +FT  ++N F C ++P  +   +    T           L                 C  P Y   + +   L   V L +    K+ ++                 T+     ++ G H L  +  ++T+  DG        V +KY++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S++  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++        V RS    L    +R  E +K I  EH+  N    F ++IG++M    +GV+G   P + +WG     ++ +   G  D+I VT++ 
Sbjct:  728 LQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASS--NETF--DGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVEST-ARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNAS--TYDQVGRSHITALADYAMRLMEQMKHI-NEHSFNN----FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDL 1132          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Human
Match: ADCY6 (adenylate cyclase 6 [Source:HGNC Symbol;Acc:HGNC:237])

HSP 1 Score: 112.464 bits (280), Expect = 7.148e-24
Identity = 79/293 (26.96%), Postives = 137/293 (46.76%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATS 1829
            W  L  N LLF+ + +IG    Y  +   R AF   R ++ + +  +  N + +RLL  V+P  +  E+K+ I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++++T   L   Y+V+ G               G+ N     YL+ +HI+   IL  S
Sbjct:  286 WKQLGANVLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLA-----SQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPG-------------RGGERN----AYLKEQHIETFLILGAS 556          

HSP 2 Score: 94.3597 bits (233), Expect = 2.306e-18
Identity = 67/249 (26.91%), Postives = 125/249 (50.20%), Query Frame = 3
Query: 3015 VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSR---LMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            V +KY++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S++  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++        V RS    L    +R  E +K I  EH+  N    F ++IG++M    +GV+G   P + +WG     ++ +   G  D+I VT++ 
Sbjct:  839 VALKYMTPVILLVFALALYLHAQQVEST-ARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNAS--TYDQVGRSHITALADYAMRLMEQMKHI-NEHSFNN----FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDL 1079          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Celegans
Match: acy-2 (Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:O16880])

HSP 1 Score: 89.3521 bits (220), Expect = 3.327e-17
Identity = 63/239 (26.36%), Postives = 107/239 (44.77%), Query Frame = 3
Query: 1299 SSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKH---------IKQNSILATSDLIVSDTSDSQHDETITKIYKAYPLLTNLLDGNESGKYSQKINQNSFSQSQTH 1988
            + D V+ +NEL+S+FD   Q L C +++   D Y  ++G P  R +HA  C  +   + +TIKQ+  +  V +++R  VHTG     ++G  +  FD+  DDV +   M     PG V ++KST D L   Y + +    D P++         S    TY++ P           I +NS L+TS  + S  S       + + + A     N      S  +   +  +  ++  T+
Sbjct:  332 AKDLVRTLNELYSKFDRDAQRLQCMRIKFLGDCYYCVSGMPVNRPNHADMCVVMGLEMINTIKQVRIATGVDVNMRIGVHTGSVLCGIMGLRKWQFDIWSDDVTLANHMESAGVPGAVHITKSTKDMLLGDYCI-VDANTDDPHVV--------SYGQPTYHILPDKTSAIERTASIYRNSRLSTSPALQSRMSMKAKVSKMVEFWGAETPFANFTKKKFSASHDPALITDEIARRPTY 561          

HSP 2 Score: 71.2478 bits (173), Expect = 1.149e-11
Identity = 49/206 (23.79%), Postives = 97/206 (47.09%), Query Frame = 3
Query: 3183 MIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVK-EPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGI-----DPDHPIESSVDRSRLMTNLLRG-------------AEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSN 3743
            +I+ +LP  V + +L+P R    L++ +++ + V+  SIP++     + + +     +R+LN+++  FD ++    +  + KI+T G T   A G+     D D       +  +   N+  G             A  + +I+   N  + +N F LRIG+ +    +GV+G   P + +WG     A+ +   G+  KIH T++
Sbjct:  817 LIENILPSSVAAKFLSPDRAVNELYARQHENVCVMFASIPNFKDFWSEWDTNRKLECLRLLNEIVCEFDKLLSKPKFSSVEKIKTVGSTYMAAAGLNESEADYDDIYLEKQNSGKYNNNIRHGNMAFRNANLMIEFALAMSQILDALNRDSFQN-FELRIGMSVGPLVAGVIGAQKPQYDIWGNTVNLASRMDTHGEPRKIHATTD 1021          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Celegans
Match: acy-4 (Adenylate cyclase [Source:UniProtKB/TrEMBL;Acc:Q966F9])

HSP 1 Score: 85.8853 bits (211), Expect = 3.258e-16
Identity = 63/244 (25.82%), Postives = 121/244 (49.59%), Query Frame = 3
Query: 1002 LIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEK----LDRLLSCVVPMPILAELKQSIMLRELHG----HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            ++GS++ Y  + + R  F   R+    CV+++M  +K     +++L  V+P  I  E+K+   ++E H     H   +    ++S +  +ICG +  A  + N      D V ++NELF+RFD +     C ++++  D Y  + G PE + +HA +  E+   +   I+ + +   V +++R  +HTG  +  VLG  +  FD+  +DV +   M      G+V ++ +T   L   Y ++ G
Sbjct:  224 VVGSLVYYPTEFVQRKTFHETRK----CVQSRMLLDKEMHRQEKILLAVLPKNIAFEVKKD--MQETHEERMFHKIYIRKYEDISILFADICGFTNLA-SEYN----PKDLVLMLNELFARFDKVASIHQCMRIKILGDCYYCVCGVPEYQKNHAINTVEMGRDMIEAIRLVREMTLVNVNMRVGIHTGKAHCGVLGLKKWQFDVWSNDVTLANQMESGGLAGRVHITDATRSYLKGAYILEEG 456          

HSP 2 Score: 59.6918 bits (143), Expect = 3.372e-8
Identity = 58/275 (21.09%), Postives = 120/275 (43.64%), Query Frame = 3
Query: 3063 ILVLWKSRILNTFRRLVFQW-------QMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCP--VGVKEPSDVASNIRVLNQLLITFDDVMES----SDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS---VPP 3839
            +LV++ +R      R  F W       Q++M  K E++  ++  +       LP  V  H++  + +   L+        ++  ++  +    +     ++    +R+LN+++  FD +++      +++ I KI+T   T   A G+          D S +    L   E+L ++  E  + +  N F LRIGI++    +GV+G + P + +WG +   A+ +   G   +I VT    + ++P   + F   G + V   G + +   +PP
Sbjct:  744 LLVVFSTRRSELISRYDFIWKLQALDEQLQMKRKHEQNRSVLENI-------LPSHVAKHFVEDATSVSKLYHESRDNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTYMVASGLAG----RECGDNSHVEAIALFARELLVKL--ESTNIHSFNNFNLRIGINVGPVVAGVIGSDKPHYDIWGNSVNVASRMDSGGVAGRIQVTEEVKSILEPLG-YNFECRGQINVKGKGMMETFFLLPP 1004          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Celegans
Match: acy-1 (Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:Q19523])

HSP 1 Score: 78.5666 bits (192), Expect = 6.819e-14
Identity = 53/185 (28.65%), Postives = 87/185 (47.03%), Query Frame = 3
Query: 1176 MLRELHGHLPSVVHL-RNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLP 1727
            M+ E     P  ++L  NVS +  +I G ++ +         + + V L+N+LF RFD L +  G  ++    D Y  +AG PE   DHA    E+   +   I+Q        +++R  +HTG     ++G  R  FD+  +DV +   M      G+V VS++T   L   Y+++ GP  D P
Sbjct:  300 MVPEYRKFRPFTMNLMTNVSILFADIAGFTKMSSNKS-----ADELVNLLNDLFGRFDTLCRLRGLEKISTLGDCYYCVAGCPEPCDDHACRTVEMGLDMIVAIRQFDIDRGQEVNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSGVAGRVHVSEATAKLLKGLYEIEEGPDYDGP 479          

HSP 2 Score: 66.6254 bits (161), Expect = 2.929e-10
Identity = 59/267 (22.10%), Postives = 122/267 (45.69%), Query Frame = 3
Query: 3042 VSQIFFAILVLWK-------SRILNTFRRLVFQWQMKMNL-----KREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPD------HPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYD 3788
            +SQ F + L +W+       S +L  F    F+   +M+       R +  ++ +  D+  D LL   + +H +   +     +S  ++T+GVL  SI +W  +  +        +RVLN+++  FD++++  D+  I KI+T G     A G++P+      HP E        +  ++  A  ++ ++   N       F+ ++G+++    +GV+G     + +WG+    A+ +   G L++I V+ +    +    +F F D
Sbjct:  960 LSQDFGSPLFIWELLLDVILSIVLVAFLNYQFETAFRMSFFGDVQARRDTERMQIVRDQA-DWLLNNVIPAHAVESLKTDTK-YSENHETVGVLFASITNWNDMYEENFEGGREFLRVLNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNMLHPKEH-------LYQMVDFALAVQHVLSVFNEDLLNFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTGVLNRIQVSQHTREYLLDRYEFEFRD 1217          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 66.6254 bits (161), Expect = 2.822e-10
Identity = 41/136 (30.15%), Postives = 66/136 (48.53%), Query Frame = 3
Query: 1311 VKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLC--DSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPE--GYKVDL 1706
            V L+N+L+  FD +      Y+V    D Y+ ++G PE R DHA    +++  + H +K           L +R  +H+G     V+G+    + L GD V     M     P K+ VS+ TYD L +  G+K++L
Sbjct: 1070 VTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDDHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLEL 1205          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 66.2402 bits (160), Expect = 3.257e-10
Identity = 41/136 (30.15%), Postives = 66/136 (48.53%), Query Frame = 3
Query: 1311 VKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLC--DSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPE--GYKVDL 1706
            V L+N+L+  FD +      Y+V    D Y+ ++G PE R DHA    +++  + H +K           L +R  +H+G     V+G+    + L GD V     M     P K+ VS+ TYD L +  G+K++L
Sbjct: 1108 VTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDDHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLEL 1243          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Fly
Match: rut (gene:FBgn0003301 transcript:FBtr0333657)

HSP 1 Score: 157.147 bits (396), Expect = 9.186e-38
Identity = 138/500 (27.60%), Postives = 247/500 (49.40%), Query Frame = 3
Query: 2346 SYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPVGVK-EPSDVASN-IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRS--RLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            S  I+   +   K+  +D    R+   F  S ME ++    +     A+  SL  ++   +L    L +T++LLL+FL  F+W+  +L+L+L +++K+I   I  S    + + I T + I+++   N F C++    +              Q+DSH  C LP Y+  S  +  L + V L LP  FK ++VLG      + I  +H+ IF  +     +  +P+  IS     IF  I +L   R++    RL F WQ++ + +++E   L  +  R++  LLP  V +H+L+   RN M L+   Y  +GV+  S+P++     + + SD     +R+LN+++  FD++++   + GI KI+T G T    +G+ P++ I+ +   S  R MT L+   + ++  +QE NS +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G      VT   +  +   S F F   GT+ V   G +++
Sbjct:  587 SQAINARSVDCDKSEHVD----RLTLRFRQSDMEREYHKDFDLGFTTAMGCSLLLLILGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRMAITIFTVILIYSVGQVNVFTCVSDHPCSGN-------GTTSFQNDSHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNIFECYDNRVNAS-IPLHLISLARIAIFM-IAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHS-YNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSL-VGSHFEFRCRGTIKVKGKGDMVT 1071          

HSP 2 Score: 147.132 bits (370), Expect = 1.249e-34
Identity = 113/438 (25.80%), Postives = 207/438 (47.26%), Query Frame = 3
Query:  417 INPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGN-FKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSK----HWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHG--HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +N   F+N  LE +Y +Y      + +L RF +L G+  LV  +  ++       N         +  +  L  + LV + C   ++  H+  L +   +   +I V   P  G+ F +D++  +  G+W+ ++++       P+  +  +A  I L   H  +++         +F+       +  L  N ++FI   + G V++ + ++  R  FL  R  + S +E +  NEKL+RLL  V+P  +  ++K  I L  + G  H   +    NVS +  +I G +  +         + + V+L+NELF RFD L  +  C ++++  D Y  ++G PE R DHAK   E+   +   I  + ++ +V+L++R  +HTG     VLG  +  FD+  +DV +   M     PG+V V+++T D L   Y+V+ G
Sbjct:   13 LNTLRFENDELECLYQRY------TLKLQRFSVL-GVVALVFVLCGVMAALSLTFNNAATFHNIFNAIVCGLFAVVLVLLQCS-VIKDHHLPTLCYGILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHISLTVYK-------IFTDALRYLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDI-LSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQ-----CSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAG 429          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Fly
Match: rut (gene:FBgn0003301 transcript:FBtr0333656)

HSP 1 Score: 156.762 bits (395), Expect = 1.264e-37
Identity = 138/500 (27.60%), Postives = 247/500 (49.40%), Query Frame = 3
Query: 2346 SYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPVGVK-EPSDVA-SNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRS--RLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            S  I+   +   K+  +D    R+   F  S ME ++    +     A+  SL  ++   +L    L +T++LLL+FL  F+W+  +L+L+L +++K+I   I  S    + + I T + I+++   N F C++    +              Q+DSH  C LP Y+  S  +  L + V L LP  FK ++VLG      + I  +H+ IF  +     +  +P+  IS     IF  I +L   R++    RL F WQ++ + +++E   L  +  R++  LLP  V +H+L+   RN M L+   Y  +GV+  S+P++     + + SD     +R+LN+++  FD++++   + GI KI+T G T    +G+ P++ I+ +   S  R MT L+   + ++  +QE NS +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G      VT   +  +   S F F   GT+ V   G +++
Sbjct:  587 SQAINARSVDCDKSEHVD----RLTLRFRQSDMEREYHKDFDLGFTTAMGCSLLLLILGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRMAITIFTVILIYSVGQVNVFTCVSDHPCSGN-------GTTSFQNDSHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNIFECYDNRVNAS-IPLHLISLARIAIFM-IAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHS-YNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSL-VGSHFEFRCRGTIKVKGKGDMVT 1071          

HSP 2 Score: 146.747 bits (369), Expect = 1.440e-34
Identity = 112/434 (25.81%), Postives = 203/434 (46.77%), Query Frame = 3
Query:  417 INPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGN-FKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHG--HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +N   F+N  LE +Y +Y      + +L RF +L G+  LV  +  ++       N         +  +  L  + LV + C   ++  H+  L +   +   +I V   P  G+ F +D++  +  G+W+ ++++       P+  +  +A   F     S+   L +            +  L  N ++FI   + G V++ + ++  R  FL  R  + S +E +  NEKL+RLL  V+P  +  ++K  I L  + G  H   +    NVS +  +I G +  +         + + V+L+NELF RFD L  +  C ++++  D Y  ++G PE R DHAK   E+   +   I  + ++ +V+L++R  +HTG     VLG  +  FD+  +DV +   M     PG+V V+++T D L   Y+V+ G
Sbjct:   13 LNTLRFENDELECLYQRY------TLKLQRFSVL-GVVALVFVLCGVMAALSLTFNNAATFHNIFNAIVCGLFAVVLVLLQCS-VIKDHHLPTLCYGILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVA---FGIALPSVHISLTVYKIFTDALRYLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDI-LSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQ-----CSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAG 429          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Fly
Match: rut (gene:FBgn0003301 transcript:FBtr0305581)

HSP 1 Score: 157.147 bits (396), Expect = 1.409e-37
Identity = 138/500 (27.60%), Postives = 247/500 (49.40%), Query Frame = 3
Query: 2346 SYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPVGVK-EPSDVASN-IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRS--RLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            S  I+   +   K+  +D    R+   F  S ME ++    +     A+  SL  ++   +L    L +T++LLL+FL  F+W+  +L+L+L +++K+I   I  S    + + I T + I+++   N F C++    +              Q+DSH  C LP Y+  S  +  L + V L LP  FK ++VLG      + I  +H+ IF  +     +  +P+  IS     IF  I +L   R++    RL F WQ++ + +++E   L  +  R++  LLP  V +H+L+   RN M L+   Y  +GV+  S+P++     + + SD     +R+LN+++  FD++++   + GI KI+T G T    +G+ P++ I+ +   S  R MT L+   + ++  +QE NS +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G      VT   +  +   S F F   GT+ V   G +++
Sbjct:  587 SQAINARSVDCDKSEHVD----RLTLRFRQSDMEREYHKDFDLGFTTAMGCSLLLLILGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRMAITIFTVILIYSVGQVNVFTCVSDHPCSGN-------GTTSFQNDSHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNIFECYDNRVNA-SIPLHLISLARIAIFM-IAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHS-YNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSL-VGSHFEFRCRGTIKVKGKGDMVT 1071          

HSP 2 Score: 147.902 bits (372), Expect = 9.134e-35
Identity = 115/441 (26.08%), Postives = 213/441 (48.30%), Query Frame = 3
Query:  417 INPFAFKNINLERIYAKYFSLVYRSTQLARFFLL--IGLFCLVIGIIEMIP-TFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGN-FKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSK----HWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHG--HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +N   F+N  LE +Y +Y      + +L RF +L  + L  ++ G++  +  TF    N  T    + +I   +  ++ LV + C   ++  H+  L +   +   +I V   P  G+ F +D++  +  G+W+ ++++       P+  +  +A  I L   H  +++         +F+       +  L  N ++FI   + G V++ + ++  R  FL  R  + S +E +  NEKL+RLL  V+P  +  ++K  I L  + G  H   +    NVS +  +I G +  +         + + V+L+NELF RFD L  +  C ++++  D Y  ++G PE R DHAK   E+   +   I  + ++ +V+L++R  +HTG     VLG  +  FD+  +DV +   M     PG+V V+++T D L   Y+V+ G
Sbjct:   13 LNTLRFENDELECLYQRY------TLKLQRFSVLGVVALVFVLCGVMAALSLTF---NNAATFHNIFNAIVCGLFAVV-LVLLQCS-VIKDHHLPTLCYGILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHISLTVYK-------IFTDALRYLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDI-LSPVAGQFHRIYIQKHENVSILFADIVGFTVLS-----SQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAG 429          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Fly
Match: rut (gene:FBgn0003301 transcript:FBtr0073992)

HSP 1 Score: 157.147 bits (396), Expect = 1.498e-37
Identity = 138/500 (27.60%), Postives = 247/500 (49.40%), Query Frame = 3
Query: 2346 SYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPVGVK-EPSDVASN-IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRS--RLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            S  I+   +   K+  +D    R+   F  S ME ++    +     A+  SL  ++   +L    L +T++LLL+FL  F+W+  +L+L+L +++K+I   I  S    + + I T + I+++   N F C++    +              Q+DSH  C LP Y+  S  +  L + V L LP  FK ++VLG      + I  +H+ IF  +     +  +P+  IS     IF  I +L   R++    RL F WQ++ + +++E   L  +  R++  LLP  V +H+L+   RN M L+   Y  +GV+  S+P++     + + SD     +R+LN+++  FD++++   + GI KI+T G T    +G+ P++ I+ +   S  R MT L+   + ++  +QE NS +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G      VT   +  +   S F F   GT+ V   G +++
Sbjct:  664 SQAINARSVDCDKSEHVD----RLTLRFRQSDMEREYHKDFDLGFTTAMGCSLLLLILGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRMAITIFTVILIYSVGQVNVFTCVSDHPCSGN-------GTTSFQNDSHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNIFECYDNRVNA-SIPLHLISLARIAIFM-IAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHS-YNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSL-VGSHFEFRCRGTIKVKGKGDMVT 1148          

HSP 2 Score: 147.902 bits (372), Expect = 9.122e-35
Identity = 115/441 (26.08%), Postives = 213/441 (48.30%), Query Frame = 3
Query:  417 INPFAFKNINLERIYAKYFSLVYRSTQLARFFLL--IGLFCLVIGIIEMIP-TFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGN-FKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSK----HWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHG--HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +N   F+N  LE +Y +Y      + +L RF +L  + L  ++ G++  +  TF    N  T    + +I   +  ++ LV + C   ++  H+  L +   +   +I V   P  G+ F +D++  +  G+W+ ++++       P+  +  +A  I L   H  +++         +F+       +  L  N ++FI   + G V++ + ++  R  FL  R  + S +E +  NEKL+RLL  V+P  +  ++K  I L  + G  H   +    NVS +  +I G +  +         + + V+L+NELF RFD L  +  C ++++  D Y  ++G PE R DHAK   E+   +   I  + ++ +V+L++R  +HTG     VLG  +  FD+  +DV +   M     PG+V V+++T D L   Y+V+ G
Sbjct:   13 LNTLRFENDELECLYQRY------TLKLQRFSVLGVVALVFVLCGVMAALSLTF---NNAATFHNIFNAIVCGLFAVV-LVLLQCS-VIKDHHLPTLCYGILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHISLTVYK-------IFTDALRYLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDI-LSPVAGQFHRIYIQKHENVSILFADIVGFTVLS-----SQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAG 429          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Fly
Match: rut (gene:FBgn0003301 transcript:FBtr0333655)

HSP 1 Score: 156.762 bits (395), Expect = 1.773e-37
Identity = 138/500 (27.60%), Postives = 247/500 (49.40%), Query Frame = 3
Query: 2346 SYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPVGVK-EPSDVASN-IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRS--RLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            S  I+   +   K+  +D    R+   F  S ME ++    +     A+  SL  ++   +L    L +T++LLL+FL  F+W+  +L+L+L +++K+I   I  S    + + I T + I+++   N F C++    +              Q+DSH  C LP Y+  S  +  L + V L LP  FK ++VLG      + I  +H+ IF  +     +  +P+  IS     IF  I +L   R++    RL F WQ++ + +++E   L  +  R++  LLP  V +H+L+   RN M L+   Y  +GV+  S+P++     + + SD     +R+LN+++  FD++++   + GI KI+T G T    +G+ P++ I+ +   S  R MT L+   + ++  +QE NS +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G      VT   +  +   S F F   GT+ V   G +++
Sbjct:  587 SQAINARSVDCDKSEHVD----RLTLRFRQSDMEREYHKDFDLGFTTAMGCSLLLLILGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRMAITIFTVILIYSVGQVNVFTCVSDHPCSGN-------GTTSFQNDSHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNIFECYDNRVNA-SIPLHLISLARIAIFM-IAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHS-YNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSL-VGSHFEFRCRGTIKVKGKGDMVT 1071          

HSP 2 Score: 147.517 bits (371), Expect = 1.176e-34
Identity = 115/441 (26.08%), Postives = 213/441 (48.30%), Query Frame = 3
Query:  417 INPFAFKNINLERIYAKYFSLVYRSTQLARFFLL--IGLFCLVIGIIEMIP-TFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGN-FKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSK----HWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHG--HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +N   F+N  LE +Y +Y      + +L RF +L  + L  ++ G++  +  TF    N  T    + +I   +  ++ LV + C   ++  H+  L +   +   +I V   P  G+ F +D++  +  G+W+ ++++       P+  +  +A  I L   H  +++         +F+       +  L  N ++FI   + G V++ + ++  R  FL  R  + S +E +  NEKL+RLL  V+P  +  ++K  I L  + G  H   +    NVS +  +I G +  +         + + V+L+NELF RFD L  +  C ++++  D Y  ++G PE R DHAK   E+   +   I  + ++ +V+L++R  +HTG     VLG  +  FD+  +DV +   M     PG+V V+++T D L   Y+V+ G
Sbjct:   13 LNTLRFENDELECLYQRY------TLKLQRFSVLGVVALVFVLCGVMAALSLTF---NNAATFHNIFNAIVCGLFAVV-LVLLQCS-VIKDHHLPTLCYGILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHISLTVYK-------IFTDALRYLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDI-LSPVAGQFHRIYIQKHENVSILFADIVGFTVLS-----SQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAG 429          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Zebrafish
Match: adcy1a (adenylate cyclase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-302])

HSP 1 Score: 123.25 bits (308), Expect = 2.105e-27
Identity = 103/376 (27.39%), Postives = 177/376 (47.07%), Query Frame = 3
Query:  597 VRCWISISMAILTIIPLVHINCQQCMRPQHMAFL-KFSGFILCCAILVSVS-PIWGNFKIDSESFI-TVGLWETIWLIITISCFYPVTFYTLLALTI-FXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            V C I  S+ I+T +  + +   Q  +   +A L  F+  +LCC   +++     G    D+ S     G+W+ + +        PV   TLLA+    L  +   I     V +++P    + W  L  N +L +   L G  +    ++  R AFL AR  +   ++ +  NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T + L   Y+V+ G
Sbjct:   88 VHCVIFTSLFIVTNVKYLQVT--QLQQIARLALLFSFTFALLCCPFPLALGHGTQGTHGPDAPSTTPEQGVWQLMLVTFVAYSLLPVR--TLLAVLFGVLVAASHFIVTATSVTARRP----RVWTPLVANAVLLVGVNLSGVFVRVRTERAQRKAFLQARNCIQQRLQLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMMEAGGLPGKVHITKATLECLNGDYEVEPG 450          

HSP 2 Score: 98.5969 bits (244), Expect = 8.553e-20
Identity = 69/271 (25.46%), Postives = 132/271 (48.71%), Query Frame = 3
Query: 3039 IVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDV---GTLIVNHAGQLIS 3830
            +++ + F+  ++   R L+   RL + W  +   +R++  ++ +   R++  LLP  V  H+L  +   M+L+   Y  +GVL  SIP++    ++   +      +R+LN+++  FD +M+   Y  I KI+T G T   A+G+    P E S  +  +  +L   A+    +    ++ N +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI VT +    +      G+YD    G + V   GQ+++
Sbjct:  781 VLAMLLFSGALVLHCRQLDLKLRLDYLWATQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLLSNPRNMDLYYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDALMDKECYRDIEKIKTIGSTYMAAVGLV---PTEGSKVKKSISAHLCTVADYAIEMFDVLDAINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVFRLLS-----GYYDFNCRGQVSVKGKGQMLT 1043          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Zebrafish
Match: adcy6a (adenylate cyclase 6a [Source:ZFIN;Acc:ZDB-GENE-060221-1])

HSP 1 Score: 123.25 bits (308), Expect = 2.200e-27
Identity = 108/431 (25.06%), Postives = 203/431 (47.10%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPN--YGTNVRCWISISMAILTIIPLVHINCQQCMRPQ-HMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF   +R  Q +   +L+G+  +V G++        PP+  Y +     +S++MA+   + +V      C R   H  ++    + L   +L+ V  ++G   +   S  + G+W +++ I  I    PV    + A  +   +  +I  +    +++   F    W  LS N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:  119 FQSRKLERLYQRYF---FRLNQ-SSLTMLMGVLVIVCGVMLTFHCIHGPPDVVYAS----VLSVAMALFLALMVV------CNRNGFHQDYMWMVSY-LVIGVLIIVQ-VFGVLMVAPRS-ASEGIWWSVFFIYIIYTLLPVR---MRAAVLSGGVLSAIHLLTTWRINQDDEFL---WKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLQYLNGDYEVEPG 521          

HSP 2 Score: 103.99 bits (258), Expect = 2.004e-21
Identity = 101/427 (23.65%), Postives = 188/427 (44.03%), Query Frame = 3
Query: 2631 MKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLL-----------------CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTC-------VIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGI-DPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            M+ +S  IV+S   S ++ + T + +F     N F C     ++   KQ   +         H +                 CP P Y  YS +   L   V L +    K+ ++L   +          V +F   +L  T  + T+R   V +K ++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S   V ++  ++    +R+LN+++  FD+++    Y  + KI+T G T   A G+ D  +  E     + L    +   E +K I  EH+  N    F ++IG+++    +GV+G   P + +WG     A+ +   G  D+I VT++ + ++  S  +     G + V   G++ +
Sbjct:  717 MQTVSKKIVQSRTNSTLVGVFTIILVFISAFVNMFSCDTQKLVDCVAKQLNWSSEMVTPCIIHNMSRSVADGLSICPNNTPSCPFPEYFSYSVLLTLLACSVFLQISSIGKLALMLLIQLTFLLLVEWPEVALFDNADLFVTANALTFRVTKVSLKVMTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDSTYDKEGRSHITALADYAMHLREQMKYI-NEHSFNN----FQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTD-LHQVLHSKGYQLECRGVIKVKGKGEMTT 1136          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Zebrafish
Match: adcy6a (adenylate cyclase 6a [Source:ZFIN;Acc:ZDB-GENE-060221-1])

HSP 1 Score: 123.25 bits (308), Expect = 2.200e-27
Identity = 108/431 (25.06%), Postives = 203/431 (47.10%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPN--YGTNVRCWISISMAILTIIPLVHINCQQCMRPQ-HMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF   +R  Q +   +L+G+  +V G++        PP+  Y +     +S++MA+   + +V      C R   H  ++    + L   +L+ V  ++G   +   S  + G+W +++ I  I    PV    + A  +   +  +I  +    +++   F    W  LS N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:  119 FQSRKLERLYQRYF---FRLNQ-SSLTMLMGVLVIVCGVMLTFHCIHGPPDVVYAS----VLSVAMALFLALMVV------CNRNGFHQDYMWMVSY-LVIGVLIIVQ-VFGVLMVAPRS-ASEGIWWSVFFIYIIYTLLPVR---MRAAVLSGGVLSAIHLLTTWRINQDDEFL---WKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLQYLNGDYEVEPG 521          

HSP 2 Score: 103.99 bits (258), Expect = 2.004e-21
Identity = 101/427 (23.65%), Postives = 188/427 (44.03%), Query Frame = 3
Query: 2631 MKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLL-----------------CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTC-------VIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGI-DPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            M+ +S  IV+S   S ++ + T + +F     N F C     ++   KQ   +         H +                 CP P Y  YS +   L   V L +    K+ ++L   +          V +F   +L  T  + T+R   V +K ++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S   V ++  ++    +R+LN+++  FD+++    Y  + KI+T G T   A G+ D  +  E     + L    +   E +K I  EH+  N    F ++IG+++    +GV+G   P + +WG     A+ +   G  D+I VT++ + ++  S  +     G + V   G++ +
Sbjct:  717 MQTVSKKIVQSRTNSTLVGVFTIILVFISAFVNMFSCDTQKLVDCVAKQLNWSSEMVTPCIIHNMSRSVADGLSICPNNTPSCPFPEYFSYSVLLTLLACSVFLQISSIGKLALMLLIQLTFLLLVEWPEVALFDNADLFVTANALTFRVTKVSLKVMTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDSTYDKEGRSHITALADYAMHLREQMKYI-NEHSFNN----FQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTD-LHQVLHSKGYQLECRGVIKVKGKGEMTT 1136          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Zebrafish
Match: adcy6a (adenylate cyclase 6a [Source:ZFIN;Acc:ZDB-GENE-060221-1])

HSP 1 Score: 123.25 bits (308), Expect = 2.397e-27
Identity = 105/431 (24.36%), Postives = 203/431 (47.10%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPN--YGTNVRCWISISMAILTIIPLVHINCQQCMRPQ-HMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF   +R  Q +   +L+G+  +V G++        PP+  Y +     +S++MA+   + +V      C R   H  ++    +++   +++    ++G   +   S  + G+W +++ I  I    PV    + A  +   +  +I  +    +++   F    W  LS N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:  158 FQSRKLERLYQRYF---FRLNQ-SSLTMLMGVLVIVCGVMLTFHCIHGPPDVVYASV----LSVAMALFLALMVV------CNRNGFHQDYMWMVSYLVIGVLIIV--QVFGVLMVAPRS-ASEGIWWSVFFIYIIYTLLPVR---MRAAVLSGGVLSAIHLLTTWRINQDDEFL---WKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLQYLNGDYEVEPG 560          

HSP 2 Score: 93.2041 bits (230), Expect = 4.110e-18
Identity = 102/445 (22.92%), Postives = 190/445 (42.70%), Query Frame = 3
Query: 2631 MKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLL-----------------CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTC-------VIIFGTHEL-------IFTEFSK-----------TYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGI-DPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            M+ +S  IV+S   S ++ + T + +F     N F C     ++   KQ   +         H +                 CP P Y  YS +   L   V L +    K+ ++L   +          V +F   +L       +F E  +           T+R   V +K ++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S   V ++  ++    +R+LN+++  FD+++    Y  + KI+T G T   A G+ D  +  E     + L    +   E +K I  EH+  N    F ++IG+++    +GV+G   P + +WG     A+ +   G  D+I VT++ + ++  S  +     G + V   G++ +
Sbjct:  756 MQTVSKKIVQSRTNSTLVGVFTIILVFISAFVNMFSCDTQKLVDCVAKQLNWSSEMVTPCIIHNMSRSVADGLSICPNNTPSCPFPEYFSYSVLLTLLACSVFLQISSIGKLALMLLIQLTFLLLVEWPEVALFDNADLFVTANALVFNETLQWSNFNTTTEQCTFRVTKVSLKVMTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDSTYDKEGRSHITALADYAMHLREQMKYI-NEHSFNN----FQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTD-LHQVLHSKGYQLECRGVIKVKGKGEMTT 1193          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Zebrafish
Match: adcy5 (adenylate cyclase 5 [Source:ZFIN;Acc:ZDB-GENE-081104-470])

HSP 1 Score: 122.094 bits (305), Expect = 6.035e-27
Identity = 111/435 (25.52%), Postives = 201/435 (46.21%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVI-------GIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRE--LHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF  + +S+ L     ++ L C V+       G+ ++  TF+            +  + AI+ I+ L+ +  +      HM  + +   +L  A+ V V  ++   +  SE     G+W T++ I  I    PV    + A  I   +  +I  ++   L+   VF    W  L  N L+F  S ++G    Y  +   R AF   RE + + + ++  N++ +RLL  V+P  +  E+K  I  ++  +  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T + L   Y V+ G
Sbjct:  151 FQSEKLERLYQRYFFRLNQSS-LTMLMAVLVLVCAVMLGFHCAGGMCQL--TFV------------LVFTAAIVLILTLMVVCNRNSFHQDHMWIVCYLLILLVLAVQV-VGVLFVKPRSASE-----GIWWTVFFIHVIYTLLPVR---MRAAVITGIILSAIHVLISWRLNDMDVFL---WKQLVSNVLIFSCSNIVGVCTHYPAEGSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVALEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNGDYDVEPG 553          

HSP 2 Score: 90.1225 bits (222), Expect = 3.286e-17
Identity = 69/275 (25.09%), Postives = 139/275 (50.55%), Query Frame = 3
Query: 3015 VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNL-LRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            VP+K ++ +V  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++     ++     R + +  +R  + +K I  EH+  N    F ++IG++M    +GV+G   P + +WG     A+ +   G  ++I VT++ + ++  S  +     G + V   G++++
Sbjct:  870 VPLKIVTPVVITVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDQFRQLEKIKTIGSTYMAASGLNDSTYDKAGRSHIRALADYAMRLMDQMKYI-NEHSFNN----FKMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPERIQVTTD-LYQVLSSYNYTLEYRGVVKVKGKGEMMT 1137          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 131.724 bits (330), Expect = 7.999e-30
Identity = 128/492 (26.02%), Postives = 225/492 (45.73%), Query Frame = 3
Query:  597 VRCWISISMAILTIIPLVHI-NCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTI-FXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETIT------------KIYKAYPLLTNLLDGNESGKY------SQKI-NQNSFSQSQTHKS 1994
            V C I +S+ I+T +  + +   QQ ++   +    FS   LCC   +      G + ++       GLW+ + +        PV   TLLA+   F+     II     +  KK     + W  L  N +LF+   L G  +  L ++  R AFL AR    +C+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T + L   Y+V+       P      +S    + ++T+++ P H ++        LI+SD   ++  +  T            K++KA    +N++   +  K       S+K+ N++SFS +  H +
Sbjct:   86 VHCIIFLSLFIVTNVKYLQVTQLQQIVKLTLLFGFTFS--FLCCPFSL------GAYGLEPPVSSEQGLWQLMLVTFVAYALLPVR--TLLAIVFGFMVSVSHIIVTATSISPKK----KRLWRTLVVNAILFVSVNLSGVFVRILTERAQRKAFLQAR----NCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVE-------PGYGHERNSFLKKHNIETFFIVPSHRRK----IFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVIHNT 543          

HSP 2 Score: 108.997 bits (271), Expect = 7.021e-23
Identity = 84/337 (24.93%), Postives = 162/337 (48.07%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            C    Y   S +  TL L + L +    K+V++L   I   VI      L  + + KT   D   ++    I++ + F+  +   SR ++   RL + W ++   +R++  ++ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++ME   Y+ I KI+T G T   A+G+ P    ++       ++ L   +  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI VT + +  I  S  + F   G + V   G++++
Sbjct:  700 CDTAHYTFLSCVVGTLSLAIFLRISSFPKMVLLLFVTILYIVI------LEISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQS-YNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTED-VHRILKSCNYEFVCRGKVSVKGKGEMLT 1028          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 131.724 bits (330), Expect = 8.947e-30
Identity = 128/492 (26.02%), Postives = 225/492 (45.73%), Query Frame = 3
Query:  597 VRCWISISMAILTIIPLVHI-NCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTI-FXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETIT------------KIYKAYPLLTNLLDGNESGKY------SQKI-NQNSFSQSQTHKS 1994
            V C I +S+ I+T +  + +   QQ ++   +    FS   LCC   +      G + ++       GLW+ + +        PV   TLLA+   F+     II     +  KK     + W  L  N +LF+   L G  +  L ++  R AFL AR    +C+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T + L   Y+V+       P      +S    + ++T+++ P H ++        LI+SD   ++  +  T            K++KA    +N++   +  K       S+K+ N++SFS +  H +
Sbjct:   89 VHCIIFLSLFIVTNVKYLQVTQLQQIVKLTLLFGFTFS--FLCCPFSL------GAYGLEPPVSSEQGLWQLMLVTFVAYALLPVR--TLLAIVFGFMVSVSHIIVTATSISPKK----KRLWRTLVVNAILFVSVNLSGVFVRILTERAQRKAFLQAR----NCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVE-------PGYGHERNSFLKKHNIETFFIVPSHRRK----IFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVIHNT 546          

HSP 2 Score: 108.997 bits (271), Expect = 6.834e-23
Identity = 84/337 (24.93%), Postives = 162/337 (48.07%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            C    Y   S +  TL L + L +    K+V++L   I   VI      L  + + KT   D   ++    I++ + F+  +   SR ++   RL + W ++   +R++  ++ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++ME   Y+ I KI+T G T   A+G+ P    ++       ++ L   +  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI VT + +  I  S  + F   G + V   G++++
Sbjct:  710 CDTAHYTFLSCVVGTLSLAIFLRISSFPKMVLLLFVTILYIVI------LEISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQS-YNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTED-VHRILKSCNYEFVCRGKVSVKGKGEMLT 1038          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 127.872 bits (320), Expect = 1.202e-28
Identity = 114/425 (26.82%), Postives = 198/425 (46.59%), Query Frame = 3
Query:  795 GLWETIWLIITISCFYPVTFYTLLALTI-FXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETIT------------KIYKAYPLLTNLLDGNESGKY------SQKI-NQNSFSQSQTHKS 1994
            GLW+ + +        PV   TLLA+   F+     II     +  KK     + W  L  N +LF+   L G  +  L ++  R AFL AR    +C+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T + L   Y+V+       P      +S    + ++T+++ P H ++        LI+SD   ++  +  T            K++KA    +N++   +  K       S+K+ N++SFS +  H +
Sbjct:   11 GLWQLMLVTFVAYALLPVR--TLLAIVFGFMVSVSHIIVTATSISPKK----KRLWRTLVVNAILFVSVNLSGVFVRILTERAQRKAFLQAR----NCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVE-------PGYGHERNSFLKKHNIETFFIVPSHRRK----IFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVIHNT 409          

HSP 2 Score: 108.612 bits (270), Expect = 8.082e-23
Identity = 84/337 (24.93%), Postives = 162/337 (48.07%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            C    Y   S +  TL L + L +    K+V++L   I   VI      L  + + KT   D   ++    I++ + F+  +   SR ++   RL + W ++   +R++  ++ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++ME   Y+ I KI+T G T   A+G+ P    ++       ++ L   +  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI VT + +  I  S  + F   G + V   G++++
Sbjct:  573 CDTAHYTFLSCVVGTLSLAIFLRISSFPKMVLLLFVTILYIVI------LEISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQS-YNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTED-VHRILKSCNYEFVCRGKVSVKGKGEMLT 901          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Xenopus
Match: ADCY6 (adenylate cyclase 6 [Source:NCBI gene;Acc:100493933])

HSP 1 Score: 117.857 bits (294), Expect = 9.081e-26
Identity = 105/429 (24.48%), Postives = 201/429 (46.85%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISI-SMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF  + +S+ L      + L CLV+         ++   +G     ++S+ ++A+   + L+ +  +      +M  + +    L  A+L +V  + G   +   S  + G+W +++ I  I    PV    + A  +   +  S+  I+   L+   +F    W  LS N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K+ I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++ +T   L   Y+V+ G
Sbjct:   34 FQSAKLERLYQRYFFQMNQSS-LTMLMGALVLVCLVM--------LIFHCTHGEPQVVYVSVLAVAMALFLSLMVVCNRNGFHQDYMWIVSY----LVIAVLFAVQ-VLGVLMVTPRS-ASEGIWWSVFFIYIIYTLLPVR---MRAAVLSGLILSSLHLIISWRLNLTDIFL---WKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITSATLKYLNGDYEVEPG 436          

HSP 2 Score: 75.8702 bits (185), Expect = 8.739e-13
Identity = 53/205 (25.85%), Postives = 100/205 (48.78%), Query Frame = 3
Query: 3141 KREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGI-DPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            ++EE  +L     R++  +LPK V +H+L        L+  SCE   +   S+   S   V ++  ++    +R+LN+++  FD+++    ++ + KI+T G T   A G+ D  +  E     + L    ++  E +K I  EH+  N    F ++IG+++    +GV+G   P + +WG     A+ +   G  D I VT++ 
Sbjct:  495 EKEEMEQLQAYNRRLLHNILPKDVAAHFLAREHRNDELYYQSCECVAVMFASICNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKFKQLEKIKTIGSTYMAASGLNDTTYDKEGKTHITALADYAMKLREQMKYI-NEHSFNN----FQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGLPDCIQVTTDL 694          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Xenopus
Match: ADCY6 (adenylate cyclase 6 [Source:NCBI gene;Acc:100493933])

HSP 1 Score: 117.087 bits (292), Expect = 2.621e-25
Identity = 105/429 (24.48%), Postives = 201/429 (46.85%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISI-SMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF  + +S+ L      + L CLV+         ++   +G     ++S+ ++A+   + L+ +  +      +M  + +    L  A+L +V  + G   +   S  + G+W +++ I  I    PV    + A  +   +  S+  I+   L+   +F    W  LS N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K+ I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++ +T   L   Y+V+ G
Sbjct:  128 FQSAKLERLYQRYFFQMNQSS-LTMLMGALVLVCLVM--------LIFHCTHGEPQVVYVSVLAVAMALFLSLMVVCNRNGFHQDYMWIVSY----LVIAVLFAVQ-VLGVLMVTPRS-ASEGIWWSVFFIYIIYTLLPVR---MRAAVLSGLILSSLHLIISWRLNLTDIFL---WKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITSATLKYLNGDYEVEPG 530          

HSP 2 Score: 108.227 bits (269), Expect = 1.495e-22
Identity = 97/409 (23.72%), Postives = 179/409 (43.77%), Query Frame = 3
Query: 2631 MKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCC-------INSPQLNATYKXXXXXXXXXXXSDSHL----------LCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPI-----------------KYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGI-DPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            ++ +S  IV+S   S ++ I+T L +FT    N F C           +LN +YK       +       +          LC  P Y  YS +   L   V L +    K+ ++L   I   VI+ G   ++F  +      + +PI                 K+++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L        L+  SCE   +   S+   S   V ++  ++    +R+LN+++  FD+++    ++ + KI+T G T   A G+ D  +  E     + L    ++  E +K I  EH+  N    F ++IG+++    +GV+G   P + +WG     A+ +   G  D I VT++ 
Sbjct:  725 LQGVSRKIVQSRTNSTLIGILTILLVFTSAFVNMFACNHRSLTDCAGQELNISYKFVNVCHLRMLNYSLSMDSPPCDSDKPLCNFPEYFNYSILLSLLACSVFLQISSIGKLALMLFIQILYIVIVEGPEVVLFDNYDLLVTVNALPINGTGDIEECLPSSKIALKFVTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATGEKEEMEQLQAYNRRLLHNILPKDVAAHFLAREHRNDELYYQSCECVAVMFASICNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKFKQLEKIKTIGSTYMAASGLNDTTYDKEGKTHITALADYAMKLREQMKYI-NEHSFNN----FQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGLPDCIQVTTDL 1127          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Mouse
Match: Adcy1 (adenylate cyclase 1 [Source:MGI Symbol;Acc:MGI:99677])

HSP 1 Score: 122.865 bits (307), Expect = 3.368e-27
Identity = 80/263 (30.42%), Postives = 131/263 (49.81%), Query Frame = 3
Query:  936 PVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            P    + W  L  N LLF    + G  +  L ++  R AFL AR    +C+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T   L   Y+V+ G
Sbjct:  203 PAKRPRLWRTLGANALLFFGVNMYGVFVRILTERSQRKAFLQAR----NCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPG 456          

HSP 2 Score: 98.5969 bits (244), Expect = 8.944e-20
Identity = 75/325 (23.08%), Postives = 153/325 (47.08%), Query Frame = 3
Query: 2868 TLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPI--KYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            TLPL + L +    K++++ G           T  ++  E S   +  G  +  +    I++ + F+  +   +R ++   RL + W  +   +R++  ++ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++M+   Y+ + KI+T G T   A+G+ P     +    S  +  L   A  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   +I VT      +   S + F   G + V   G++++
Sbjct:  737 TLPLAIFLRVSSLPKMILLSGLT---------TSYILVLELSGYTKVGGGALSGRSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLCTLADFAIDMFDVLDEINYQS-YNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLKRCS-YQFVCRGKVSVKGKGEMLT 1050          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Mouse
Match: Adcy5 (adenylate cyclase 5 [Source:MGI Symbol;Acc:MGI:99673])

HSP 1 Score: 111.309 bits (277), Expect = 1.139e-23
Identity = 80/307 (26.06%), Postives = 147/307 (47.88%), Query Frame = 3
Query:  795 GLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRE--LHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            G+W T++ I TI    PV    + A  +   +  ++   + +  + +  F  K    L  N L+F  + ++G    Y  +   R AF   RE + + + ++  N++ +RLL  V+P  +  E+K  I  ++  +  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T + L   Y+V+ G
Sbjct:  329 GIWWTVFFIYTIYTLLPVR---MRAAVLSGVLLSALHLAISLHTNSQDQFLLKQ---LVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNGDYEVEPG 624          

HSP 2 Score: 95.9005 bits (237), Expect = 5.988e-19
Identity = 83/356 (23.31%), Postives = 170/356 (47.75%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGT-------VICTCVIIFGTHELIFTEFSKTYRSDG----------VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            C  P Y  YS +   L   V L +    K+V++L         V    V +F   +L+ T  +  + ++G          V +K ++ I+  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S++  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++     +S+ D++   T++   A+   +++ +    N    N F ++IG+++    +GV+G   P + +WG     A+ +   G  D+I VT++ M ++  ++ +     G + V   G++++
Sbjct:  905 CNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIEFIYVLIVEVPGVTLFDNADLLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLN-----DSTYDKAG-KTHIKAIADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTD-MYQVLAANTYQLECRGVVKVKGKGEMMT 1252          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Mouse
Match: Adcy6 (adenylate cyclase 6 [Source:MGI Symbol;Acc:MGI:87917])

HSP 1 Score: 110.153 bits (274), Expect = 2.623e-23
Identity = 69/253 (27.27%), Postives = 123/253 (48.62%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            W  L  N +LF+ +  IG    Y  +   R AF   R ++ + +  +  N + +RLL  V+P  +  E+K+ I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++++T   L   Y+V+ G
Sbjct:  284 WKQLGANVVLFLCTNAIGVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPG 531          

HSP 2 Score: 97.8265 bits (242), Expect = 1.524e-19
Identity = 100/417 (23.98%), Postives = 184/417 (44.12%), Query Frame = 3
Query: 2631 MKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLL-----------------CPLPVY--------IPYSTIWVTLPLIVMLA----LPETFKVVIVLG---TVICTCVIIFGTHELIFTEFSKTYRSDG--------VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSR---LMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            ++ +S +IVRS + S  + I + L +F   ++N F C ++P      +    T           L                 C  P Y        +  S++++ +  I  LA    L  T+ V+++LG    +     ++ G H L     S     DG        V +KY++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S++  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++        V RS    L    +R  E +K I  EH+  N    F ++IG++M    +GV+G   P + +WG     ++ +   G  D+I VT++ 
Sbjct:  726 LQRLSRNIVRSRVHSTAVGIFSVLLVFISAIANMFTCNHTPIRTCAARMLNLTPADVTACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNVLLSLLASSVFLHISSIGKLAMTFILGFTYLVLLLLGPPAAIFDNYDLLLGVHGLA----SSNETFDGLDCPAVGRVALKYMTPVILLVFALALYLHAQQVEST-ARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNAS--TYDQVGRSHITALADYAMRLMEQMKHI-NEHSFNN----FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDL 1130          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Mouse
Match: Adcy2 (adenylate cyclase 2 [Source:MGI Symbol;Acc:MGI:99676])

HSP 1 Score: 110.153 bits (274), Expect = 2.815e-23
Identity = 99/368 (26.90%), Postives = 167/368 (45.38%), Query Frame = 3
Query: 2682 LLIITSLGIFTLIVSNSFCCINS-----PQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKT-YRSDGV--PIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASN----IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSN 3743
            L I+T+  I T+ V N F   NS     P  NA+         Q     +  L  LP +I YS I   +   V L +    K++I++  ++   +I+  TH  +   +S+  ++  G+   +K + ++   IFF I +L   R    + RL F W+ K   +REE   +      +++ +LP  V  H+L  S     L+   Y  + V+  SIP +     +  SDV       +R+LN+++  FDD++    + G+ KI+T G T   A G+      E + +  R   ++    E    +V + ++ N    N F LR+GI+     +GV+G   P + +WG     A+ +   G LDKI VT  
Sbjct:  686 LTIVTTAIILTMAVFNMFFLSNSEETTLPTANASNANVSVPDNQTAILHARNLFFLPYFI-YSCILGLISCSVFLRVNYELKMLIMMVALVGYNIILLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFF-ITLLVLGRQSEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTE--SDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEE 1049          

HSP 2 Score: 105.145 bits (261), Expect = 9.296e-22
Identity = 78/300 (26.00%), Postives = 139/300 (46.33%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHG------------HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGP-RLDLPYIXXXXXXX------GDSNRMDTYYLRPKH 1799
            W  L+ N ++FI   L G+   +L +  L+  +      + S ++ +    + +RLL  ++P  I  E+K  I+ R L G            H   V    NVS +  +I G +R A     G     + V ++NELF +FD + +E  C ++++  D Y  ++G P +  +HAK+C ++   +   IK++ D+  V +++R  VH+G     V+G  +  +D+   DV +   M     PG+V +S  T + L   YKV+ G   +  PY+   +  +          R   +  RP+H
Sbjct:  193 WQILA-NVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQR-LQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPG-----ELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRH 485          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Mouse
Match: Adcy8 (adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:1341110])

HSP 1 Score: 108.227 bits (269), Expect = 9.763e-23
Identity = 72/249 (28.92%), Postives = 123/249 (49.40%), Query Frame = 3
Query:  981 LLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVH------LRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +LF+     G  ISYL  +  R AFL  R  + + +  +  N++ +RL+  V+P  ++ E+   +   E   HL    H        NVS +  ++ G +     + +    + + V+++NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +  TI+ +    +  +D+R  +H+G     VLG  +  FD+   DV I   +     PG++ +SK+T D L   Y V+ G
Sbjct:  324 VLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVE-DEHLQHQFHRIYIHRYENVSILFADVKGFT-----NLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 566          

HSP 2 Score: 93.9745 bits (232), Expect = 2.523e-18
Identity = 74/308 (24.03%), Postives = 139/308 (45.13%), Query Frame = 3
Query: 2823 LCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRS--DGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPV--GVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHV 3734
            +C  P Y  ++ +   +   V L L    K+ ++L  +    ++    +  +F  +     S  D +  K  S ++  +F  + V +  + L    RL F W+++   +  E  +L    + M+  +LP  V  H+L   R+   L+S  Y  +GV+  SIP +       +  +     +R+LN+++  FD+++    ++ I KI+T G T     G+ P+   +   D+   +  L   +  L   +QE N K+  N F LRIGI   +  +GV+G   P + +WG+    A+ +   G   +I V
Sbjct:  827 ICSYPEYFVFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLSYDNLNHSGEDFLGTKEASLLLMAMF-LLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEK--QQCEDKWGHLCALADFSLALTESIQEIN-KHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQV 1130          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. UniProt/SwissProt
Match: sp|P32870|CYA1_DROME (Ca(2+)/calmodulin-responsive adenylate cyclase OS=Drosophila melanogaster OX=7227 GN=rut PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.502e-36
Identity = 138/500 (27.60%), Postives = 247/500 (49.40%), Query Frame = 3
Query: 2346 SYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPVGVK-EPSDVASN-IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRS--RLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            S  I+   +   K+  +D    R+   F  S ME ++    +     A+  SL  ++   +L    L +T++LLL+FL  F+W+  +L+L+L +++K+I   I  S    + + I T + I+++   N F C++    +              Q+DSH  C LP Y+  S  +  L + V L LP  FK ++VLG      + I  +H+ IF  +     +  +P+  IS     IF  I +L   R++    RL F WQ++ + +++E   L  +  R++  LLP  V +H+L+   RN M L+   Y  +GV+  S+P++     + + SD     +R+LN+++  FD++++   + GI KI+T G T    +G+ P++ I+ +   S  R MT L+   + ++  +QE NS +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G      VT   +  +   S F F   GT+ V   G +++
Sbjct:  664 SQAINARSVDCDKSEHVD----RLTLRFRQSDMEREYHKDFDLGFTTAMGCSLLLLILGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRMAITIFTVILIYSVGQVNVFTCVSDHPCSGN-------GTTSFQNDSHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNIFECYDNRVNA-SIPLHLISLARIAIFM-IAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHS-YNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSL-VGSHFEFRCRGTIKVKGKGDMVT 1148          

HSP 2 Score: 147.902 bits (372), Expect = 9.144e-34
Identity = 115/441 (26.08%), Postives = 213/441 (48.30%), Query Frame = 3
Query:  417 INPFAFKNINLERIYAKYFSLVYRSTQLARFFLL--IGLFCLVIGIIEMIP-TFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGN-FKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSK----HWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHG--HLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +N   F+N  LE +Y +Y      + +L RF +L  + L  ++ G++  +  TF    N  T    + +I   +  ++ LV + C   ++  H+  L +   +   +I V   P  G+ F +D++  +  G+W+ ++++       P+  +  +A  I L   H  +++         +F+       +  L  N ++FI   + G V++ + ++  R  FL  R  + S +E +  NEKL+RLL  V+P  +  ++K  I L  + G  H   +    NVS +  +I G +  +         + + V+L+NELF RFD L  +  C ++++  D Y  ++G PE R DHAK   E+   +   I  + ++ +V+L++R  +HTG     VLG  +  FD+  +DV +   M     PG+V V+++T D L   Y+V+ G
Sbjct:   13 LNTLRFENDELECLYQRY------TLKLQRFSVLGVVALVFVLCGVMAALSLTF---NNAATFHNIFNAIVCGLFAVV-LVLLQCS-VIKDHHLPTLCYGILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHISLTVYK-------IFTDALRYLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDI-LSPVAGQFHRIYIQKHENVSILFADIVGFTVLS-----SQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAG 429          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. UniProt/SwissProt
Match: sp|Q08828|ADCY1_HUMAN (Adenylate cyclase type 1 OS=Homo sapiens OX=9606 GN=ADCY1 PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.537e-27
Identity = 119/477 (24.95%), Postives = 219/477 (45.91%), Query Frame = 3
Query:  621 MAILTIIPLVHINCQQCMRPQHMAFLKFSGF-ILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTI-FXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETIT------------KIYKAYPLLTNLLDGNESGKY------SQKI-NQNSFS 1973
            +A+L +  +  +   Q  +   +A L    F +LCC   +              +    G+W+   L++T   +  +   +LLA+    +  +  ++    +V +K+P    + W  L  N LLF+   + G  +  L ++  R AFL AR    SC+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T   L   Y+V+       P      +S   ++ ++T+++ P H ++        LI+SD   ++  +  T            K++KA    +N++   +  K       S+K+ N++SFS
Sbjct:  103 LALLVVTNVRSLQVPQLQQVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQ--LLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTATLVPAKRP----RLWRTLGANALLFVGVNMYGVFVRILTERSQRKAFLQAR----SCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVE-------PGYGHERNSFLKTHNIETFFIVPSHRRK----IFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFS 553          

HSP 2 Score: 106.301 bits (264), Expect = 2.352e-21
Identity = 80/325 (24.62%), Postives = 155/325 (47.69%), Query Frame = 3
Query: 2868 TLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDG--VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            TLPL +   +    K++++ G           T  ++  E S   R+ G  V  +    IV+ + F+  +   +R ++   RL + W  +   +RE+  K+ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++ME   Y+ I KI+T G T   A+G+ P    ++    S  ++ L   A  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   +I VT   +  +     + F   G + V   G++++
Sbjct:  738 TLPLAIFFRVSSLPKMILLSG---------LTTSYILVLELSGYTRTGGGAVSGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQS-YNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEE-VHRLLRRCPYHFVCRGKVSVKGKGEMLT 1051          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. UniProt/SwissProt
Match: sp|P19754|ADCY1_BOVIN (Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.050e-26
Identity = 80/263 (30.42%), Postives = 132/263 (50.19%), Query Frame = 3
Query:  936 PVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            P    + W  L  N LLF+   + G  +  L ++  R AFL AR    +C+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T   L   Y+V+ G
Sbjct:  206 PAKRPRLWRTLGANALLFLGVNVYGIFVRILAERAQRKAFLQAR----NCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPG 459          

HSP 2 Score: 103.99 bits (258), Expect = 1.440e-20
Identity = 97/429 (22.61%), Postives = 190/429 (44.29%), Query Frame = 3
Query: 2868 TLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPGTITFRVFMLREKTLSHGSMIPNNLVPICSDESIISIGGRRNSLTVVMASGEPINHYMMNSTPVVPHNAT------ASLMSSNPLVMPRNGAIPPGMS 4130
            TLPL + L +    K++++   V+ T  I+     L  + ++K   +  +  +    I++ + F+  +   +R ++   RL + W  +   +R++  K+ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++M+   Y+ + KI+T G T   A+G+ P    ++    S  ++ L   A  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   +I VT      +   S + F   G + V   G++++               + L  +T  +GS   +    + S+  +   G  R  L   +A+G P         PV P           +L  S     P    +PPG S
Sbjct:  740 TLPLAIFLRVSSLPKMILL--AVLTTSYILV----LELSGYTKAMGAGAISGRSFEPIMAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERDDMEKVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTKAKKCISSHLSTLADFAIEMFDVLDEINYQS-YNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRGS-YRFVCRGKVSVKGKGEMLT---------------YFLEGRTDGNGSQTRS----LNSERKMYPFG--RAGLQTRLAAGHP---------PVPPAAGLPVGAGPGALQGSGLAPGPPGQHLPPGAS 1130          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. UniProt/SwissProt
Match: sp|O88444|ADCY1_MOUSE (Adenylate cyclase type 1 OS=Mus musculus OX=10090 GN=Adcy1 PE=1 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 2.356e-26
Identity = 80/263 (30.42%), Postives = 131/263 (49.81%), Query Frame = 3
Query:  936 PVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            P    + W  L  N LLF    + G  +  L ++  R AFL AR    +C+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T   L   Y+V+ G
Sbjct:  203 PAKRPRLWRTLGANALLFFGVNMYGVFVRILTERSQRKAFLQAR----NCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPG 456          

HSP 2 Score: 98.5969 bits (244), Expect = 6.256e-19
Identity = 75/325 (23.08%), Postives = 153/325 (47.08%), Query Frame = 3
Query: 2868 TLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPI--KYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            TLPL + L +    K++++ G           T  ++  E S   +  G  +  +    I++ + F+  +   +R ++   RL + W  +   +R++  ++ +   R++  LLP  V  H+L  +   M+L+   Y  +GV+  SIP++    ++   +      +R+LN+++  FD++M+   Y+ + KI+T G T   A+G+ P     +    S  +  L   A  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   +I VT      +   S + F   G + V   G++++
Sbjct:  737 TLPLAIFLRVSSLPKMILLSGLT---------TSYILVLELSGYTKVGGGALSGRSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLCTLADFAIDMFDVLDEINYQS-YNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLKRCS-YQFVCRGKVSVKGKGEMLT 1050          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. UniProt/SwissProt
Match: sp|O43306|ADCY6_HUMAN (Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 2.880e-23
Identity = 79/293 (26.96%), Postives = 137/293 (46.76%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATS 1829
            W  L  N LLF+ + +IG    Y  +   R AF   R ++ + +  +  N + +RLL  V+P  +  E+K+ I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++++T   L   Y+V+ G               G+ N     YL+ +HI+   IL  S
Sbjct:  286 WKQLGANVLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLA-----SQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPG-------------RGGERN----AYLKEQHIETFLILGAS 556          

HSP 2 Score: 96.2857 bits (238), Expect = 3.339e-18
Identity = 97/417 (23.26%), Postives = 180/417 (43.17%), Query Frame = 3
Query: 2631 MKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLL-----------------CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVL---------------GTVICTCVIIFGTHELIFTEFSKTYRSDG--------VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSR---LMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            ++ +S  IVRS   S  + I + L +FT  ++N F C ++P  +   +    T           L                 C  P Y   + +   L   V L +    K+ ++                 T+     ++ G H L  +  ++T+  DG        V +KY++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S++  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++        V RS    L    +R  E +K I  EH+  N    F ++IG++M    +GV+G   P + +WG     ++ +   G  D+I VT++ 
Sbjct:  728 LQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASS--NETF--DGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVEST-ARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNAS--TYDQVGRSHITALADYAMRLMEQMKHI-NEHSFNN----FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDL 1132          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. TrEMBL
Match: A0A183NSZ1 (Guanylate cyclase domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS5227 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 4.466e-40
Identity = 94/281 (33.45%), Postives = 153/281 (54.45%), Query Frame = 3
Query: 1002 LIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDA---------VKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVR-ILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLD------LPYIXXXXXXXGDSNRMDTYYLRPK 1796
            LIG +I+    +     FL A           M   KL RL  C+VP P+  +L    +   L    P V++LRNV+F++ E+ GLS  +    + +  +++          +  +N++++ FD L Q   CY+VR++ ++YL +AGYPETRVDHA+SC +L   +   I ++ + + V L++R  VHTG  Y  VLG SR+ FDL+GDDV  + R       P +V+ S+ST++QLPEG++ + GP         +P      S+  +   M+TY+++P+
Sbjct:  539 LIGQLIAVWTSRHRYRLFLTASYTQAIIFRLHMTESKLHRLSKCLVPAPLADDLVNDFINGHLSWSSPLVIYLRNVTFLSAELVGLSNLSSNLASTLKSNTNINHELICQQFISFINDIYTCFDYLAQNESCYRVRLNANEYLCIAGYPETRVDHARSCIDLGLNMLKIIGEISERSHVQLELRVSVHTGTAYAIVLGRSRLGFDLIGDDVTYVSRLKYAAYRPCRVLTSRSTFNQLPEGFRGEAGPIFGYPNPVIIPTNESIKSNHHNQTTMETYFVQPR 819          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. TrEMBL
Match: A0A183LER0 (Guanylate cyclase domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2285 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.123e-39
Identity = 96/283 (33.92%), Postives = 154/283 (54.42%), Query Frame = 3
Query: 1002 LIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDA---------VKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVR-ILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLD------LPYIXXXXXXXGDSNRMDTYYLRPKHI 1802
            LIG +I+    +     FL A           M   KL RL  C+VP P+  +L    +   L    P V++LRNV+F++ E+ GLS  +    + +  +++          +  +N++++ FD L Q   CY+VR++ ++YL +AGYPETRVDHA+SC +L   +   I ++ + + V L++R  VHTG  Y  VLG SR+ FDL+GDDV  + R       P +V+ S+ST++QLPEG++ + GP         +P      SS  +   M+TY+++P+ I
Sbjct:  539 LIGQLIAVWTSRHRYRLFLTASYTQAIIFRLHMTESKLHRLSKCLVPAPLADDLVNDFINGHLSWSSPLVIYLRNVTFLSAELVGLSNLSSNLASTLKSNTNINHELICQQFISFINDIYTCFDYLAQNESCYRVRLNANEYLCIAGYPETRVDHARSCIDLGLNMLKIIGEISERSHVQLELRVSVHTGTAYAIVLGRSRLGFDLIGDDVTYVSRLKYAAYRPCRVLTSRSTFNQLPEGFRGEAGPIFGYPNPVIIPTNESIKSSHHNQTTMETYFVQPRTI 821          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. TrEMBL
Match: A0A0X3PL39 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR114579 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.288e-38
Identity = 118/379 (31.13%), Postives = 197/379 (51.98%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQ-KMLRNAFLYAREFLNSCVENK---MANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARG--------------DG-NGISFSSDA--VKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDS--NRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETITKIYKAYPLLTNLLDGNESGKYSQKINQNSFSQSQTHKSLDYSDTNEKG 2024
            W   + N L F+ + L+G  ++ L++    R  F+     L+S   ++   +   KLD +   +VP P+ A+L+Q  +        P V++LRNVSF++ E+ G    A                DG  GI+  S    +  +N+L S+ + + +  GCY V +HP + L +AGYP+ RVDHA SC +LA  I+  +  + +SA V L +R  VHTG  Y AV G S + FDLLG DV  LR +     PG+V+VS+ST+DQLPEGY+ ++GP         S +++ D+  +  +T+Y++P+ +  +S  ++  L+  D             +  +P LT  + G+       ++ +++ + S TH  LD+  + E+G
Sbjct:  315 WRGFAVNLLSFLCANLVGYQLARLKELAQWRCLFV----VLSSSARSRHLQLVQSKLDIVSRSLVPAPLAADLEQDFISGVCSWTSPLVIYLRNVSFLSAELVGFCTSATDSSDTRACAERELVVDGPGGITGPSPGHVISFLNQLLSQVNSISEAHGCYPVHLHPSEILCVAGYPDVRVDHAHSCVQLALEIRRLVSSIANSARVGLQLRVAVHTGEAYAAVFGKSMLAFDLLGPDVVFLRRLRSATLPGRVLVSRSTFDQLPEGYEGEIGPFF---AAKSSSTNTADTAVSAPETFYVQPRKMT-DSKNSSPSLLGGD-------------HCRWPCLTQ-VSGSTLATCFARLARSAGAASSTHLPLDFLFSAEEG 671          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. TrEMBL
Match: A0A267EH02 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003700g2 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.195e-38
Identity = 128/452 (28.32%), Postives = 235/452 (51.99%), Query Frame = 3
Query: 2403 SISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYR---------------SDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDR---MIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPV-GVKEPSDVASNIRVLNQLLITFDDVMESSD-YEGITKIRTAGETAWYAIGIDP---DHPIESSVDRSRL--MTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEA 3680
            S++ V   F     E+++  Q +   G A+L +L  +L   SL A +L +T++LLL+F++ F WIG++L+++L  ++K +  +I  S +  V+++I + L ++ +  +N FCC ++     TY    Q           L CPLP +I  S     + + V  +LP   K+ +++       + +  TH  +F+      R               S G    ++  +V    F+IL+   SR     +R  FQW+ +     E  H + +  +    ++  LLP+ V  H+ + + RN ++L++ EY+ +G+L  ++P W P  G + P  V  +IRVLN ++   D++++ +D ++ + K+RT GE    A+G++P   D+P       S+L  +T L++ A++++R V E N+   E+R  +R+GI +  GF GVVGG+ P F +WG+A
Sbjct:  706 SMNPVTLKFSTQAKENEYHRQEDHTFGAAMLAALFILLISASLQASVLPRTMLLLLLFMIAFTWIGMMLMVLLAARLKCLEFNIQSSFVIRVVVIITSVLFVYAVSQANVFCCRSTVGNRTTYGPILQDSDNSL----ELQCPLPDFIYLSGTLCLILVAVFASLPSFIKLFLLVAVSTTFGLTVAVTHRPLFSLVDSDVRGLASLSGLAASAHDMSAGPVPTFVWGLVCLTAFSILIFVHSRFHEFAQRQEFQWKSQ---SAENQHDMFLVKEASCCLLKNLLPQHVALHFTDTTYRNPVDLYAQEYQLLGILWANLPDWQPAPGTEAPLLVQESIRVLNDVICELDELIQRADRHQELVKVRTVGENYVVAVGMNPQLQDNPA------SKLFHLTGLVQLAQLMRRRVAELNATLYEDRIRMRVGIDLGPGFCGVVGGSRPVFDIWGQA 1144          

HSP 2 Score: 145.976 bits (367), Expect = 9.372e-31
Identity = 120/482 (24.90%), Postives = 228/482 (47.30%), Query Frame = 3
Query:  420 NPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPI-W-GNFKIDSESFITV--GLWETIWLIITISCFYP-----------VTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANE----KLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISF-SSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEG-YKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHI 1802
            N  AF + ++ER+Y KY   + R+  L+RF  L+   CL++ +  +   F +  +Y   V    + +     +   +H    + MRP+H +       +L   I  +  P+ W     +  +   T+  GLW+  + +  + C  P           V     LA +  L     +       +++K +  S +W +L  + L+ + + L G+ +   +  +LR +FL  +    +C+ N++  +    KL+RL+  VVP  +  +++   +       +  V     +S +   I GL++         SF +SDAVKLMN++F R D L  E   ++VR+  D+Y +  G+P    +HA         +   I  L + +++ L+ R  +++GV Y A+LG  R+ +D++G+ V I R +L    PG++++SKSTY +L +   +V+ GP LD P      ++ G   +++T  +RP+ +
Sbjct:  124 NSDAFVDWSVERLYRKYAFRLERA-MLSRF--LLTYVCLLLALTSIDYAFGHRFSYKAAVYVASASAFLFAAV--FLH---SRLMRPEHTSTGCALVLLLVSLIAATAFPVSWVSASTVQQQQIFTMADGLWQVAFAVFAVYCLLPGQLLATALYGSVLSLCYLACSAVLTRQQLVEPSRADSVARKHITES-YWTSLIASSLVLLCANLGGACLQRFRDSLLRRSFLETK----ACIANQLQLDDETYKLERLVQSVVPSDLTDDMRADCLHGNFGWKVAQVNQTPYMSLMCASISGLTKFP------ASFPASDAVKLMNQVFCRLDQLAYEHQAFRVRIQGDEYTAAIGFPHECAEHATLAVRFGQVLLEMIGNLSECSQLPLEARVGINSGVAYAALLGKCRLTYDVMGEQVVIARRLLQACPPGRILLSKSTYLELADADLRVEPGPLLDRP-----GANGGVRTKLETVIVRPRQL 581          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. TrEMBL
Match: A0A267FGN4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003700g1 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 3.223e-38
Identity = 128/452 (28.32%), Postives = 235/452 (51.99%), Query Frame = 3
Query: 2403 SISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYR---------------SDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDR---MIDILLPKFVVSHYLNPS-RNYMNLFSCEYKTIGVLSVSIPSWCPV-GVKEPSDVASNIRVLNQLLITFDDVMESSD-YEGITKIRTAGETAWYAIGIDP---DHPIESSVDRSRL--MTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEA 3680
            S++ V   F     E+++  Q +   G A+L +L  +L   SL A +L +T++LLL+F++ F WIG++L+++L  ++K +  +I  S +  V+++I + L ++ +  +N FCC ++     TY    Q           L CPLP +I  S     + + V  +LP   K+ +++       + +  TH  +F+      R               S G    ++  +V    F+IL+   SR     +R  FQW+ +     E  H + +  +    ++  LLP+ V  H+ + + RN ++L++ EY+ +G+L  ++P W P  G + P  V  +IRVLN ++   D++++ +D ++ + K+RT GE    A+G++P   D+P       S+L  +T L++ A++++R V E N+   E+R  +R+GI +  GF GVVGG+ P F +WG+A
Sbjct:  707 SMNPVTLKFSTQAKENEYHRQEDHTFGAAMLAALFILLISASLQASVLPRTMLLLLLFMIAFTWIGMMLMVLLAARLKCLEFNIQSSFVIRVVVIITSVLFVYAVSQANVFCCRSTVGNRTTYGPILQDSDNSL----ELQCPLPDFIYLSGTLCLILVAVFASLPSFIKLFLLVAVSTTFGLTVAVTHRPLFSLVDSDVRGLASLSGLAASAHDMSAGPVPTFVWGLVCLTAFSILIFVHSRFHEFAQRQEFQWKSQ---SAENQHDMFLVKEASCCLLKNLLPQHVALHFTDTTYRNPVDLYAQEYQLLGILWANLPDWQPAPGTEAPLLVQESIRVLNDVICELDELIQRADRHQELVKVRTVGENYVVAVGMNPQLQDNPA------SKLFHLTGLVQLAQLMRRRVAELNATLYEDRIRMRVGIDLGPGFCGVVGGSRPVFDIWGQA 1145          

HSP 2 Score: 144.436 bits (363), Expect = 3.070e-30
Identity = 120/482 (24.90%), Postives = 227/482 (47.10%), Query Frame = 3
Query:  420 NPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPI-W-GNFKIDSESFITV--GLWETIWLIITISCFYP-----------VTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANE----KLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISF-SSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEG-YKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHI 1802
            N  AF + ++ER+Y KY   + R+  L+RF  L+   CL++ +  +   F +  +Y   V    + +     +   +H    + MRP+H +       +L   I  +  P+ W     +  +   T+  GLW+  + +  + C  P           V     LA +  L     +       +++K +  S +W +L  + L+ + + L G+ +   +  +LR +FL  +    +C+ N++  E    KL+RL+  VVP  +  +++   +       +  V     +S +   I GL++         SF +SDAVKLMN++F R D L  E   ++VR+  D+Y +  G+P    +H          +   I  L + +++ L+ R  +++GV Y A+LG  R+ +D++G+ V I R +L    PG++++SKSTY +L +   +V+ GP LD P      ++ G   +++T  +RP+ +
Sbjct:  125 NSDAFVDWSVERLYRKYAFRLERA-MLSRF--LLTYVCLLLALTSIDYAFGHRFSYKAAVYVASASAFLFAAV--FLH---SRLMRPEHTSTGCALVLLLVSLIAATAFPVSWVSASTVQQQQIFTMADGLWQVAFAVFAVYCLLPGQLLATALYGSVLSLCYLACSAVLTRQQLVEPSRADSVARKHITES-YWTSLIASSLVLLCANLGGACLQRFRDSLLRRSFLETK----ACIANQLQLEDETYKLERLVQSVVPSDLTDDMRADCLHGNFGWKVAQVNQTPYMSLMCASISGLTKFP------ASFPASDAVKLMNQVFCRLDQLAYEHQAFRVRIQGDEYTAAIGFPHECTEHTTLAVRFGQVLLEMIGNLSECSQLPLEARVGINSGVAYAALLGKCRLTYDVMGEQVVIARRLLQACPPGRILLSKSTYLELADADLRVEPGPLLDRP-----GANGGVRTKLETVIVRPRQL 582          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Cavefish
Match: adcy5 (adenylate cyclase 5 [Source:NCBI gene;Acc:103026414])

HSP 1 Score: 120.168 bits (300), Expect = 1.717e-26
Identity = 103/429 (24.01%), Postives = 193/429 (44.99%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSE-SFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRE--LHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF  + +S+ L     +I L C V+          YP          ++ S+AI  ++ L+    +      HM       +++C A++  +  +     I       + GLW T++ I  +    PV     +A  +      ++ +I ++   K     +  W  +  N L+F  + ++G    Y  +   R AF   RE + + + ++  N++ +RLL  V+P  +  E+K  I  ++  +  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T + L   Y V+ G
Sbjct:  169 FRSEKLERLYQRYFFRLNQSS-LTMLMAVIALVCAVMLCFHCAGGPCYPA-------LVLTFSLAIALVLALMLACNRSAFHQDHM-------WLVCYAVIAVLLVLQVVGVILVRPRSASDGLWWTVFFIYVVYTLLPVRMRAAVATGV------ALAAIHVVGSWKLNEQDALLWRQIVSNVLIFSCTNIVGVCTHYPAEGSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNGDYDVEPG 571          

HSP 2 Score: 97.4413 bits (241), Expect = 1.694e-19
Identity = 116/528 (21.97%), Postives = 223/528 (42.23%), Query Frame = 3
Query: 2361 EDDISLKKTSEIDL-SISRVRN--------TFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCC--------------INSPQLNATYKXXXXXXXXXXXSDSHLL-----CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVII-------FGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNL-LRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            ED++       ID  SI R+R+        TF +  +E K+  Q +   G  +  +    LFI+ L  ++  +                     +  + ++ +S  IV+S L S ++ + T + +F     N F C              I    +NA + +           DS        C  P Y     +   L   V L +    K+ ++L   I   +II       F   +L+    +       VP+K ++ +V  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++     ++     R + +  +R  + +K I  EH+  N    F ++IG++M    +GV+G   P + +WG     A+ +   G  ++I VT++ + ++  S  +     G + V   G++++
Sbjct:  660 EDEVDEFLGRAIDARSIDRLRSEHVKKFLLTFREPDLEKKYSKQVDSRFGAYVACASLVFLFISPLTFILFGQ---------------------LFPVPLQNLSKRIVQSRLNSALVGVFTIVLVFLSAFINIFTCSTDDLKRCLGREFNITPSSVNACHVRSSAFNYSLWSQDSLCYSTAPACNFPEYFSSCVLLSLLACSVFLQMSSIGKLFLMLFIEILYVLIIEVPEVSLFDNGDLLVIANAICVTDSRVPLKIMTPVVITVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDQFRQLEKIKTIGSTYMAASGLNDSTYDKAGRSHIRALADYAMRLMDQMKYI-NEHSFNN----FKMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPERIQVTTD-LYQVLNSYNYSLECRGVVKVKGKGEMMT 1159          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Cavefish
Match: adcy5 (adenylate cyclase 5 [Source:NCBI gene;Acc:103026414])

HSP 1 Score: 119.398 bits (298), Expect = 2.875e-26
Identity = 103/429 (24.01%), Postives = 193/429 (44.99%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSE-SFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRE--LHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF  + +S+ L     +I L C V+          YP          ++ S+AI  ++ L+    +      HM       +++C A++  +  +     I       + GLW T++ I  +    PV     +A  +      ++ +I ++   K     +  W  +  N L+F  + ++G    Y  +   R AF   RE + + + ++  N++ +RLL  V+P  +  E+K  I  ++  +  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T + L   Y V+ G
Sbjct:  169 FRSEKLERLYQRYFFRLNQSS-LTMLMAVIALVCAVMLCFHCAGGPCYPA-------LVLTFSLAIALVLALMLACNRSAFHQDHM-------WLVCYAVIAVLLVLQVVGVILVRPRSASDGLWWTVFFIYVVYTLLPVRMRAAVATGV------ALAAIHVVGSWKLNEQDALLWRQIVSNVLIFSCTNIVGVCTHYPAEGSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNGDYDVEPG 571          

HSP 2 Score: 89.7373 bits (221), Expect = 3.934e-17
Identity = 69/275 (25.09%), Postives = 139/275 (50.55%), Query Frame = 3
Query: 3015 VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNL-LRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            VP+K ++ +V  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S   V ++  ++    +R+LN+++  FD+++    +  + KI+T G T   A G++     ++     R + +  +R  + +K I  EH+  N    F ++IG++M    +GV+G   P + +WG     A+ +   G  ++I VT++ + ++  S  +     G + V   G++++
Sbjct:  928 VPLKIMTPVVITVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDQFRQLEKIKTIGSTYMAASGLNDSTYDKAGRSHIRALADYAMRLMDQMKYI-NEHSFNN----FKMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPERIQVTTD-LYQVLNSYNYSLECRGVVKVKGKGEMMT 1195          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Cavefish
Match: adcy6b (adenylate cyclase type 6-like [Source:NCBI gene;Acc:103042747])

HSP 1 Score: 113.62 bits (283), Expect = 1.707e-24
Identity = 106/436 (24.31%), Postives = 199/436 (45.64%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQ-HMAFLKFSGFILCCAIL-------VSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF   +R  Q +   +L+G+  LV G++         P+        +S++MA+  ++ +V      C R   H  ++    +++   ++       + VSP     +  SE     G+W +I+ +  I    PV   + +   I       + +I L+   +  +     W  L  N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:  139 FRSAKLERLYQRYF---FRLNQ-SSLTMLMGVLVLVCGVMLAFHCVHGHPDVA--YASVLSVAMALFLVLMVV------CNRNGFHQDYMWMVSYLVMAVLVVVQVFGVLMVSP-----RSASE-----GVWWSIFFVYIIYTLLPVRMRSAVLSGI------VLSTIHLVTAWRLNLEDQFLWKQLCANGLVFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQQERLLLSVLPRHVAMEMKAHINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEPG 541          

HSP 2 Score: 88.5817 bits (218), Expect = 7.700e-17
Identity = 80/326 (24.54%), Postives = 154/326 (47.24%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICT-------CVIIFGTHELIFTE-----FSKTY---RSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            CP P Y  YS +   L   V L +    K+ ++L   +          V ++   +L+ T      F+ T+   R   V +K ++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S     ++  ++    +R+LN+++  FD+++    ++ + KI+T G T   A G++      S+ DR    +++L  A+   R+ ++    N    N F ++IG+++    +GV+G   P + +WG     A+ +   G  D I VT++ 
Sbjct:  819 CPFPEYFTYSVLLTLLACSVFLHISSIGKLALMLLIQLIFLLLLEWPLVDLYDNADLLVTANALSGFNGTHCHERMSKVSLKVMTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADFDEIISEDQFKQLEKIKTIGSTYMAASGLNA-----STYDREG-RSHILALADYAMRLREQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDCIQVTTDL 1137          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Cavefish
Match: adcy6b (adenylate cyclase type 6-like [Source:NCBI gene;Acc:103042747])

HSP 1 Score: 113.62 bits (283), Expect = 1.707e-24
Identity = 106/436 (24.31%), Postives = 199/436 (45.64%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQ-HMAFLKFSGFILCCAIL-------VSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF   +R  Q +   +L+G+  LV G++         P+        +S++MA+  ++ +V      C R   H  ++    +++   ++       + VSP     +  SE     G+W +I+ +  I    PV   + +   I       + +I L+   +  +     W  L  N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:  139 FRSAKLERLYQRYF---FRLNQ-SSLTMLMGVLVLVCGVMLAFHCVHGHPDVA--YASVLSVAMALFLVLMVV------CNRNGFHQDYMWMVSYLVMAVLVVVQVFGVLMVSP-----RSASE-----GVWWSIFFVYIIYTLLPVRMRSAVLSGI------VLSTIHLVTAWRLNLEDQFLWKQLCANGLVFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQQERLLLSVLPRHVAMEMKAHINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEPG 541          

HSP 2 Score: 88.5817 bits (218), Expect = 7.700e-17
Identity = 80/326 (24.54%), Postives = 154/326 (47.24%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICT-------CVIIFGTHELIFTE-----FSKTY---RSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            CP P Y  YS +   L   V L +    K+ ++L   +          V ++   +L+ T      F+ T+   R   V +K ++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S     ++  ++    +R+LN+++  FD+++    ++ + KI+T G T   A G++      S+ DR    +++L  A+   R+ ++    N    N F ++IG+++    +GV+G   P + +WG     A+ +   G  D I VT++ 
Sbjct:  819 CPFPEYFTYSVLLTLLACSVFLHISSIGKLALMLLIQLIFLLLLEWPLVDLYDNADLLVTANALSGFNGTHCHERMSKVSLKVMTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADFDEIISEDQFKQLEKIKTIGSTYMAASGLNA-----STYDREG-RSHILALADYAMRLREQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDCIQVTTDL 1137          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Cavefish
Match: adcy6b (adenylate cyclase type 6-like [Source:NCBI gene;Acc:103042747])

HSP 1 Score: 113.62 bits (283), Expect = 1.707e-24
Identity = 106/436 (24.31%), Postives = 199/436 (45.64%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQ-HMAFLKFSGFILCCAIL-------VSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF   +R  Q +   +L+G+  LV G++         P+        +S++MA+  ++ +V      C R   H  ++    +++   ++       + VSP     +  SE     G+W +I+ +  I    PV   + +   I       + +I L+   +  +     W  L  N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:  139 FRSAKLERLYQRYF---FRLNQ-SSLTMLMGVLVLVCGVMLAFHCVHGHPDVA--YASVLSVAMALFLVLMVV------CNRNGFHQDYMWMVSYLVMAVLVVVQVFGVLMVSP-----RSASE-----GVWWSIFFVYIIYTLLPVRMRSAVLSGI------VLSTIHLVTAWRLNLEDQFLWKQLCANGLVFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQQERLLLSVLPRHVAMEMKAHINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEPG 541          

HSP 2 Score: 88.5817 bits (218), Expect = 7.700e-17
Identity = 80/326 (24.54%), Postives = 154/326 (47.24%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICT-------CVIIFGTHELIFTE-----FSKTY---RSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            CP P Y  YS +   L   V L +    K+ ++L   +          V ++   +L+ T      F+ T+   R   V +K ++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S     ++  ++    +R+LN+++  FD+++    ++ + KI+T G T   A G++      S+ DR    +++L  A+   R+ ++    N    N F ++IG+++    +GV+G   P + +WG     A+ +   G  D I VT++ 
Sbjct:  819 CPFPEYFTYSVLLTLLACSVFLHISSIGKLALMLLIQLIFLLLLEWPLVDLYDNADLLVTANALSGFNGTHCHERMSKVSLKVMTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADFDEIISEDQFKQLEKIKTIGSTYMAASGLNA-----STYDREG-RSHILALADYAMRLREQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDCIQVTTDL 1137          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Sea Lamprey
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 129.028 bits (323), Expect = 5.413e-30
Identity = 88/290 (30.34%), Postives = 145/290 (50.00%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDL-PYIXXXXXXXGDSNRMDTYYLRPKHIKQ 1808
            W  L  N  LF+   L G+ I  L ++  R AFL AR    +C+E+++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++KST D L   Y+V+ G   D   Y+          + ++TY++ P H ++
Sbjct:   13 WLKLLANVSLFVSVNLSGAFIRVLTERAQRKAFLQAR----NCIEDRLRLEDENEKQERLLMSLLPRHVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKSTLDCLNGDYEVEPGNGKDRNSYLR--------KHNIETYFIVPSHRRK 285          

HSP 2 Score: 94.3597 bits (233), Expect = 2.068e-19
Identity = 66/272 (24.26%), Postives = 134/272 (49.26%), Query Frame = 3
Query: 3021 IKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            +K    +++ + F   +   SR L+   RL + W  +   +R +  ++     R++  LLP  V  H+L  +   M+L+   Y  +GVL  SIP++    ++   +      +R+LN+++  FD++++   ++ I KI+T G T   A+G+ P    ++       ++++   A  +  +V E N ++  N F+LR+GI +    +GV+G   P + +WG     A+ +   G   KI V+ + + +I   S + F   G + V   G++++
Sbjct:  584 MKAYEPVLTILLFICAMGLHSRQLDLKLRLDYLWASQAEDERGDMERVKNDNKRILFNLLPAHVAQHFLQSNPRNMDLYYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELLDKECFKDIEKIKTIGSTYMAAVGLVPTSGTKAKCSIISHLSSVADFAMEMFDVVDEINYQS-YNDFVLRVGISVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGLPGKIQVSED-VYKILKQSNYEFTCRGKVTVKGKGEMLT 853          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008766.1 (pep scaffold:Pmarinus_7.0:GL476654:390837:418056:1 gene:ENSPMAG00000007932.1 transcript:ENSPMAT00000008766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 3.630e-25
Identity = 69/250 (27.60%), Postives = 122/250 (48.80%), Query Frame = 3
Query:  966 LSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            L  N L+F+ + + G    Y  +   R AF   RE + + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:   12 LVANALVFVCTNMAGVCTHYPTEVAQRQAFHETRECIKARLRTQKENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLIKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLRYLNGDYEVEAG 256          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006025.1 (pep scaffold:Pmarinus_7.0:GL480980:9262:24123:1 gene:ENSPMAG00000005435.1 transcript:ENSPMAT00000006025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 4.763e-25
Identity = 73/252 (28.97%), Postives = 123/252 (48.81%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELH-GHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            W  L  N +L + +   G  +    +++ R+ F    E +   +     NEK +RLL  ++P  +  EL+Q  +    H  H   +    NVS +  +I G +  A         + + VKL+NELFS+FD L  E  C ++++  D Y  ++G    + DHA  C ++   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T D L   Y+V+ G
Sbjct:  164 WPKLLVNAVLLVSACACGGAVRIFTERVQRSTFRRTWESVRQRLLLDDENEKQERLLVSLLPRHVAIELRQDFLKPPNHIFHKVYIQRHENVSILFADIVGFTGMA-----SQCTAQELVKLLNELFSKFDELATENHCRRIKILGDCYYCVSGLALAKADHAHCCVKMGLDMIDTIDLVAEAMEVRLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANAMEAGGLPGKVHITKATLDGLRGDYEVEPG 410          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Sea Lamprey
Match: adcy2a (adenylate cyclase 2a [Source:ZFIN;Acc:ZDB-GENE-061109-1])

HSP 1 Score: 105.531 bits (262), Expect = 8.405e-23
Identity = 93/373 (24.93%), Postives = 169/373 (45.31%), Query Frame = 3
Query: 2841 YIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGV-------PIKYISAI-VSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASN----IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHN--SKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPGTITFRVFMLREKTLSHGSMI 3917
            Y  YS I   +   V L +    KV+ +L  V+   VI+  TH  +F  +++      +        +K + +I +   FF +LVL  +R    + RL F W+ K   +REE   +      +++ +LP  V  H+L   R   +L+   Y+ + V+  SIP +      + SDV       +R+LN+++  FD+++    + G+ KI+T G T   A G++     E+  +  R   ++    E    ++ + +  +K+  N F LR+GI+     +GV+G   P + +WG +   ++ +   G L KI VT    ++I  +  +     G + V   G+L             TF V     ++LS G++I
Sbjct:  509 YFLYSCILGLVSCSVFLRVNHELKVLTLLAAVVGYNVILLHTHHGVFDAYTEALYHPSLVRPGVLKDVKVMGSIWLIVFFFTLLVL--ARQNEYYCRLDFLWKQKFKKEREEIETMENLNRVLLENVLPAHVAEHFLTHHRKNEDLYHQSYECVCVMFASIPDF--KEFYQESDVNKEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNAAVGQENGQEPERQYAHIGIMVEFAMALMGKLDVINKHSFNNFRLRVGINHGPVIAGVIGAQKPQYDIWGNSVNVSSRMDSTGVLGKIQVTEE-TSDILQTLGYNCQCRGMIKVKGKGEL------------KTFFVVTEMTRSLSQGNVI 864          

HSP 2 Score: 83.1889 bits (204), Expect = 5.276e-16
Identity = 55/215 (25.58%), Postives = 104/215 (48.37%), Query Frame = 3
Query: 1116 DRLLSCVVPMPILAELKQSIMLR--------ELHGHLPS---------VVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            +RLL  V+P  I  E+K  I+ R        +    LP          V   ++VS +  +I G +R A          ++ V  +N+LF +FD + ++  C ++++  D Y  ++G P +   HAK+C ++   +   IK++  +  V +++R  VH+G     V+G  +  +D+   DV +   M     PG+V ++++T + L   Y+V+ G
Sbjct:    2 ERLLLSVLPAHIALEMKAEIIQRLKGPFCGQQQQQLLPENSNNFHNLYVRRHKSVSILYADIVGFTRLASD-----CSPAELVHTLNQLFGKFDQIAKDNDCMRIKILGDCYYCVSGLPISLPSHAKNCVKMGIDMCEAIKKVRYATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITEATLEHLHGAYEVEEG 211          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Sea Lamprey
Match: adcy9 (adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-050208-455])

HSP 1 Score: 99.7525 bits (247), Expect = 7.195e-21
Identity = 51/133 (38.35%), Postives = 72/133 (54.14%), Query Frame = 3
Query: 1311 VKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            V+L+N+LF RFD L +  GC ++    D Y  +AG PE R DHA  C E+   +   I+Q C      +D+R  VHTG     +LG  R  FD+L +DV +   M  +   GKV VS++T   L E Y ++ G
Sbjct:  347 VRLLNDLFGRFDKLCEVTGCEKISTLGDCYYCVAGCPEPRTDHAACCVEMGLGMIAAIEQFCRDNRETVDMRVGVHTGTVLCGILGMKRFKFDVLSNDVNLANMMEQLGVAGKVHVSEATALCLDERYTMEDG 479          

HSP 2 Score: 68.1662 bits (165), Expect = 2.767e-11
Identity = 58/247 (23.48%), Postives = 108/247 (43.72%), Query Frame = 3
Query: 3087 ILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVT-SNFMAEIDPSSKFGFYDVGTLIVNHAGQL 3824
             LN    + ++     N++ E H + I  +    D+LL   +  H  +  +   + +S  ++ +GV+  SI ++     +         RVL++L+   D ++    Y GI KI+T G T   A G++   P   + D    +  L   A  +  IV++ N       F LRIG +     +GV+G   P + +WG+    A+ +   G   ++ V+  ++    D   +F +   GT+ V   GQ+
Sbjct:  929 FLNREFEVAYRLNYHGNVEAELHQRKIQHMKNQADLLLHNIIPGHVADQLKVQPH-YSKNHEDVGVIFASIVNFSEFYEENYEGGKECYRVLHELMSDLDQLLARDHYGGIEKIKTIGATYMAASGLNVPEP--RAGDAHAHLRTLFEFARDMMSIVEDFNKDMLWFNFRLRIGFNHGPLTAGVIGTTKPLYDIWGDTVNIASRMDSTGVDCRVQVSQESYHVLCDMGYQFDYR--GTVNVKGKGQM 1170          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Nematostella
Match: EDO45868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ7])

HSP 1 Score: 115.161 bits (287), Expect = 2.294e-25
Identity = 76/251 (30.28%), Postives = 123/251 (49.00%), Query Frame = 3
Query:  966 LSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSI---MLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            L GN LLFI + + G    Y  +   R AFL  R  + + +  +  N+  +RLL  V+P  +  E+K  I   + +    H   +    NVS +  +I G +  +         +   +K +NEL++RFD L  E  C ++++  D Y  ++G P+ R DHA SC E+   +   I  + D+ +V L++R  VH G  +  VLG  +  +D+  DDV I   M     PG+V ++K   D L   Y+V+ G
Sbjct:  254 LVGNLLLFICANITGVFTHYPTEISQRQAFLETRRCIEARLTIQKENQNQERLLLSVLPRYVAMEMKDDIESGISQNSQFHKIYIQRHENVSILFADIEGFTVLSSQ-----CTAQSLIKTLNELYARFDQLAVENHCLRIKILGDCYYCVSGLPDPRPDHAHSCIEMGLAMIDAISFVRDATQVNLNMRVGVHMGKVHSGVLGLVKWQYDVWSDDVTIANHMESGGLPGRVHITKEVLDCLNGDYEVEEG 499          

HSP 2 Score: 83.5741 bits (205), Expect = 8.725e-16
Identity = 121/540 (22.41%), Postives = 227/540 (42.04%), Query Frame = 3
Query: 2352 QIDEDDISLKKTSEIDL-SISRVRN--------TFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFI-------SGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQ--------LNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVII-------FGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILN-TFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNY-MNLFSCEYKTIGVLSVSIPSWCPVG-----VKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPG 3857
            Q  ED+++    S ID  SI R+R         TF +   E  +  + ++             LFI     L+L +  + L +FL +F+ + +  LL++  K  F+       S  I +S +   I+  I  +G++   V N F C   P          N T      +    Q    +  C  P Y+ +    V +   V L L    K  ++    I   +++       F  H+  F +F        +    +S ++  IF  IL L     L+    RL F W+++   +++E  +L     +++  +LP  V  H+L    N   +L+   Y++   ++V   + C        +    +    +R+LN++L  FD+++    ++ I KI+T GET   A GI P+   +  +     +  +   A  +KR +++ N  +  N F ++IG++     +GV+G + P + +WG+    A+ +   G+ + I VT   M EI  +  + F   G + V   G++++     W+ G
Sbjct:  518 QDTEDEVNEFLGSSIDARSIERLRKEYVQPILLTFKNPAKEELYSQERDRMFKSYTSCVFLVYLFILGTQLLVLPRNYVTLAVFLSIFLIVAITYLLVVSEKFSFLPESLTNLSSTICQSRVICRIIASILIIGLYVAAVGNLFGCDEPPTPEFTKIFLNNETKLVCNASRYPPQLGVENQSCDYPQYVTFCVTLVMIGCAVFLQLSTVLKFSLLTVMAIVYILLVQYVAKNSFLRHD--FLQFCGLGSGHFIEWSDLSILIVVIF--ILALTAHGYLHEQISRLDFLWKLQATEEKKEMEQLREYNKKLLYNILPVHVAQHFLGHKANKNEDLY---YQSCDKVAVMFSNICNFSDFYTELDANGEGVECLRLLNEILADFDELLSEPQFQCIEKIKTIGETYMAASGIKPES--QEKLATLNHICTMADFAMAMKRKLEDIN-LHSFNNFAMKIGLNFGPVVAGVIGAHKPQYDIWGDTVNVASRMYSTGKDNHIQVTKA-MYEILSTRGYTFDCRGLVAVKGKGKMVTY----WLLG 1042          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Nematostella
Match: EDO42810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C5])

HSP 1 Score: 107.457 bits (267), Expect = 4.560e-23
Identity = 106/453 (23.40%), Postives = 198/453 (43.71%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSK-TYRSDG---VPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEP--SDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPGTITFRVFMLREKTLSHGSMIPNNLVPICSDESIIS--IGGRRNSLTVVMASGE----PINHYMMNSTPVVPH------NATASLMSSNPLVMPRNGAIPPGMS 4130
            C  P Y  Y+ I + + + V++ L    KV++++G +I   +I     + +F  + K  Y + G   VP  Y S++V  + F IL L   ++  T  RL+F W+M+ + K++E                                +L+S  YK + V+  SIP++     ++   +     IR+LN+++  FD+V+    + G+ KI+T   T   A G+ P+       + S+ + +++  A  L+  +   N ++  N+F+LR+GI      +GV+G   P + +WG     A+ ++  G+   I +T+     I     F F   G + V   GQLI+               ++   K  S    + +N+  + SD   ++  IG   +++  V+++ E     + H   N+  V  +      NA A   +   +   RNG   PG+S
Sbjct:  776 CEYPQYFSYNGILILVGISVLVQLSHALKVMLMIGVLIAYWIINLVRQDKLFVNYDKYVYFNSGSTFVPKMYFSSVVLALTFIILALHGRQVERT-ARLLFLWKMEADEKKKE--------------------------------DLYSHSYKRVSVMFASIPNFSEFYSEDNINNGGVECIRLLNEVITDFDEVLADPRFLGVEKIKTISSTYMAASGLRPE---SEDAEESQNLVDIVDFALTLRDKLDFINQESF-NQFVLRVGICQGPIVAGVIGAKKPHYDIWGNTVNVASRMETTGKAGCIQITAQTYETI-KDKDFVFVYRGAVRVKGKGQLIT--------------YYLTGRKNTSQHVYVVSNVECVVSDVEYVASNIGHVASNVECVVSNVEYVASNVGHVASNAECVASNSGCIVSNAVAVFWTDEIMDKYRNG---PGIS 1173          

HSP 2 Score: 70.4774 bits (171), Expect = 9.675e-12
Identity = 59/253 (23.32%), Postives = 116/253 (45.85%), Query Frame = 3
Query:  966 LSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINV-EICGLSRGARGDGNGISFSSDAVKL---MNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVM-LDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            L  N L+F+ + ++G++  ++  +  R + L  RE L   +     N++  RLL  V+P  +  E+ +     E  G+     +     FI   + C +          +S    A +L   +NELF+ FD L  +  C ++++  D Y  ++G  ++  +HA     +   +   I  + +   V  L++R  +HTG+    VLG  +  F+   +DV +   M     PG+V +S+ T + + + ++V+ G
Sbjct:  270 LVANTLVFVCANILGAIDYHIADRKQRRSVLETRESLEVKLTLDAQNQQQRRLLLSVLPKHVAEEMTKDF---EGDGNPALTDNAFKKLFIRTHDTCSILFADIVGFTELSSKCTAEQLIVTLNELFANFDKLAAKNHCLRIKILGDCYYCISGLDDS-CNHALCAVNMGLDMVEHIAHVREEKGVKSLNMRVGIHTGMVLAGVLGQRKWQFEAWSNDVTLANHMESGGIPGRVHISEPTLNSIKDYFEVEDG 518          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Nematostella
Match: EDO47010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN58])

HSP 1 Score: 85.5001 bits (210), Expect = 2.576e-16
Identity = 50/182 (27.47%), Postives = 87/182 (47.80%), Query Frame = 3
Query: 1164 KQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            K  ++ R    H      + NVS +  +I G ++ +         +   V+L+N+LF RFD L +   C ++    D Y  +AG P+   +HA  C E+   +   IK+  +  +  +D+R  VHTG     ++G  R  FD+  +DV +   M     PG+V ++++T   L + Y V+ G
Sbjct:  274 KAKMVFRPFQMH-----RMENVSILFADIVGFTKMSSNKS-----ADQLVRLLNDLFGRFDRLTEYNHCEKISTLGDCYYCVAGCPKPTPNHATYCVEMGLDMLEQIKEFDNDTDNDVDMRVGVHTGTVLCGIVGTKRFKFDVWSNDVTLANRMETAGLPGRVHITEATVGFLRDQYIVENG 445          

HSP 2 Score: 62.7734 bits (151), Expect = 2.241e-9
Identity = 53/202 (26.24%), Postives = 92/202 (45.54%), Query Frame = 3
Query: 3141 KREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTA-GETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSN 3743
            K+ + HK     D ++  L PK V S  L  S +Y    S  Y   GV+  SI ++     +        IRVLN+L+  FD+++++ +Y  + KI+T  G T     G++ +  I   +     +  L+  A  +  +V   N      +F LRIG +     +GV+G     + +WG+    A+ +   G  +KI V+ +
Sbjct:  868 KKSQVHK--QQADWLLLSLFPKHV-SEALKTSDHY----SMNYNNAGVMFASIVNFSDFYEENFEGGKECIRVLNELVGDFDELLDNIEYMEVEKIKTVNGSTFMAGAGLNQEDNIRREIHPYEHLKQLVEFALEMFNVVDRFNEHMLGFKFKLRIGFNAGPVTAGVIGTTKLLYDIWGDTVNLASRMDSTGVPEKIQVSES 1062          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Nematostella
Match: EDO45933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRE5])

HSP 1 Score: 58.9214 bits (141), Expect = 1.544e-9
Identity = 43/186 (23.12%), Postives = 87/186 (46.77%), Query Frame = 3
Query: 1122 LLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQEL--GCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTY 1673
            LL  V+P  +  EL+ +  ++     + +++    V F   +IC  S+             + V L+N ++++FDML        Y+V    D Y++++G PE    HA+S   +A  ++H  + +    +  + ++  +H+G     V+G+    + L G+ V +        APG+V +++ TY
Sbjct:    1 LLYSVLPPSVANELRHNRPVQAERAEMVTLLFSGIVDF--AQICKNSK-----------PMEIVMLLNNIYTKFDMLTDPSINDVYKVETVGDKYMAVSGLPERCAFHARSICNMALDMKHVTQSIIHKGD-KIQIKIGIHSGEVVAGVVGHKTPRYCLFGNTVNLTSRTETTGAPGQVNITEFTY 172          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Nematostella
Match: EDO47083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN69])

HSP 1 Score: 61.6178 bits (148), Expect = 3.557e-9
Identity = 50/210 (23.81%), Postives = 97/210 (46.19%), Query Frame = 3
Query: 1065 REFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQEL--GCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPE 1688
            R+  N+  E K      D+LL  V+P  +  EL+ +  ++     + +++    V F   +IC  S+             + V L+N ++++FDML        Y+V    D Y++++G PE    HA+S   +A  ++H  + +    +  + ++  +H+G     V+G+    + L G+ V +        APG+V +++ TY  L E
Sbjct:  484 RQTHNALAEKKQLT---DQLLYSVLPPSVANELRHNRPVQAERAEMVTLLFSGIVDF--AQICKNSK-----------PMEIVMLLNNIYTKFDMLTDPSINDVYKVETVGDKYMAVSGLPERCAFHARSICNMALDMKHVTQSIIHKGD-KIQIKIGIHSGEVVAGVVGHKTPRYCLFGNTVNLTSRTETTGAPGQVNITEFTYRCLLE 676          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Medaka
Match: adcy1b (adenylate cyclase type 1 [Source:NCBI gene;Acc:101166500])

HSP 1 Score: 130.183 bits (326), Expect = 1.372e-29
Identity = 118/465 (25.38%), Postives = 216/465 (46.45%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTN-VRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQ 1808
            F    LE ++  Y   + +++ L    +LI      + ++E++       + G++ V C I +S+ I+T +  + +   Q +    + F  F+   LCC   +      G   ++  +    G+W+ I +        PV   TLLA+ + L +S S + +    ++ K   + K W  L  N +LF    L G  +  L ++  R AFL AR    +C+E ++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV +++ST + L   Y+V+ G   +              + ++T+++ P H ++
Sbjct:   38 FDCKELESLFQNYNLKLEQTSTLKALAVLI-FMSFTLAVVELLSGPSLTISKGSHPVHCVIFLSLFIVTNVKYLQVTQLQQIVNLTLLF-GFTFSFLCCPFSL------GAMGMEPPTSPEQGVWQLILVTFVAYALLPVR--TLLAVLLGLMVSISHLIVTATSVTVK---TQKLWRTLVANTVLFTSVNLSGLFVRILTERAQRKAFLQAR----NCIEERLRMEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVNLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITRSTLECLNGDYEVEPGNGHERSAFL-------QKHEIETFFIVPSHRRK 473          

HSP 2 Score: 93.9745 bits (232), Expect = 1.566e-18
Identity = 75/299 (25.08%), Postives = 140/299 (46.82%), Query Frame = 3
Query: 2988 FSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYL--NPSRNYM--------------NLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLIS 3830
            F +T       I+    I+S + F   +   SR L+   RL F W ++   +R+   K+ +   R++  LLP  V  H+L  NP RN +              +L+   Y  +GVL  SIP++    ++   +      +R+LN+++  FD++M+   Y+ I KI+T G T   A+G+ P    ++       ++ +   A  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI VT +    ++  S +     G + V   G++++
Sbjct:  765 FRRTAGGGSFHIRGFEPILSLLLFVSALALHSRQLDLKLRLDFLWAVQAEEERDGMEKVKLDNRRILFNLLPAHVAQHFLMSNP-RNMVSQANRQAGMQTDKQDLYYQSYAQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKECYKDIEKIKTIGSTYMAAVGLVPTIGTKAKKSVHDHLSTIADYAIEMFDVLDEINYQS-YNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVPGKIQVTEDVYRLLN--SNYDLVCRGKISVKGKGEMLT 1059          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Medaka
Match: adcy1b (adenylate cyclase type 1 [Source:NCBI gene;Acc:101166500])

HSP 1 Score: 129.798 bits (325), Expect = 1.828e-29
Identity = 118/465 (25.38%), Postives = 216/465 (46.45%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTN-VRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKM----ANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQ 1808
            F    LE ++  Y   + +++ L    +LI      + ++E++       + G++ V C I +S+ I+T +  + +   Q +    + F  F+   LCC   +      G   ++  +    G+W+ I +        PV   TLLA+ + L +S S + +    ++ K   + K W  L  N +LF    L G  +  L ++  R AFL AR    +C+E ++     NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV +++ST + L   Y+V+ G   +              + ++T+++ P H ++
Sbjct:   38 FDCKELESLFQNYNLKLEQTSTLKALAVLI-FMSFTLAVVELLSGPSLTISKGSHPVHCVIFLSLFIVTNVKYLQVTQLQQIVNLTLLF-GFTFSFLCCPFSL------GAMGMEPPTSPEQGVWQLILVTFVAYALLPVR--TLLAVLLGLMVSISHLIVTATSVTVK---TQKLWRTLVANTVLFTSVNLSGLFVRILTERAQRKAFLQAR----NCIEERLRMEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVNLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITRSTLECLNGDYEVEPGNGHERSAFL-------QKHEIETFFIVPSHRRK 473          

HSP 2 Score: 101.293 bits (251), Expect = 9.128e-21
Identity = 68/254 (26.77%), Postives = 125/254 (49.21%), Query Frame = 3
Query: 2988 FSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSN 3743
            F +T       I+    I+S + F   +   SR L+   RL F W ++   +R+   K+ +   R++  LLP  V  H+L  +   M+L+   Y  +GVL  SIP++    ++   +      +R+LN+++  FD++M+   Y+ I KI+T G T   A+G+ P    ++       ++ +   A  +  ++ E N ++  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI VT +
Sbjct:  765 FRRTAGGGSFHIRGFEPILSLLLFVSALALHSRQLDLKLRLDFLWAVQAEEERDGMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYAQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKECYKDIEKIKTIGSTYMAAVGLVPTIGTKAKKSVHDHLSTIADYAIEMFDVLDEINYQS-YNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVPGKIQVTED 1017          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Medaka
Match: adcy1a (adenylate cyclase type 1 [Source:NCBI gene;Acc:101165720])

HSP 1 Score: 128.257 bits (321), Expect = 5.694e-29
Identity = 121/511 (23.68%), Postives = 227/511 (44.42%), Query Frame = 3
Query:  282 EGFTFLDEQRRKTTDFCPIICCSQLIDNYLSTDEWCNFFKCGSESINPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTN-VRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQ 1808
            E   F   Q+R+ T  CP       +D     DE                F +  LE ++  Y   + +++ L    +LI +    + ++E++ +     + G+N V C + +S+ I+T +  + +   Q +    + F  F+  +LCC   +++    G  +    +    G+W+ + + +      PV   TLLA+   + ++ S   +     + +     + W  L  N +LF    L G  +  L ++  R  FL AR  +   +  +  NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T + L   Y+V+       P       S    + ++T+++ P H ++
Sbjct:    7 EEMPFARVQKRRRTGHCP---APAPLDAIACEDE----------------FNSHELEALFQSYNLKLEQTSTLKALAVLI-VAASSMTLMELLSSPRLTLSKGSNPVHCVVFLSLFIVTNVKYLQVTQLQQIAKLALLF-SFTFSLLCCPFPLAL----GTSEPAHATAPEQGVWQLMLVTLVAYVLLPVR--TLLAVLFGIMLAASHFVVFATSFTGR---KQRMWRPLVANAVLFTSVNLSGVFVRILTERTQRKVFLQARNCIQERLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTIASVVEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKTTLECLNGDYEVE-------PGFGHERHSFLQKHHIETFFIVPSHRRK 475          

HSP 2 Score: 94.7449 bits (234), Expect = 1.049e-18
Identity = 69/278 (24.82%), Postives = 133/278 (47.84%), Query Frame = 3
Query: 3039 IVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSD--VASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPGT 3860
            +++ + F+  +   SR L+   RL + W  +    R +  K+ +   R++  LLP  V  H+L  +   M+L+   Y  +GVL  SI ++    ++   +      +R+LN+++  FD++M+   Y  I KI+T G T   A+G+ P     +S  +  + ++L   ++    +    ++ N +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI VT +    I  +  + F   G + V   GQ+++       PG+
Sbjct:  778 VLAVLLFSGALALHSRQLDLKLRLDYLWATQAEEDRNDMEKVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVLFASIANFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKECYRDIEKIKTIGSTYMAAVGLVP---TTASKAKKSITSHLCTVSDFAIEMFNVLDAINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVHRLI--TDFYNFVCRGQVSVKGKGQMLTYLLEGRRPGS 1050          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Medaka
Match: adcy1a (adenylate cyclase type 1 [Source:NCBI gene;Acc:101165720])

HSP 1 Score: 127.872 bits (320), Expect = 7.554e-29
Identity = 121/511 (23.68%), Postives = 227/511 (44.42%), Query Frame = 3
Query:  282 EGFTFLDEQRRKTTDFCPIICCSQLIDNYLSTDEWCNFFKCGSESINPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTN-VRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR-ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQ 1808
            E   F   Q+R+ T  CP       +D     DE                F +  LE ++  Y   + +++ L    +LI +    + ++E++ +     + G+N V C + +S+ I+T +  + +   Q +    + F  F+  +LCC   +++    G  +    +    G+W+ + + +      PV   TLLA+   + ++ S   +     + +     + W  L  N +LF    L G  +  L ++  R  FL AR  +   +  +  NEK +RLL  ++P  +  E+K+  +   E   H   +    NVS +  +I G +  A         + + VKL+NELF +FD L  E  C ++++  D Y  ++G  + + DHA  C E+   +  TI  + ++ EV L++R  +HTG     VLG  +  +D+  +DV +   M     PGKV ++K+T + L   Y+V+       P       S    + ++T+++ P H ++
Sbjct:    7 EEMPFARVQKRRRTGHCP---APAPLDAIACEDE----------------FNSHELEALFQSYNLKLEQTSTLKALAVLI-VAASSMTLMELLSSPRLTLSKGSNPVHCVVFLSLFIVTNVKYLQVTQLQQIAKLALLF-SFTFSLLCCPFPLAL----GTSEPAHATAPEQGVWQLMLVTLVAYVLLPVR--TLLAVLFGIMLAASHFVVFATSFTGR---KQRMWRPLVANAVLFTSVNLSGVFVRILTERTQRKVFLQARNCIQERLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ-----CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTIASVVEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKTTLECLNGDYEVE-------PGFGHERHSFLQKHHIETFFIVPSHRRK 475          

HSP 2 Score: 87.4261 bits (215), Expect = 1.449e-16
Identity = 59/235 (25.11%), Postives = 115/235 (48.94%), Query Frame = 3
Query: 3039 IVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDV--ASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPE--NRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIH 3731
            +++ + F+  +   SR L+   RL + W  +    R +  K+ +   R++  LLP  V  H+L  +   M+L+   Y  +GVL  SI ++    ++   +      +R+LN+++  FD++M+   Y  I KI+T G T   A+G+    P  +S  +  + ++L   ++    +    ++ N +  N F+LR+GI++    +GV+G   P + +WG     A+ +   G   KI 
Sbjct:  778 VLAVLLFSGALALHSRQLDLKLRLDYLWATQAEEDRNDMEKVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVLFASIANFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKECYRDIEKIKTIGSTYMAAVGLV---PTTASKAKKSITSHLCTVSDFAIEMFNVLDAINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQ 1009          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Medaka
Match: adcy6a (adenylate cyclase 6 [Source:NCBI gene;Acc:101158108])

HSP 1 Score: 125.176 bits (313), Expect = 5.367e-28
Identity = 108/429 (25.17%), Postives = 202/429 (47.09%), Query Frame = 3
Query:  432 FKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQ-HMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLR--ELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLG 1709
            F++  LER+Y +YF   +R  Q +   +L+G+  +V GI+         P+   +    +S++MA+   + +V      C R   H  ++    + L   +LVSV  ++G   +   S  + G+W +++ I  I    PV    + A  +   +   I  +    ++++  F    W  +S N L+F+ + +IG    Y  +   R AF   R ++ + +  +  N++ +RLL  V+P  +  E+K  I  +  ++  H   +    NVS +  +I G +  A         + + V  +NELF+RFD L  E  C ++++  D Y  ++G PE R DHA  C E+   +   I  + +   V +++R  +H+G  +  VLG  +  FD+  +DV +   M      G++ ++K+T   L   Y+V+ G
Sbjct:  163 FQSRKLERLYQRYF---FRLNQ-SSLTMLMGVLVIVCGIMLTFHCVHAAPHVAYSSA--LSVAMALFMALMVV------CNRNGFHQDYMWMVSY-LVIGVLVSVQ-VFGVLMVAPRS-ASEGIWWSVFFIYIIYTLLPVR---MRAAVLSGAVLSIIHVVTTWQINQEDKFL---WKQVSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ-----CTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLQYLNGDYEVEPG 565          

HSP 2 Score: 93.5893 bits (231), Expect = 2.393e-18
Identity = 85/336 (25.30%), Postives = 153/336 (45.54%), Query Frame = 3
Query: 2826 CPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGT-------VICTCVIIFGTHELI--------------FTEFSKT-----YRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLF--SCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGI-DPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNF 3746
            CP P Y  YS +   L   V L +    K+ ++L         V    V +F   +L               +T F++T     Y    V ++ ++ ++  +F   L L   ++ +T  RL F W+++   ++EE  +L     R++  +LPK V +H+L   R    L+  SCE   +   S+S  S   V ++  ++    +R+LN+++  FD+++    Y  + KI+T G T   A G+ D  +  E     + L    +R  E +K I  EH+  N    F ++IG+++    +GV+G   P + +WG     A+ +   G  D+I VT++ 
Sbjct:  843 CPFPEYFSYSVLLTLLACSVFLQISSIGKLTLMLLIQFTFLLLVEWPQVALFDNADLFVTSNAIDLNETVFQWTSFNETTNQCPYAVTKVSLRVMTPVILTVFVLALYLHAQQVEST-ARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDSTYDKEGRSHITALADYSMRLREQMKYI-NEHSFNN----FQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDL 1172          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Planmine SMEST
Match: SMESG000023584.1 (SMESG000023584.1)

HSP 1 Score: 4507.98 bits (11691), Expect = 0.000e+0
Identity = 2426/2428 (99.92%), Postives = 2426/2428 (99.92%), Query Frame = 3
Query:   90 MSYTAIPPQDRALKSSCNGYVKRSTLRAERGSCLKSPASLQRRTSGPAIPNSLRKTAPEHQEIYEGFTFLDEQRRKTTDFCPIICCSQLIDNYLSTDEWCNFFKCGSESINPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFXXXXXXXXXXXXXXXXKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYIXXXXXXXGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETITKIYKAYPLLTNLLDGNESGKYSQKINQNSFSQSQTHKSLDYSDTNEKGCEGHNXXXXXXXXXXXXTNQTITKTSAFSKLAQTAKFNANIPYYFXXXXXXXXXXXXXXXXXXXIGGAIVSSNIHNVTGSPVFHGTTKSSASWKSTLKSQFTQSLIGSYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTXXXXXXXXXXXXWIGXXXXXXXXXKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKXXXXXXXXXXXSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPGTITFRVFMLREKTLSHGSMIPNNLVPICSDESIISIGGRRNSLTVVMASGEPINHYMMNSTPVVPHNATASLMSSNPLVMPRNGAIPPGMSPXXXXXXXXXXGLFSITPITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLGSSSNPQPIPQILPQKSIALAHNSNFMKSPQEPMNRKSILEARPKIHHYRNLATELPDTVIPPSPPPHRKIYPDTVNTGLVQSGLPVIVPQTDQFVHCQLEHQTPREKYLVRDTNQMTQSAISPPKERNTRSTKCITPSSSMDSFLELEKACTTNPRTKSANYSIPPNERLSLIPESYKLVPETDLIEDESYHNAEDIASVDIMTTSDDRIFDTDQADIMSHHNPMYTDNEYESMAESQANLLDPIEEIRRSRLISKKQIGSDYGSGIADKLLEHKLECIXXXXXXXXXXXXXXXVINGTSFDFPDYRRPASPSGGINGDDSDHLXXXXXXXXXXXXXXXIAAHRSGGATSSDESGKKESNNNCNKILEISQASFSNGNQISVTEDISNGEHGVLAIHCGIANRDSANKGYDNGSSCMSLVTDLGWTSYDDEDMYSDYPGYAGRYKLNGDQNNKNRKRSDWVSKWSDSNDLLSSNVQGXXXXXXXXCIRFHSDLISDVSENPLVSDLETETDCDFKSSDPAIGSMVNENRINSYYKFPVNNILNPEFYGNNQYKSDKPFDDQYSKGDINNRMFAAHPWIDSSHINKVRNENDIYSLATSSRGEDLXXXXXXXXXXXGQEQNRTTKLPDIAPVRMPDFGDSHMGFRMSRDVVKPTVASRFAKKHGRYISSSPERSDYDNVSGRNSLQDSGNHIPAAISSRNSDMGRYNYGDDSDALSGYVGDVASSVYDSDEYDEAPGKRFTQLYLNYDVDNEDXXXXXXXXXXXXXXXHRPSEPQLQKRSQNSSGSLNGKRSDYDNLDSDKLSDIYSRNDKKKKYLKTQPNIKSNEDYQQQIAEEARRISLVFQNQWTTEKKAPITIEPKLGNNKKSDCKHRIKSFFVNSQRETSVESELSSMNIHSNGILESNHIPYDKGAKSRSTDCLLTCTSTVSNDCCNDKLENELLKQKSLDDYNRGLSKIIQRAERVRSLLPTELHSYILPGCFXXXXXXXXXXXXPIRXXXXXXXXXXXXRHNERQYFSDEERSNQHQV 7373
            MSYTAIPPQDRALKSSCNGYVKRSTLRAERGSCLKSPASLQRRTSGPAIPNSLRKTAPEHQEIYEGFTFLDEQRRKTTDFCPIICCSQLIDNYLSTDEWCNFFKCGSESINPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFLCMSHSIISILLIVLSKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYISMSMSSSGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETITKIYKAYPLLTNLLDGNESGKYSQKINQNSFSQSQTHKSLDYSDTNEKGCEGHNSRSGQSDSLSSSTNQTITKTSAFSKLAQTAKFNANIPYYFLTDDSFLLSSPDDDRLLLDIGGAIVSSNIHNVTGSPVFHGTTKSSASWKSTLKSQFTQSLIGSYQIDEDDISLKKTSEIDLSISRVRN FLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTVMLLLMFLVVFMWIGLLLLLILLIKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKQQQQTLPQQQQSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPGTITFRVFMLREKTLSHGSMIPNNLVPICSDESIISIGGRRNSLTVVMASGEPINHYMMNSTPVVPHNATASLMSSNPLVMPRNGAIPPGMSPNAQNYNNNSNGLFSITPITSLSNLPSNINSNSPLPSNISSIIPAVNPPANNPSLGSSSNPQPIPQILPQKSIALAHNSNFMKSPQEPMNRKSILEARPKIHHYRNLATELPDTVIPPSPPPHRKIYPDTVNTGLVQSGLPVIVPQTDQFVHCQLEHQTPREKYLVRDTNQMTQSAISPPKERNTRSTKCITPSSSMDSFLELEKACTTNPRTKSANYSIPPNERLSLIPESYKLVPETDLIEDESYHNAEDIASVDIMTTSDDRIFDTDQADIMSHHNPMYTDNEYESMAESQANLLDPIEEIRRSRLISKKQIGSDYGSGIADKLLEHKLECINSRGNTNSSNSFGSNVINGTSFDFPDYRRPASPSGGINGDDSDHLSKRNRNSSNSRDSSSIAAHRSGGATSSDESGKKESNNNCNKILEISQASFSNGNQISVTEDISNGEHGVLAIHCGIANRDSANKGYDNGSSCMSLVTDLGWTSYDDEDMYSDYPGYAGRYKLNGDQNNKNRKRSDWVSKWSDSNDLLSSNVQGDDDDSDIDCIRFHSDLISDVSENPLVSDLETETDCDFKSSDPAIGSMVNENRINSYYKFPVNNILNPEFYGNNQYKSDKPFDDQYSKGDINNRMFAAHPWIDSSHINKVRNENDIYSLATSSRGEDLSSTSSKTPSKSGQEQNRTTKLPDIAPVRMPDFGDSHMGFRMSRDVVKPTVASRFAKKHGRYISSSPERSDYDNVSGRNSLQDSGNHIPA ISSRNSDMGRYNYGDDSDALSGYVGDVASSVYDSDEYDEAPGKRFTQLYLNYDVDNEDPMAPFFPRLPPPQDFHRPSEPQLQKRSQNSSGSLNGKRSDYDNLDSDKLSDIYSRNDKKKKYLKTQPNIKSNEDYQQQIAEEARRISLVFQNQWTTEKKAPITIEPKLGNNKKSDCKHRIKSFFVNSQRETSVESELSSMNIHSNGILESNHIPYDKGAKSRSTDCLLTCTSTVSNDCCNDKLENELLKQKSLDDYNRGLSKIIQRAERVRSLLPTELHSYILPGCFSSSSLNSSGKSSPIRKKLSKNVKSVNSRHNERQYFSDEERSNQHQV
Sbjct:    1 MSYTAIPPQDRALKSSCNGYVKRSTLRAERGSCLKSPASLQRRTSGPAIPNSLRKTAPEHQEIYEGFTFLDEQRRKTTDFCPIICCSQLIDNYLSTDEWCNFFKCGSESINPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLVIGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHMAFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCFYPVTFYTLLALTIFLCMSHSIISILLIVLSKKPVFSSKHWAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYISMSMSSSGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETITKIYKAYPLLTNLLDGNESGKYSQKINQNSFSQSQTHKSLDYSDTNEKGCEGHNSRSGQSDSLSSSTNQTITKTSAFSKLAQTAKFNANIPYYFLTDDSFLLSSPDDDRLLLDIGGAIVSSNIHNVTGSPVFHGTTKSSASWKSTLKSQFTQSLIGSYQIDEDDISLKKTSEIDLSISRVRNAFLDSTMESKFQNQSEKYMGFALLISLSTVLFITSLHALMLAKTVMLLLMFLVVFMWIGLLLLLILLIKMKFISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKQQQQTLPQQQQSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVICTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPPGQWVPGTITFRVFMLREKTLSHGSMIPNNLVPICSDESIISIGGRRNSLTVVMASGEPINHYMMNSTPVVPHNATASLMSSNPLVMPRNGAIPPGMSPNAQNYNNNSNGLFSITPITSLSNLPSNINSNSPLPSNISSIIPAVNPPANNPSLGSSSNPQPIPQILPQKSIALAHNSNFMKSPQEPMNRKSILEARPKIHHYRNLATELPDTVIPPSPPPHRKIYPDTVNTGLVQSGLPVIVPQTDQFVHCQLEHQTPREKYLVRDTNQMTQSAISPPKERNTRSTKCITPSSSMDSFLELEKACTTNPRTKSANYSIPPNERLSLIPESYKLVPETDLIEDESYHNAEDIASVDIMTTSDDRIFDTDQADIMSHHNPMYTDNEYESMAESQANLLDPIEEIRRSRLISKKQIGSDYGSGIADKLLEHKLECINSRGNTNSSNSFGSNVINGTSFDFPDYRRPASPSGGINGDDSDHLSKRNRNSSNSRDSSSIAAHRSGGATSSDESGKKESNNNCNKILEISQASFSNGNQISVTEDISNGEHGVLAIHCGIANRDSANKGYDNGSSCMSLVTDLGWTSYDDEDMYSDYPGYAGRYKLNGDQNNKNRKRSDWVSKWSDSNDLLSSNVQGDDDDSDIDCIRFHSDLISDVSENPLVSDLETETDCDFKSSDPAIGSMVNENRINSYYKFPVNNILNPEFYGNNQYKSDKPFDDQYSKGDINNRMFAAHPWIDSSHINKVRNENDIYSLATSSRGEDLSSTSSKTPSKSGQEQNRTTKLPDIAPVRMPDFGDSHMGFRMSRDVVKPTVASRFAKKHGRYISSSPERSDYDNVSGRNSLQDSGNHIPAVISSRNSDMGRYNYGDDSDALSGYVGDVASSVYDSDEYDEAPGKRFTQLYLNYDVDNEDPMAPFFPRLPPPQDFHRPSEPQLQKRSQNSSGSLNGKRSDYDNLDSDKLSDIYSRNDKKKKYLKTQPNIKSNEDYQQQIAEEARRISLVFQNQWTTEKKAPITIEPKLGNNKKSDCKHRIKSFFVNSQRETSVESELSSMNIHSNGILESNHIPYDKGAKSRSTDCLLTCTSTVSNDCCNDKLENELLKQKSLDDYNRGLSKIIQRAERVRSLLPTELHSYILPGCFSSSSLNSSGKSSPIRKKLSKNVKSVNSRHNERQYFSDEERSNQHQV 2428          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Planmine SMEST
Match: SMESG000048844.1 (SMESG000048844.1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.514e-18
Identity = 54/169 (31.95%), Postives = 83/169 (49.11%), Query Frame = 3
Query: 1218 LRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDL 1724
              NVS +  +I G +  +         +   V L+N+LF+RFD L     C ++    D Y  +AG P  R DHA SC E+   +   IKQ     +  +++R  VHTG    A++G  R  FD+  +DV I   M     PG+V +S+S Y+ +   Y V+ G  L++
Sbjct:  320 FENVSILFADIVGFTNMSSNKT-----APQVVTLLNDLFNRFDELCNITNCEKLGTLGDCYYCVAGCPLPRPDHAVSCIEMGLGMCRIIKQFNHDHKENVNMRVGVHTGRVNAAIIGKQRFRFDVYSNDVIIANTMESSGKPGQVHISQSVYELIRHAYNVEPGDDLEI 483          

HSP 2 Score: 56.225 bits (134), Expect = 3.976e-7
Identity = 55/285 (19.30%), Postives = 125/285 (43.86%), Query Frame = 3
Query: 2991 SKTYRSDGVPIKYISAIVSQIFFAILVLWKSRILNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSRNYMNLFSCEYK----TIGVLSVSIPSWCPVGVKEPSDVASN-IRVLNQLLITFDDVMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAEMLKRIVQEHNSKN--PENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFGATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQL 3824
            SK + +D +  +Y    +   F  ++ L + R  N   R+ F    +  + REE  + + +   ++  ++PK+V  +        +   +  Y       GV+   I ++     +E      N +++L+ ++  FD ++ + +Y+ + KI+T  +    A G++    IE + ++   +  L+  A  +++I+   N       ++F ++IG +     +G++G   P + +WG+    ++ +   G+  +I V      E+ P   F F   G + V   G +
Sbjct:  809 SKKFYNDILLREYFYQYLFS-FIIMIALIRERERNL--RIWFYVSREAEIGREEALRAMQSSQELLYNIIPKYVFDYVRLRGGENLECANFNYALAVPRAGVVFACISNFFSKYYREDYKGGGNALKLLHNIICKFDQILMNKEYKDVEKIKTINDCYMLASGLNAS-EIEFNENKHEHLIALMNYAFHMQKILGNFNEYYIIGSDKFEIKIGYNFGPVTAGIIGSTKPMYDIWGDTVNVSSRMYSTGKHSEIQVPHYVAEELKPY--FLFKYRGIIFVKGKGDM 1087          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Planmine SMEST
Match: SMESG000050966.1 (SMESG000050966.1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.711e-18
Identity = 67/261 (25.67%), Postives = 114/261 (43.68%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLL-------SCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRL 1718
            +  L G  +LF    L G  +        ++AFL          +N  A  K+D  +         ++P  +  E  +SI  ++L  +L      +NVS +  +I G +  +         +   V L+N+L++RFD  G+ + C ++    D Y  ++G P  R DHA  C E+   +   I       +  +++R  VH+G    A++GN R  FD+  +DV I   +     PGKV +SK T+  +   Y    G +L
Sbjct:  192 YYMLIGQIILFFMVYLTGLYLRIFNSIRRKSAFL-------KLAQNAQAKMKMDSAIKVQIYWIEAIMPAAVRGEFLESIRSKDLF-NLGYCKQFKNVSILFADIVGFTAMSSNKT-----AKQLVYLLNDLYNRFDDFGKIMNCEKIATLGDCYYCVSGCPVPRSDHALCCVEMGLGMCKMILAFNRLHKEEVNMRVGVHSGRVIAAIIGNLRFRFDVYSNDVSIANALESSGKPGKVHISKKTFKLVCHAYTFIEGEKL 439          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Planmine SMEST
Match: SMESG000009036.1 (SMESG000009036.1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.192e-17
Identity = 53/197 (26.90%), Postives = 101/197 (51.27%), Query Frame = 3
Query: 1143 MPILAELKQSIMLRELHGHLPSVVHLRN---VSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDL 1724
            MP  + +K+  + R     + S+V+ +N   VS +  +I G ++ +         ++  V L+N+L++RFD+ G++  C ++    D Y  ++G P  R+DHA +C E+   +   I +     +  +++R  +H+G    A++GN R  FD+  +DV I   +     PG V +S+ TY  +   Y V+ G  L++
Sbjct:  251 MP--SSVKEQFLKRIRDNDMFSLVYCQNFDNVSILFADIVGFTKMSANKT-----AAKLVYLLNDLYNRFDVQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAINCVEMGLGMCRIIMKFNKDHKEKVNMRVGIHSGRVIAAIIGNHRFRFDVFSNDVVIANSLESSGKPGLVHISEDTYVLVRHAYAVNEGEALEI 440          
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Planmine SMEST
Match: SMESG000050971.1 (SMESG000050971.1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.542e-17
Identity = 61/254 (24.02%), Postives = 114/254 (44.88%), Query Frame = 3
Query:  957 WAALSGNWLLFIPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVVPMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNGISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDHAKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFDLLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRL 1718
            +  L    LLF    L+G  + +      ++AFL   +   + ++ + A E     +  ++P  +  E  Q++  ++   +L      ++VS +  +I G +  +         +   V L+N+L++RFD  G  + C ++    D Y  ++G P  R DHA  C E+   +   I       +  +++R  VH+G    A++GN R  FD+  +DV I   +     PGKV +S+ T+  +   Y    G +L
Sbjct:  168 YNLLVAECLLFFAVYLVGLYLRFFNSIRRKSAFLKLAQNAQAKMKMESAIEVQIYWIEAIMPSAVKTEFLQNVRHKDFF-NLVYCRQFKDVSILFADIVGFTAMSSNKT-----AKQLVYLLNDLYNRFDDFGNIMNCEKIATLGDCYYCVSGCPVPRSDHALCCVEMGLGMCKMIMTFNKVHKEEVNMRVGVHSGRVIAAIIGNLRFRFDVYSNDVSIANALESSGKPGKVHISEKTFKLVCHAYTFVEGEKL 415          
The following BLAST results are available for this feature:
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADCY13.201e-2824.95adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY16.863e-2630.71adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY16.863e-2630.71adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY65.998e-2426.96adenylate cyclase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY67.148e-2426.96adenylate cyclase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acy-23.327e-1726.36Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:O16... [more]
acy-43.258e-1625.82Adenylate cyclase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
acy-16.819e-1428.65Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:Q19... [more]
gcy-282.822e-1030.15Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-283.257e-1030.15Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rut9.186e-3827.60gene:FBgn0003301 transcript:FBtr0333657[more]
rut1.264e-3727.60gene:FBgn0003301 transcript:FBtr0333656[more]
rut1.409e-3727.60gene:FBgn0003301 transcript:FBtr0305581[more]
rut1.498e-3727.60gene:FBgn0003301 transcript:FBtr0073992[more]
rut1.773e-3727.60gene:FBgn0003301 transcript:FBtr0333655[more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy1a2.105e-2727.39adenylate cyclase 1a [Source:ZFIN;Acc:ZDB-GENE-070... [more]
adcy6a2.200e-2725.06adenylate cyclase 6a [Source:ZFIN;Acc:ZDB-GENE-060... [more]
adcy6a2.200e-2725.06adenylate cyclase 6a [Source:ZFIN;Acc:ZDB-GENE-060... [more]
adcy6a2.397e-2724.36adenylate cyclase 6a [Source:ZFIN;Acc:ZDB-GENE-060... [more]
adcy56.035e-2725.52adenylate cyclase 5 [Source:ZFIN;Acc:ZDB-GENE-0811... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADCY17.999e-3026.02adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
ADCY18.947e-3026.02adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
ADCY11.202e-2826.82adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
ADCY69.081e-2624.48adenylate cyclase 6 [Source:NCBI gene;Acc:10049393... [more]
ADCY62.621e-2524.48adenylate cyclase 6 [Source:NCBI gene;Acc:10049393... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adcy13.368e-2730.42adenylate cyclase 1 [Source:MGI Symbol;Acc:MGI:996... [more]
Adcy51.139e-2326.06adenylate cyclase 5 [Source:MGI Symbol;Acc:MGI:996... [more]
Adcy62.623e-2327.27adenylate cyclase 6 [Source:MGI Symbol;Acc:MGI:879... [more]
Adcy22.815e-2326.90adenylate cyclase 2 [Source:MGI Symbol;Acc:MGI:996... [more]
Adcy89.763e-2328.92adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:134... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P32870|CYA1_DROME1.502e-3627.60Ca(2+)/calmodulin-responsive adenylate cyclase OS=... [more]
sp|Q08828|ADCY1_HUMAN1.537e-2724.95Adenylate cyclase type 1 OS=Homo sapiens OX=9606 G... [more]
sp|P19754|ADCY1_BOVIN2.050e-2630.42Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=... [more]
sp|O88444|ADCY1_MOUSE2.356e-2630.42Adenylate cyclase type 1 OS=Mus musculus OX=10090 ... [more]
sp|O43306|ADCY6_HUMAN2.880e-2326.96Adenylate cyclase type 6 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183NSZ14.466e-4033.45Guanylate cyclase domain-containing protein OS=Sch... [more]
A0A183LER02.123e-3933.92Guanylate cyclase domain-containing protein OS=Sch... [more]
A0A0X3PL391.288e-3831.13Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A267EH022.195e-3828.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FGN43.223e-3828.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy51.717e-2624.01adenylate cyclase 5 [Source:NCBI gene;Acc:10302641... [more]
adcy52.875e-2624.01adenylate cyclase 5 [Source:NCBI gene;Acc:10302641... [more]
adcy6b1.707e-2424.31adenylate cyclase type 6-like [Source:NCBI gene;Ac... [more]
adcy6b1.707e-2424.31adenylate cyclase type 6-like [Source:NCBI gene;Ac... [more]
adcy6b1.707e-2424.31adenylate cyclase type 6-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADCY15.413e-3030.34adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ENSPMAT00000008766.13.630e-2527.60pep scaffold:Pmarinus_7.0:GL476654:390837:418056:1... [more]
ENSPMAT00000006025.14.763e-2528.97pep scaffold:Pmarinus_7.0:GL480980:9262:24123:1 ge... [more]
adcy2a8.405e-2324.93adenylate cyclase 2a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
adcy97.195e-2138.35adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-0502... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458682.294e-2530.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428104.560e-2323.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470102.576e-1627.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459331.544e-923.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470833.557e-923.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy1b1.372e-2925.38adenylate cyclase type 1 [Source:NCBI gene;Acc:101... [more]
adcy1b1.828e-2925.38adenylate cyclase type 1 [Source:NCBI gene;Acc:101... [more]
adcy1a5.694e-2923.68adenylate cyclase type 1 [Source:NCBI gene;Acc:101... [more]
adcy1a7.554e-2923.68adenylate cyclase type 1 [Source:NCBI gene;Acc:101... [more]
adcy6a5.367e-2825.17adenylate cyclase 6 [Source:NCBI gene;Acc:10115810... [more]
back to top
BLAST of Ca(2 )/calmodulin-responsive adenylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023584.10.000e+099.92SMESG000023584.1[more]
SMESG000048844.12.514e-1831.95SMESG000048844.1[more]
SMESG000050966.12.711e-1825.67SMESG000050966.1[more]
SMESG000009036.12.192e-1726.90SMESG000009036.1[more]
SMESG000050971.12.542e-1724.02SMESG000050971.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025596 ID=SMED30025596|Name=Ca(2 )/calmodulin-responsive adenylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=7516bp
CTTATATGAAGTTCGAGTGGGCATACACAAATTAGTTGAGAAATTATGAA
ATAAATTTCAATTCTAGCTCTGAGTTTCTATCGGCAATAATGAGTTATAC
TGCAATCCCACCACAAGACAGAGCTCTCAAATCGTCATGCAATGGATATG
TTAAACGTTCAACGCTACGTGCCGAAAGAGGTTCATGCTTGAAGTCACCA
GCTTCTCTTCAAAGACGAACATCAGGACCAGCTATACCTAACTCCTTACG
AAAAACAGCTCCAGAACACCAGGAGATATACGAAGGATTCACATTTCTCG
ATGAGCAGCGTAGAAAAACTACTGATTTTTGTCCTATAATTTGTTGCTCG
CAATTGATTGACAATTATCTGTCGACAGACGAGTGGTGCAATTTCTTTAA
ATGCGGCTCCGAATCCATTAATCCGTTTGCATTTAAAAACATCAATTTAG
AACGCATTTACGCCAAATACTTTTCTCTTGTTTACCGATCTACACAACTG
GCCAGATTTTTTTTACTGATTGGATTATTTTGTTTAGTTATTGGGATAAT
TGAAATGATACCAACATTTTTATATCCGCCAAATTATGGTACAAATGTTC
GCTGCTGGATTTCTATTTCCATGGCCATATTGACAATTATTCCGTTGGTC
CACATTAATTGTCAGCAGTGCATGAGGCCTCAGCATATGGCTTTTCTGAA
ATTTTCTGGTTTCATACTCTGCTGTGCTATACTTGTTTCTGTTTCTCCAA
TATGGGGCAATTTCAAAATAGATTCGGAATCTTTCATAACAGTAGGTCTT
TGGGAAACAATTTGGTTGATCATAACGATATCATGCTTTTACCCGGTTAC
ATTTTATACGTTGTTAGCATTGACAATATTTCTCTGTATGAGCCATTCGA
TTATTAGTATTCTATTGATAGTATTATCAAAAAAACCGGTGTTTTCCAGT
AAGCATTGGGCAGCTCTAAGTGGAAACTGGCTATTATTTATTCCTTCGAT
ATTGATCGGCTCTGTTATTAGTTATCTTCAACAGAAAATGCTTCGAAATG
CTTTTCTCTACGCTCGAGAATTCCTTAACAGTTGTGTTGAAAACAAAATG
GCCAACGAAAAACTTGATCGATTGCTGTCATGTGTCGTGCCTATGCCTAT
TTTAGCCGAATTAAAACAGAGCATAATGTTAAGAGAGCTGCATGGTCATT
TACCTTCGGTTGTTCATCTTCGGAATGTAAGTTTCATAAATGTCGAGATA
TGTGGTTTGAGTAGAGGAGCCAGAGGAGATGGAAATGGAATTTCATTTTC
ATCTGATGCTGTCAAATTAATGAATGAACTTTTCTCTCGATTTGATATGC
TTGGTCAAGAGTTAGGATGCTATCAAGTTCGAGTGCATCCGGATGATTAT
CTAAGTCTTGCTGGATACCCTGAAACAAGAGTCGATCATGCCAAGTCCTG
TACTGAATTAGCATTTAGAATTCAACATACTATCAAACAACTTTGTGATA
GCGCTGAGGTGATGTTGGATGTGCGGACGGTGGTTCATACTGGTGTTACG
TATGGGGCAGTGTTGGGCAATTCTCGAATGGTTTTCGATCTTCTTGGTGA
TGATGTTCGAATATTACGATTTATGCTTGGAATTGCAGCACCTGGAAAAG
TGATGGTGTCCAAGTCTACATATGACCAATTACCAGAAGGGTATAAAGTA
GATCTTGGTCCTAGATTAGATCTTCCATATATATCAATGTCTATGTCTTC
GTCTGGAGATTCAAATAGAATGGATACTTACTATCTTCGACCAAAACATA
TAAAGCAAAATTCCATTCTCGCCACATCAGATTTGATCGTTTCCGATACA
TCTGACAGCCAACACGATGAAACAATTACGAAAATTTATAAAGCATATCC
GTTGTTGACTAATTTATTGGATGGAAATGAAAGCGGGAAATATTCTCAAA
AGATAAATCAAAATAGTTTTTCACAATCACAGACTCACAAATCTTTGGAT
TACAGCGATACCAATGAAAAAGGCTGTGAAGGTCATAATTCTCGAAGTGG
ACAATCCGACTCGTTGTCTTCATCAACAAATCAAACAATTACTAAAACAT
CGGCGTTTTCTAAATTGGCGCAAACTGCGAAATTTAATGCTAACATACCG
TATTACTTTCTCACTGATGATAGTTTTTTGCTTTCATCGCCAGACGACGA
CAGGCTGTTGTTGGATATAGGAGGAGCAATAGTCAGTTCCAATATACATA
ATGTTACCGGTTCTCCAGTATTTCACGGAACGACTAAAAGCAGTGCATCA
TGGAAGTCTACCTTAAAAAGTCAATTTACTCAGAGTCTTATTGGAAGTTA
TCAAATAGATGAAGATGATATTTCATTGAAAAAAACCTCAGAAATAGATT
TATCCATATCTAGAGTTAGGAATACATTTTTAGATTCGACCATGGAATCA
AAGTTTCAAAACCAATCAGAGAAATATATGGGATTCGCATTATTAATCTC
TTTGTCCACGGTTCTATTTATCACCAGCCTTCACGCCCTTATGCTAGCCA
AAACTGTGATGCTTTTATTGATGTTTTTGGTGGTTTTTATGTGGATAGGT
CTATTACTCCTTCTCATCCTTCTTATCAAAATGAAATTCATTTCCGGACA
TATTGTCAGGTCTCACCTATGTTCTGTGATACTTCTTATAATCACGAGTT
TGGGAATATTTACCCTCATTGTGTCCAACTCGTTTTGCTGTATCAATTCC
CCACAGCTCAATGCAACATATAAACAACAACAACAAACACTACCACAACA
ACAACAATCTGATTCGCATTTGTTATGTCCGTTACCCGTGTATATTCCAT
ATTCCACAATTTGGGTTACTCTGCCTTTGATTGTAATGTTGGCCCTTCCA
GAAACGTTTAAAGTTGTGATAGTGCTTGGTACTGTAATTTGCACGTGCGT
CATTATATTCGGCACCCACGAATTGATATTCACAGAATTCAGTAAGACAT
ACAGATCCGACGGAGTGCCAATAAAGTACATTTCTGCTATTGTTTCTCAG
ATATTCTTTGCTATTCTTGTGTTATGGAAAAGCCGGATTCTGAATACGTT
CCGACGGTTGGTTTTCCAGTGGCAAATGAAGATGAATCTAAAGCGGGAAG
AGCACCATAAATTAATAGTTACAGTTGATAGAATGATCGATATTTTGCTG
CCAAAATTTGTAGTGTCGCACTATCTCAACCCCTCCAGGAATTATATGAA
TCTCTTTAGCTGTGAATATAAAACGATTGGGGTGCTCAGTGTTTCCATTC
CCTCTTGGTGTCCAGTTGGGGTGAAGGAACCGAGTGACGTTGCCTCCAAT
ATCAGAGTTCTGAACCAATTATTGATAACATTTGATGATGTGATGGAGAG
TTCAGATTATGAGGGAATCACAAAAATCCGAACCGCCGGTGAAACGGCAT
GGTATGCAATTGGCATTGATCCCGATCACCCAATCGAGAGTTCCGTTGAT
CGAAGCCGATTAATGACAAATTTACTACGAGGAGCTGAAATGTTGAAACG
CATAGTGCAAGAGCATAATTCCAAAAATCCAGAGAACCGATTTTTACTTA
GAATTGGTATTCACATGGCTGCCGGATTCTCCGGTGTTGTAGGAGGAAAT
AATCCAACATTCGGTGTTTGGGGAGAAGCTTATTTTGGAGCGACCATTGT
GCAAAGATGTGGCCAGTTAGATAAAATTCATGTCACAAGCAATTTTATGG
CAGAAATTGATCCTTCTTCGAAATTTGGTTTTTATGACGTCGGGACTTTA
ATAGTAAATCATGCTGGTCAGCTTATATCAGTACCACCGGGACAATGGGT
GCCGGGAACAATCACTTTCCGTGTATTTATGTTACGAGAGAAAACCCTTA
GTCATGGTTCAATGATTCCCAATAATCTTGTGCCAATATGTTCAGATGAA
TCAATAATATCAATTGGAGGACGCCGGAATTCTTTAACCGTTGTAATGGC
TTCTGGGGAACCAATAAATCATTATATGATGAATTCTACTCCAGTAGTGC
CACACAACGCAACAGCAAGTCTCATGTCTAGCAATCCGTTGGTAATGCCG
AGAAACGGTGCAATTCCACCTGGAATGTCACCTAACGCACAAAATTACAA
TAATAATTCCAATGGTTTATTCTCAATAACACCAATAACTTCTCTCTCAA
ATCTGCCCTCGAATATCAACTCGAATTCCCCATTGCCCTCAAATATATCC
AGCATAATTCCAGCGGTAAATCCTCCCGCCAATAATCCTTCACTCGGTTC
GTCTTCAAACCCTCAACCGATTCCTCAAATATTGCCACAGAAATCAATTG
CCCTCGCTCACAATTCGAATTTCATGAAATCTCCTCAAGAACCCATGAAT
CGTAAGTCGATTCTCGAAGCTCGACCAAAAATCCATCATTACCGTAATCT
GGCTACCGAGCTACCAGATACAGTAATCCCACCATCTCCACCACCACACA
GGAAAATTTATCCGGATACTGTGAATACGGGCCTGGTCCAATCAGGGTTA
CCGGTTATCGTTCCGCAAACGGATCAATTCGTACACTGCCAATTAGAGCA
TCAGACCCCCCGTGAAAAATATCTCGTTCGAGACACTAATCAAATGACAC
AATCCGCAATAAGTCCCCCCAAAGAAAGAAATACAAGATCCACCAAGTGC
ATTACTCCATCGTCATCTATGGACAGCTTCTTAGAACTAGAAAAGGCATG
CACAACCAATCCGAGAACAAAATCTGCAAATTATTCTATTCCACCTAATG
AAAGATTGAGCCTAATTCCCGAATCATACAAGTTGGTACCGGAAACAGAT
CTGATTGAAGACGAGTCATATCATAATGCCGAAGATATTGCAAGTGTGGA
CATCATGACCACTTCTGATGACAGGATTTTTGATACTGACCAGGCCGATA
TTATGAGCCATCATAATCCCATGTACACAGACAATGAATATGAATCAATG
GCGGAAAGTCAAGCCAATTTATTGGATCCAATAGAAGAAATACGGAGATC
AAGACTTATTAGTAAGAAACAAATAGGAAGTGATTACGGAAGTGGGATTG
CTGATAAATTACTGGAGCACAAGTTAGAGTGTATAAATTCCCGGGGCAAT
ACAAACAGTTCAAATTCATTTGGTTCAAATGTAATTAATGGAACATCTTT
TGATTTTCCTGATTATCGTCGACCGGCAAGTCCAAGTGGAGGGATTAATG
GGGATGACAGTGACCATTTATCAAAACGAAATCGAAATTCTTCTAATTCA
CGGGATAGCAGTTCTATAGCTGCTCACAGATCAGGAGGAGCAACATCGTC
AGATGAAAGTGGTAAAAAAGAATCAAATAATAATTGCAATAAAATTTTGG
AAATTTCTCAAGCCAGTTTCTCAAATGGAAACCAGATAAGTGTAACCGAA
GACATTTCCAATGGTGAACATGGCGTTCTTGCAATACATTGTGGCATAGC
CAATCGGGATTCGGCTAATAAAGGTTATGACAATGGCTCTTCCTGTATGA
GTCTCGTTACAGATCTCGGTTGGACGAGTTATGATGATGAAGATATGTAC
AGCGATTACCCAGGATATGCTGGCAGATATAAATTAAATGGGGATCAAAA
TAACAAAAACCGAAAAAGATCAGATTGGGTTTCAAAATGGTCAGATTCTA
ATGATCTTTTGAGCAGCAACGTCCAAGGTGATGACGACGATTCAGATATA
GATTGCATTCGATTTCACAGCGACCTTATTTCTGATGTCAGTGAAAATCC
TCTAGTCTCAGACTTGGAAACCGAAACTGACTGTGATTTTAAATCTTCTG
ATCCTGCAATTGGGTCCATGGTTAATGAAAATCGTATTAATTCCTATTAC
AAATTTCCTGTAAATAATATTCTTAACCCCGAATTTTATGGAAACAATCA
GTACAAATCAGATAAACCCTTTGACGACCAATATTCAAAAGGAGATATTA
ATAATCGAATGTTTGCGGCACATCCTTGGATTGATTCGTCTCATATCAAT
AAAGTTAGGAATGAAAATGACATATATTCACTAGCAACTTCCAGTCGTGG
AGAAGATCTTAGTTCTACTTCAAGTAAAACTCCTTCGAAATCAGGCCAGG
AACAAAATAGAACGACAAAATTACCAGATATTGCCCCAGTACGAATGCCT
GATTTTGGTGATTCTCACATGGGATTTCGAATGAGCAGAGATGTCGTCAA
GCCGACTGTTGCATCGAGATTTGCAAAGAAACACGGCAGATATATTAGTA
GTAGTCCAGAAAGATCTGACTACGATAATGTCAGTGGACGGAATTCCCTT
CAAGATAGTGGAAACCATATACCAGCAGCGATATCATCGAGAAACAGTGA
CATGGGACGATATAATTATGGGGATGACAGTGACGCATTGAGCGGTTATG
TTGGAGATGTGGCTTCATCTGTTTACGACAGTGATGAATATGACGAGGCA
CCAGGGAAAAGATTCACTCAGCTTTATTTGAATTATGATGTAGATAATGA
GGATCCTATGGCTCCTTTTTTCCCGAGATTACCGCCACCTCAGGATTTCC
ACAGACCATCAGAGCCACAGCTACAGAAAAGGAGTCAGAATAGCAGTGGA
AGTCTAAATGGTAAAAGATCTGATTACGACAATTTGGACAGTGATAAATT
GTCAGACATCTATTCAAGAAATGATAAAAAGAAGAAGTATCTAAAAACTC
AACCCAATATTAAAAGTAATGAAGATTATCAACAGCAAATTGCTGAAGAG
GCTCGGCGTATTAGTTTAGTTTTTCAAAATCAGTGGACGACCGAAAAAAA
AGCTCCTATTACAATTGAACCAAAACTCGGAAATAACAAAAAATCGGACT
GTAAACATCGTATTAAATCATTTTTTGTTAATTCACAGCGAGAAACATCT
GTGGAATCGGAATTGAGCTCTATGAATATCCATTCAAATGGAATCCTTGA
ATCTAATCATATTCCCTATGATAAAGGAGCAAAATCCCGAAGTACAGATT
GCTTATTAACTTGCACTTCGACAGTATCAAATGATTGCTGTAACGACAAA
TTAGAGAATGAACTGTTGAAACAAAAATCTCTGGATGATTACAATAGAGG
ATTATCGAAAATAATACAGCGAGCAGAAAGAGTTCGCAGTCTTTTACCAA
CTGAATTGCATTCATACATTTTACCGGGATGTTTCAGCAGCAGTTCTCTC
AATTCGTCCGGCAAATCCAGTCCAATCAGAAAAAAGCTATCAAAGAATGT
CAAATCAGTTAATAGTCGCCATAATGAGCGGCAATATTTTAGTGATGAAG
AAAGATCAAATCAGCACCAAGTCTGAATGCGGCCAAAACGATGCAAGAAA
ATTGGTATACATTTGTAAACAAACATCTATTATCAGTTAATTCAACTCAT
TTCGTTTTCCTATGAAAGGAGTAACTGTCATGTGTTGCTGCTAGTCGTCA
ATCTTTGTTGAAATGA
back to top

protein sequence of SMED30025596-orf-1

>SMED30025596-orf-1 ID=SMED30025596-orf-1|Name=SMED30025596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2429bp
MSYTAIPPQDRALKSSCNGYVKRSTLRAERGSCLKSPASLQRRTSGPAIP
NSLRKTAPEHQEIYEGFTFLDEQRRKTTDFCPIICCSQLIDNYLSTDEWC
NFFKCGSESINPFAFKNINLERIYAKYFSLVYRSTQLARFFLLIGLFCLV
IGIIEMIPTFLYPPNYGTNVRCWISISMAILTIIPLVHINCQQCMRPQHM
AFLKFSGFILCCAILVSVSPIWGNFKIDSESFITVGLWETIWLIITISCF
YPVTFYTLLALTIFLCMSHSIISILLIVLSKKPVFSSKHWAALSGNWLLF
IPSILIGSVISYLQQKMLRNAFLYAREFLNSCVENKMANEKLDRLLSCVV
PMPILAELKQSIMLRELHGHLPSVVHLRNVSFINVEICGLSRGARGDGNG
ISFSSDAVKLMNELFSRFDMLGQELGCYQVRVHPDDYLSLAGYPETRVDH
AKSCTELAFRIQHTIKQLCDSAEVMLDVRTVVHTGVTYGAVLGNSRMVFD
LLGDDVRILRFMLGIAAPGKVMVSKSTYDQLPEGYKVDLGPRLDLPYISM
SMSSSGDSNRMDTYYLRPKHIKQNSILATSDLIVSDTSDSQHDETITKIY
KAYPLLTNLLDGNESGKYSQKINQNSFSQSQTHKSLDYSDTNEKGCEGHN
SRSGQSDSLSSSTNQTITKTSAFSKLAQTAKFNANIPYYFLTDDSFLLSS
PDDDRLLLDIGGAIVSSNIHNVTGSPVFHGTTKSSASWKSTLKSQFTQSL
IGSYQIDEDDISLKKTSEIDLSISRVRNTFLDSTMESKFQNQSEKYMGFA
LLISLSTVLFITSLHALMLAKTVMLLLMFLVVFMWIGLLLLLILLIKMKF
ISGHIVRSHLCSVILLIITSLGIFTLIVSNSFCCINSPQLNATYKQQQQT
LPQQQQSDSHLLCPLPVYIPYSTIWVTLPLIVMLALPETFKVVIVLGTVI
CTCVIIFGTHELIFTEFSKTYRSDGVPIKYISAIVSQIFFAILVLWKSRI
LNTFRRLVFQWQMKMNLKREEHHKLIVTVDRMIDILLPKFVVSHYLNPSR
NYMNLFSCEYKTIGVLSVSIPSWCPVGVKEPSDVASNIRVLNQLLITFDD
VMESSDYEGITKIRTAGETAWYAIGIDPDHPIESSVDRSRLMTNLLRGAE
MLKRIVQEHNSKNPENRFLLRIGIHMAAGFSGVVGGNNPTFGVWGEAYFG
ATIVQRCGQLDKIHVTSNFMAEIDPSSKFGFYDVGTLIVNHAGQLISVPP
GQWVPGTITFRVFMLREKTLSHGSMIPNNLVPICSDESIISIGGRRNSLT
VVMASGEPINHYMMNSTPVVPHNATASLMSSNPLVMPRNGAIPPGMSPNA
QNYNNNSNGLFSITPITSLSNLPSNINSNSPLPSNISSIIPAVNPPANNP
SLGSSSNPQPIPQILPQKSIALAHNSNFMKSPQEPMNRKSILEARPKIHH
YRNLATELPDTVIPPSPPPHRKIYPDTVNTGLVQSGLPVIVPQTDQFVHC
QLEHQTPREKYLVRDTNQMTQSAISPPKERNTRSTKCITPSSSMDSFLEL
EKACTTNPRTKSANYSIPPNERLSLIPESYKLVPETDLIEDESYHNAEDI
ASVDIMTTSDDRIFDTDQADIMSHHNPMYTDNEYESMAESQANLLDPIEE
IRRSRLISKKQIGSDYGSGIADKLLEHKLECINSRGNTNSSNSFGSNVIN
GTSFDFPDYRRPASPSGGINGDDSDHLSKRNRNSSNSRDSSSIAAHRSGG
ATSSDESGKKESNNNCNKILEISQASFSNGNQISVTEDISNGEHGVLAIH
CGIANRDSANKGYDNGSSCMSLVTDLGWTSYDDEDMYSDYPGYAGRYKLN
GDQNNKNRKRSDWVSKWSDSNDLLSSNVQGDDDDSDIDCIRFHSDLISDV
SENPLVSDLETETDCDFKSSDPAIGSMVNENRINSYYKFPVNNILNPEFY
GNNQYKSDKPFDDQYSKGDINNRMFAAHPWIDSSHINKVRNENDIYSLAT
SSRGEDLSSTSSKTPSKSGQEQNRTTKLPDIAPVRMPDFGDSHMGFRMSR
DVVKPTVASRFAKKHGRYISSSPERSDYDNVSGRNSLQDSGNHIPAAISS
RNSDMGRYNYGDDSDALSGYVGDVASSVYDSDEYDEAPGKRFTQLYLNYD
VDNEDPMAPFFPRLPPPQDFHRPSEPQLQKRSQNSSGSLNGKRSDYDNLD
SDKLSDIYSRNDKKKKYLKTQPNIKSNEDYQQQIAEEARRISLVFQNQWT
TEKKAPITIEPKLGNNKKSDCKHRIKSFFVNSQRETSVESELSSMNIHSN
GILESNHIPYDKGAKSRSTDCLLTCTSTVSNDCCNDKLENELLKQKSLDD
YNRGLSKIIQRAERVRSLLPTELHSYILPGCFSSSSLNSSGKSSPIRKKL
SKNVKSVNSRHNERQYFSDEERSNQHQV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019774Aromatic-AA_hydroxylase_C
IPR001054A/G_cyclase
IPR032628AC_N
IPR029787Nucleotide_cyclase
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006171cAMP biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0016849phosphorus-oxygen lyase activity
GO:0000166nucleotide binding
GO:0004016adenylate cyclase activity
GO:0016829lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 337..541
e-value: 6.1E-4
score: -10.0
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 407..539
e-value: 1.3E-18
score: 67.3
coord: 1085..1239
e-value: 2.2E-11
score: 43.7
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 1064..1205
score: 14.908
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 381..513
score: 18.731
IPR032628Adenylate cyclase, N-terminalPFAMPF16214AC_Ncoord: 115..362
e-value: 3.0E-8
score: 33.2
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 1055..1248
e-value: 1.9E-16
score: 62.1
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 375..574
e-value: 6.2E-25
score: 89.7
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 1087..1246
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 378..540
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2000..2027
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2406..2428
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2073..2093
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 624..662
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1734..1762
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1716..1762
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2392..2428
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2171..2205
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2000..2028
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2177..2194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2064..2093
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 648..662
NoneNo IPR availablePANTHERPTHR45627FAMILY NOT NAMEDcoord: 101..1244
NoneNo IPR availableCDDcd07302CHDcoord: 406..533
e-value: 6.22403E-17
score: 78.775
NoneNo IPR availableTMHMMTMhelixcoord: 258..280
NoneNo IPR availableTMHMMTMhelixcoord: 974..996
NoneNo IPR availableTMHMMTMhelixcoord: 942..964
NoneNo IPR availableTMHMMTMhelixcoord: 915..937
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 859..878
NoneNo IPR availableTMHMMTMhelixcoord: 1172..1194
NoneNo IPR availableTMHMMTMhelixcoord: 798..820
NoneNo IPR availableTMHMMTMhelixcoord: 172..191
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 824..846
NoneNo IPR availableTMHMMTMhelixcoord: 232..251