hemipterous

Overview
Namehemipterous (AIP89945.1)
Smed IDSMED30025593
Length (bp)2604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of hemipterous (SMED30025593) t-SNE clustered cells

Violin plots show distribution of expression levels for hemipterous (SMED30025593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of hemipterous (SMED30025593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for hemipterous (SMED30025593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30025593SMESG000000893.1 dd_Smed_v4_5234_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30025593SMESG000000893.1 dd_Smed_v4_5234_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025593SMESG000000893.1 dd_Smed_v4_5234_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30025593SMESG000000893.1 dd_Smed_v4_5234_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hemipterous vs. Ensembl Human
Match: MAP2K7 (mitogen-activated protein kinase kinase 7 [Source:HGNC Symbol;Acc:HGNC:6847])

HSP 1 Score: 320.087 bits (819), Expect = 2.206e-100
Identity = 148/320 (46.25%), Postives = 218/320 (68.12%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + +    +D+  W++ V  K
Sbjct:   83 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAK 400          
BLAST of hemipterous vs. Ensembl Human
Match: MAP2K7 (mitogen-activated protein kinase kinase 7 [Source:HGNC Symbol;Acc:HGNC:6847])

HSP 1 Score: 319.701 bits (818), Expect = 5.073e-100
Identity = 148/320 (46.25%), Postives = 218/320 (68.12%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + +    +D+  W++ V  K
Sbjct:   99 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAK 416          
BLAST of hemipterous vs. Ensembl Human
Match: MAP2K7 (mitogen-activated protein kinase kinase 7 [Source:HGNC Symbol;Acc:HGNC:6847])

HSP 1 Score: 312.768 bits (800), Expect = 1.596e-97
Identity = 148/327 (45.26%), Postives = 218/327 (66.67%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSL-------VELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SL       VELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + +    +D+  W++ V  K
Sbjct:   83 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLPCPSPSQVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAK 407          
BLAST of hemipterous vs. Ensembl Human
Match: MAP2K6 (mitogen-activated protein kinase kinase 6 [Source:HGNC Symbol;Acc:HGNC:6846])

HSP 1 Score: 236.498 bits (602), Expect = 4.755e-70
Identity = 120/296 (40.54%), Postives = 181/296 (61.15%), Query Frame = 3
Query:  261 LTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIP-MAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFL---NCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPER----LNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            ++I N+    K D+ E    LG G  G V +MR   +PS   MAVK++R + +S +E KR+  DLD+  R  DCPF VT YG      +VWICME M T LDK  K +       PE ++GK++ +I+KAL++L +K  ++HRD+KPSN+L++  G+VK+CDFGIS  L DS+A +   GC  YMAPER    LN   Y V++D+WSLG++++ELAI +FP D   + F+ + ++++   P LP   +S  F  F S CL+K+   RP Y +L+   F+ +H  +  D+  + + +
Sbjct:   39 ISIGNQNFEVKADDLEPIMELGRGAYGVVEKMR--HVPSGQIMAVKRIRATVNS-QEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLI 331          
BLAST of hemipterous vs. Ensembl Human
Match: MAP2K4 (mitogen-activated protein kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6844])

HSP 1 Score: 235.728 bits (600), Expect = 5.919e-69
Identity = 132/316 (41.77%), Postives = 188/316 (59.49%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEK-ITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKF----LNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLP---EGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDI 1103
            +P+ +   +I  L+    + SG L I+ E+      ++ +    +G G  G+V +M  K    I MAVK++R S+   +E K++  DLDVV R  DCP+IV  YG      + WICME MST  DK  K+    L+   PE ++GK++ A +KAL +LK    I+HRDIKPSN+LL   G +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L ELA G+FP     S F+ + +++ G PP L    E  +S +F  FV+ CL KD + RPKY +L+   F  M+    +++
Sbjct:   64 NPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQI-MAVKRIR-STVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEV 377          
BLAST of hemipterous vs. Ensembl Celegans
Match: mek-1 (Dual specificity mitogen-activated protein kinase kinase mek-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21307])

HSP 1 Score: 284.263 bits (726), Expect = 3.627e-88
Identity = 148/318 (46.54%), Postives = 205/318 (64.47%), Query Frame = 3
Query:  183 SPHSPS-SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERL---NSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            +PH PS S +  N+  L  +  + SG LT+   +    + E +    +GHG+CG V + R K   S+ MAVK M R+S+S E + RI  DLDV+    DCP+IV C+G FI+  +V +CME M+TCLD+LL  +  P PE +IGK+S +IIKAL YLKTKH IMHRD+KPSN+LL   G +KLCDFGI+ +L +S A+S+Q GC  YM PERL   N  +YD+R+DVWS G++LVELA G++P  G  +EF++M++I++ +PP L    +S  F + V SCLQ+D   RP YD L+   F   H     D+  W+  V
Sbjct:   31 APHHPSRSSNDHNVKNLMKQAEENSGYLTLQGNRRKADLKELQFVEDIGHGSCGTVTKCRYK---SVIMAVKTMPRTSNSYEMS-RILMDLDVICLSFDCPYIVRCFGYFITNFDVRVCMECMATCLDRLLIRIKQPIPERIIGKLSVSIIKALHYLKTKHQIMHRDVKPSNILLDWSGVIKLCDFGIAGRLIESRAHSKQAGCPLYMGPERLDPNNFDSYDIRSDVWSFGVTLVELATGQYPYAG--TEFDMMSKILNDEPPRLDPAKFSPDFCQLVESCLQRDPTMRPNYDMLLQHPFVVHHEKIETDVEEWFADV 342          
BLAST of hemipterous vs. Ensembl Celegans
Match: jkk-1 (Dual specificity mitogen-activated protein kinase kinase jkk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDT6])

HSP 1 Score: 221.476 bits (563), Expect = 8.178e-64
Identity = 131/291 (45.02%), Postives = 177/291 (60.82%), Query Frame = 3
Query:  237 ELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCP----FPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERL---NSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARI--IDGKPPSLPEGV---YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFY 1073
            E ++KSG L I+ EK     +E  I S LG G+CG V    ++   S  MAVK M ++ +  E  KRI RD+ +++ C+  PFIVT YG F+  S V ICM+ MS C +KLL+ +       FPE+V G +  + I AL YLK KH I+HRDIKPSN+L  D G VKLCDFGIS  + DS+A+S+  GC  YMAPERL    +S YDVR+DVWSLG+++ +L  G +P      EF  +  I  ++   PSL E     +S  F +F+  CL+KD   RP+Y +L+  DFY
Sbjct:  100 EGYKKSGTLEIDGEKQVVDPNEIHIISLLGSGSCGVVESATVR---SKLMAVKTMYKNDNK-ENLKRILRDVRIMSMCNS-PFIVTSYGYFMFDSSVKICMQIMSACCEKLLRRIYHSKLDFFPEFVAGHIVYSAISALDYLKEKHSIIHRDIKPSNILFDDSGNVKLCDFGISGFMTDSMAHSKSAGCPPYMAPERLTIETNSKYDVRSDVWSLGITVYQLVTGLYPFPLNDMEFTTLTIIANLNLPSPSLREETKRSFSPLFIEFLDLCLRKDVRERPEYRQLMKHDFY 385          
BLAST of hemipterous vs. Ensembl Celegans
Match: mkk-4 (MAP kinase kinase mkk-4 [Source:UniProtKB/Swiss-Prot;Acc:Q20347])

HSP 1 Score: 215.312 bits (547), Expect = 2.556e-62
Identity = 115/267 (43.07%), Postives = 162/267 (60.67%), Query Frame = 3
Query:  315 SSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFL----NCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSS-TYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSL-PEG---VYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNV 1088
             ++G+G  G VY+MR K    + +AVK++R ++    E  R+ R+ D + +    P IV  YG   S  + WICME M   +D L K +    N    E V+G ++   + AL YLK +  I+HRD+KPSN+L+   G VKLCDFGI  +L++S A +   GC  Y+APER+ SS  YDVR+DVWSLG++L E+A GKFP     S F+ +A ++ G PP L P+     YS    KF+++CL KD  +RPKYD L S DFYR++ V
Sbjct:   70 GAIGNGNFGTVYKMRHKETGKL-IAVKRIRCNNIGHREQIRLLREHDTIVKSEKGPNIVKFYGAIFSEGDCWICMELMDISMDLLYKRVYMVKNSRLNENVVGHITVCTVDALDYLKKELKIIHRDVKPSNILVDGTGAVKLCDFGICGQLEESFAKTHDAGCQPYLAPERITSSDKYDVRSDVWSLGITLYEIATGKFPYQEWNSLFDQIATVVSGDPPILHPDSDDFHYSLPLVKFINTCLTKDRRHRPKYDTLKSFDFYRIYAV 335          
BLAST of hemipterous vs. Ensembl Celegans
Match: sek-1 (Dual specificity mitogen-activated protein kinase kinase sek-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDF7])

HSP 1 Score: 211.846 bits (538), Expect = 1.742e-61
Identity = 113/277 (40.79%), Postives = 169/277 (61.01%), Query Frame = 3
Query:  261 LTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKF---LNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST---YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLP-EGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADF 1070
            LT  +E+I     +  +   LG G  G V +M+  R   I MAVK+++ SS + +  K++  +LD   R   CP +V  YG      +VWICME M T LDK  +    +    PE  IGK++ ++I+ L ++K + +++HRD+KPSN+LL+  G+VK+CDFGIS  L +S+A + Q GC  YM PER++  T   YDVRADVWSLG++++E+A+G  P    K+ FE + +++   PP LP E  +S     FV  CL+KD+N RPKY +L++  F
Sbjct:   36 LTNESEEIEIAATDLVVLEELGKGGYGIVEKMQ-HRQSGIIMAVKRIK-SSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREGDVWICMEVMDTSLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPSNILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGETKSAYDVRADVWSLGITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERPKYPELLAMPF 310          
BLAST of hemipterous vs. Ensembl Celegans
Match: sek-1 (Dual specificity mitogen-activated protein kinase kinase sek-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDF7])

HSP 1 Score: 211.846 bits (538), Expect = 1.742e-61
Identity = 113/277 (40.79%), Postives = 169/277 (61.01%), Query Frame = 3
Query:  261 LTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKF---LNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST---YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLP-EGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADF 1070
            LT  +E+I     +  +   LG G  G V +M+  R   I MAVK+++ SS + +  K++  +LD   R   CP +V  YG      +VWICME M T LDK  +    +    PE  IGK++ ++I+ L ++K + +++HRD+KPSN+LL+  G+VK+CDFGIS  L +S+A + Q GC  YM PER++  T   YDVRADVWSLG++++E+A+G  P    K+ FE + +++   PP LP E  +S     FV  CL+KD+N RPKY +L++  F
Sbjct:   36 LTNESEEIEIAATDLVVLEELGKGGYGIVEKMQ-HRQSGIIMAVKRIK-SSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREGDVWICMEVMDTSLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPSNILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGETKSAYDVRADVWSLGITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERPKYPELLAMPF 310          
BLAST of hemipterous vs. Ensembl Fly
Match: hep (gene:FBgn0010303 transcript:FBtr0330397)

HSP 1 Score: 303.908 bits (777), Expect = 1.474e-93
Identity = 144/308 (46.75%), Postives = 207/308 (67.21%), Query Frame = 3
Query:  240 LFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN--SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV---YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVAN 1148
            + +++G L IN  +  T +++ +    LG+GT GNV +M      +I +AVKQMRR+ ++ EENKRI  DLDVV + HDC +IV C G F+   +VWICME MS C DKLLK    P PE ++GKV+ A + AL YLK KH ++HRD+KPSN+L+ +RG +KLCDFGIS +L DS AN+R  GC  YMAPER++     YD+RADVWSLG++LVELA  + P +G  ++FE++ +++D +PP LP G    +S+ F  FV  CL K+  +RPKY +L++  F R++    +D+  W++S+    + AN
Sbjct:  176 IMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTI-IAVKQMRRTGNA-EENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRAN 481          
BLAST of hemipterous vs. Ensembl Fly
Match: hep (gene:FBgn0010303 transcript:FBtr0073748)

HSP 1 Score: 303.908 bits (777), Expect = 1.474e-93
Identity = 144/308 (46.75%), Postives = 207/308 (67.21%), Query Frame = 3
Query:  240 LFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN--SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV---YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVAN 1148
            + +++G L IN  +  T +++ +    LG+GT GNV +M      +I +AVKQMRR+ ++ EENKRI  DLDVV + HDC +IV C G F+   +VWICME MS C DKLLK    P PE ++GKV+ A + AL YLK KH ++HRD+KPSN+L+ +RG +KLCDFGIS +L DS AN+R  GC  YMAPER++     YD+RADVWSLG++LVELA  + P +G  ++FE++ +++D +PP LP G    +S+ F  FV  CL K+  +RPKY +L++  F R++    +D+  W++S+    + AN
Sbjct:  176 IMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTI-IAVKQMRRTGNA-EENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRAN 481          
BLAST of hemipterous vs. Ensembl Fly
Match: hep (gene:FBgn0010303 transcript:FBtr0340303)

HSP 1 Score: 306.22 bits (783), Expect = 8.975e-89
Identity = 148/318 (46.54%), Postives = 211/318 (66.35%), Query Frame = 3
Query:  240 LFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN--SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV---YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANK-PTSINANA 1175
            + +++G L IN  +  T +++ +    LG+GT GNV +M      +I +AVKQMRR+ ++ EENKRI  DLDVV + HDC +IV C G F+   +VWICME MS C DKLLK    P PE ++GKV+ A + AL YLK KH ++HRD+KPSN+L+ +RG +KLCDFGIS +L DS AN+R  GC  YMAPER++     YD+RADVWSLG++LVELA  + P +G  ++FE++ +++D +PP LP G    +S+ F  FV  CL K+  +RPKY +L++  F R++    +D+  W++S+    + AN  PT   A A
Sbjct:  176 IMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTI-IAVKQMRRTGNA-EENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDPTLQRATA 491          
BLAST of hemipterous vs. Ensembl Fly
Match: hep (gene:FBgn0010303 transcript:FBtr0073747)

HSP 1 Score: 306.605 bits (784), Expect = 9.742e-89
Identity = 148/318 (46.54%), Postives = 211/318 (66.35%), Query Frame = 3
Query:  240 LFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN--SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV---YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANK-PTSINANA 1175
            + +++G L IN  +  T +++ +    LG+GT GNV +M      +I +AVKQMRR+ ++ EENKRI  DLDVV + HDC +IV C G F+   +VWICME MS C DKLLK    P PE ++GKV+ A + AL YLK KH ++HRD+KPSN+L+ +RG +KLCDFGIS +L DS AN+R  GC  YMAPER++     YD+RADVWSLG++LVELA  + P +G  ++FE++ +++D +PP LP G    +S+ F  FV  CL K+  +RPKY +L++  F R++    +D+  W++S+    + AN  PT   A A
Sbjct:  176 IMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTI-IAVKQMRRTGNA-EENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDPTLQRATA 491          
BLAST of hemipterous vs. Ensembl Fly
Match: hep (gene:FBgn0010303 transcript:FBtr0330396)

HSP 1 Score: 306.22 bits (783), Expect = 9.809e-89
Identity = 148/318 (46.54%), Postives = 211/318 (66.35%), Query Frame = 3
Query:  240 LFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN--SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV---YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANK-PTSINANA 1175
            + +++G L IN  +  T +++ +    LG+GT GNV +M      +I +AVKQMRR+ ++ EENKRI  DLDVV + HDC +IV C G F+   +VWICME MS C DKLLK    P PE ++GKV+ A + AL YLK KH ++HRD+KPSN+L+ +RG +KLCDFGIS +L DS AN+R  GC  YMAPER++     YD+RADVWSLG++LVELA  + P +G  ++FE++ +++D +PP LP G    +S+ F  FV  CL K+  +RPKY +L++  F R++    +D+  W++S+    + AN  PT   A A
Sbjct:  176 IMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTI-IAVKQMRRTGNA-EENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDPTLQRATA 491          
BLAST of hemipterous vs. Ensembl Zebrafish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 307.76 bits (787), Expect = 9.970e-96
Identity = 146/349 (41.83%), Postives = 224/349 (64.18%), Query Frame = 3
Query:   96 NRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            NRP +++T       P+T ++++            +++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ AI+ AL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP  + +S  F  FV  CL KD   RPKY KL+   F R + V  +D+  W+++V
Sbjct:   76 NRPRQMLTL------PTTPYNLQK-----------NLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVLPLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVSEVDVAGWFQAV 405          
BLAST of hemipterous vs. Ensembl Zebrafish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 308.145 bits (788), Expect = 1.008e-95
Identity = 146/349 (41.83%), Postives = 224/349 (64.18%), Query Frame = 3
Query:   96 NRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            NRP +++T       P+T ++++            +++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ AI+ AL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP  + +S  F  FV  CL KD   RPKY KL+   F R + V  +D+  W+++V
Sbjct:   85 NRPRQMLTL------PTTPYNLQK-----------NLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVLPLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVSEVDVAGWFQAV 414          
BLAST of hemipterous vs. Ensembl Zebrafish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 291.582 bits (745), Expect = 2.262e-89
Identity = 146/378 (38.62%), Postives = 224/378 (59.26%), Query Frame = 3
Query:   96 NRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCA-----------------------------IIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            NRP +++T       P+T ++++            +++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ A                             I+ AL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP  + +S  F  FV  CL KD   RPKY KL+   F R + V  +D+  W+++V
Sbjct:   69 NRPRQMLTL------PTTPYNLQK-----------NLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAVGLFINSLNSLIRYWLDMIASISLFLLLQIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVLPLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVSEVDVAGWFQAV 427          
BLAST of hemipterous vs. Ensembl Zebrafish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 292.352 bits (747), Expect = 2.397e-89
Identity = 146/378 (38.62%), Postives = 224/378 (59.26%), Query Frame = 3
Query:   96 NRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCA-----------------------------IIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            NRP +++T       P+T ++++            +++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ A                             I+ AL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP  + +S  F  FV  CL KD   RPKY KL+   F R + V  +D+  W+++V
Sbjct:   85 NRPRQMLTL------PTTPYNLQK-----------NLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAVGLFINSLNSLIRYWLDMIASISLFLLLQIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVLPLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVSEVDVAGWFQAV 443          
BLAST of hemipterous vs. Ensembl Zebrafish
Match: map2k4a (mitogen-activated protein kinase kinase 4a [Source:ZFIN;Acc:ZDB-GENE-060512-98])

HSP 1 Score: 238.81 bits (608), Expect = 2.789e-70
Identity = 135/330 (40.91%), Postives = 193/330 (58.48%), Query Frame = 3
Query:  216 NINELKDELFQKSGLLTINNEK-ITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKF----LNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSL---PEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWY-RSVNHKPIVANKPTSIN 1166
            +I  L+    + SG L I+ E+      ++ +    +G G  G+V +M  K    I MAVK++R S+    E K++  DLDVV R  DCP+IV  YG      + WICME MST  DK  K+    L+   PE ++GK++ A +KAL +LK    I+HRDIKPSN+LL  +G +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L ELA G+FP     S F+ + +++ G PP L    E  +S  F  FV+ CL KD + RPKY +L+   F +M+    +D+  +  R ++  P   + P  ++
Sbjct:   77 HIERLRTHSIESSGKLKISAEQHCDFTAEDLKDLGEIGRGAYGSVNKMAHKPSGQI-MAVKRIR-STVDEREQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSSLDEVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSSSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHAFIQMYEERSVDVATYVCRILDQMPPSPSSPMYVD 404          
BLAST of hemipterous vs. Ensembl Xenopus
Match: tbc1d23 (TBC1 domain family member 23 [Source:Xenbase;Acc:XB-GENE-5893467])

HSP 1 Score: 315.079 bits (806), Expect = 2.731e-98
Identity = 146/314 (46.50%), Postives = 211/314 (67.20%), Query Frame = 3
Query:  201 SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            S++ + I++   E+ +++G L I+ +K    +++ E    +G GTCG V++MR K+   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV CYG FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+ AL YLK KH ++HRD+KPSN+LL   G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F R +    +D+  W++ +
Sbjct:   99 SMESIEIDQKLQEIIKQTGYLVIDGQKYPADINDLENLGEIGSGTCGQVWKMRFKKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCYGTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIVNALYYLKEKHGVIHRDVKPSNILLDANGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNMGFSPLFQSFVKDCLTKDHRKRPKYNKLLEHPFLRRYETTEVDVALWFQEI 410          
BLAST of hemipterous vs. Ensembl Xenopus
Match: tbc1d23 (TBC1 domain family member 23 [Source:Xenbase;Acc:XB-GENE-5893467])

HSP 1 Score: 313.923 bits (803), Expect = 5.009e-98
Identity = 146/314 (46.50%), Postives = 211/314 (67.20%), Query Frame = 3
Query:  201 SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            S++ + I++   E+ +++G L I+ +K    +++ E    +G GTCG V++MR K+   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV CYG FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+ AL YLK KH ++HRD+KPSN+LL   G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F R +    +D+  W++ +
Sbjct:   90 SMESIEIDQKLQEIIKQTGYLVIDGQKYPADINDLENLGEIGSGTCGQVWKMRFKKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCYGTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIVNALYYLKEKHGVIHRDVKPSNILLDANGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNMGFSPLFQSFVKDCLTKDHRKRPKYNKLLEHPFLRRYETTEVDVALWFQEI 401          
BLAST of hemipterous vs. Ensembl Xenopus
Match: tbc1d23 (TBC1 domain family member 23 [Source:Xenbase;Acc:XB-GENE-5893467])

HSP 1 Score: 306.605 bits (784), Expect = 4.018e-95
Identity = 146/325 (44.92%), Postives = 211/325 (64.92%), Query Frame = 3
Query:  201 SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCA-----------IIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            S++ + I++   E+ +++G L I+ +K    +++ E    +G GTCG V++MR K+   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV CYG FI+ ++V+I ME M TC +KL K +  P PE ++GK++ A           I+ AL YLK KH ++HRD+KPSN+LL   G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F R +    +D+  W++ +
Sbjct:   83 SMESIEIDQKLQEIIKQTGYLVIDGQKYPADINDLENLGEIGSGTCGQVWKMRFKKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCYGTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAVSASSSLRDMLIVNALYYLKEKHGVIHRDVKPSNILLDANGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNMGFSPLFQSFVKDCLTKDHRKRPKYNKLLEHPFLRRYETTEVDVALWFQEI 405          
BLAST of hemipterous vs. Ensembl Xenopus
Match: tbc1d23 (TBC1 domain family member 23 [Source:Xenbase;Acc:XB-GENE-5893467])

HSP 1 Score: 306.605 bits (784), Expect = 5.631e-95
Identity = 146/325 (44.92%), Postives = 211/325 (64.92%), Query Frame = 3
Query:  201 SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCA-----------IIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            S++ + I++   E+ +++G L I+ +K    +++ E    +G GTCG V++MR K+   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV CYG FI+ ++V+I ME M TC +KL K +  P PE ++GK++ A           I+ AL YLK KH ++HRD+KPSN+LL   G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F R +    +D+  W++ +
Sbjct:   99 SMESIEIDQKLQEIIKQTGYLVIDGQKYPADINDLENLGEIGSGTCGQVWKMRFKKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCYGTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAVSASSSLRDMLIVNALYYLKEKHGVIHRDVKPSNILLDANGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNMGFSPLFQSFVKDCLTKDHRKRPKYNKLLEHPFLRRYETTEVDVALWFQEI 421          
BLAST of hemipterous vs. Ensembl Xenopus
Match: tbc1d23 (TBC1 domain family member 23 [Source:Xenbase;Acc:XB-GENE-5893467])

HSP 1 Score: 302.368 bits (773), Expect = 4.704e-93
Identity = 156/366 (42.62%), Postives = 223/366 (60.93%), Query Frame = 3
Query:   81 LSMHRNRPNKLITTNTRSCSPSTKFSIE---------NTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINN---EKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            +S  R RP  LIT +  + +PS + +++          +D     HSP ++       L    +    L  I     +K    +++ E    +G GTCG V++MR K+   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV CYG FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+ AL YLK KH ++HRD+KPSN+LL   G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F R +    +D+  W++ +
Sbjct:   32 ISPQRPRPIILITLSP-TPAPSQRAALQLPLANDGHSRSDAPSHHHSPLTVRPRTFLSLPQTNYLTISLFDIYGFALQKYPADINDLENLGEIGSGTCGQVWKMRFKKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCYGTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIVNALYYLKEKHGVIHRDVKPSNILLDANGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNMGFSPLFQSFVKDCLTKDHRKRPKYNKLLEHPFLRRYETTEVDVALWFQEI 394          
BLAST of hemipterous vs. Ensembl Mouse
Match: Map2k7 (mitogen-activated protein kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346871])

HSP 1 Score: 320.472 bits (820), Expect = 1.174e-101
Identity = 149/320 (46.56%), Postives = 219/320 (68.44%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   I +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + + +  +D+  W++ V  K
Sbjct:   10 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHI-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAK 327          
BLAST of hemipterous vs. Ensembl Mouse
Match: Map2k7 (mitogen-activated protein kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346871])

HSP 1 Score: 320.857 bits (821), Expect = 2.715e-101
Identity = 149/320 (46.56%), Postives = 219/320 (68.44%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   I +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + + +  +D+  W++ V  K
Sbjct:   10 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHI-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAK 327          
BLAST of hemipterous vs. Ensembl Mouse
Match: Map2k7 (mitogen-activated protein kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346871])

HSP 1 Score: 321.627 bits (823), Expect = 3.972e-101
Identity = 149/320 (46.56%), Postives = 219/320 (68.44%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   I +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + + +  +D+  W++ V  K
Sbjct:   83 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHI-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAK 400          
BLAST of hemipterous vs. Ensembl Mouse
Match: Map2k7 (mitogen-activated protein kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346871])

HSP 1 Score: 320.087 bits (819), Expect = 6.609e-101
Identity = 149/320 (46.56%), Postives = 219/320 (68.44%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   I +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + + +  +D+  W++ V  K
Sbjct:   55 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHI-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAK 372          
BLAST of hemipterous vs. Ensembl Mouse
Match: Map2k7 (mitogen-activated protein kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346871])

HSP 1 Score: 321.242 bits (822), Expect = 9.339e-101
Identity = 149/320 (46.56%), Postives = 219/320 (68.44%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   I +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + + +  +D+  W++ V  K
Sbjct:   99 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHI-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAK 416          
BLAST of hemipterous vs. UniProt/SwissProt
Match: sp|Q4KSH7|MP2K7_RAT (Dual specificity mitogen-activated protein kinase kinase 7 OS=Rattus norvegicus OX=10116 GN=Map2k7 PE=1 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 7.249e-100
Identity = 149/320 (46.56%), Postives = 218/320 (68.12%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   I +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + +    +D+  W++ V  K
Sbjct:   83 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHI-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYETLEVDVASWFKDVMAK 400          
BLAST of hemipterous vs. UniProt/SwissProt
Match: sp|O14733|MP2K7_HUMAN (Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP2K7 PE=1 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 1.059e-99
Identity = 148/320 (46.25%), Postives = 218/320 (68.12%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   + +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + +    +D+  W++ V  K
Sbjct:   83 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHV-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAK 400          
BLAST of hemipterous vs. UniProt/SwissProt
Match: sp|Q8CE90|MP2K7_MOUSE (Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus OX=10090 GN=Map2k7 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 4.186e-98
Identity = 149/320 (46.56%), Postives = 219/320 (68.44%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHK 1133
            +P S++ + I++   E+ +++G LTI  ++   ++++ E    +G GTCG V++MR ++   I +AVKQMRRS +  EENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL +RG++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++  +PP LP  + +S  F  FV  CL KD   RPKY+KL+   F + + +  +D+  W++ V  K
Sbjct:   99 TPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHI-IAVKQMRRSGNK-EENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAK 416          
BLAST of hemipterous vs. UniProt/SwissProt
Match: sp|Q23977|HEP_DROME (Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster OX=7227 GN=hep PE=1 SV=2)

HSP 1 Score: 306.605 bits (784), Expect = 9.765e-88
Identity = 148/318 (46.54%), Postives = 211/318 (66.35%), Query Frame = 3
Query:  240 LFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN--SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV---YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANK-PTSINANA 1175
            + +++G L IN  +  T +++ +    LG+GT GNV +M      +I +AVKQMRR+ ++ EENKRI  DLDVV + HDC +IV C G F+   +VWICME MS C DKLLK    P PE ++GKV+ A + AL YLK KH ++HRD+KPSN+L+ +RG +KLCDFGIS +L DS AN+R  GC  YMAPER++     YD+RADVWSLG++LVELA  + P +G  ++FE++ +++D +PP LP G    +S+ F  FV  CL K+  +RPKY +L++  F R++    +D+  W++S+    + AN  PT   A A
Sbjct:  176 IMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTI-IAVKQMRRTGNA-EENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRANGDPTLQRATA 491          
BLAST of hemipterous vs. UniProt/SwissProt
Match: sp|Q21307|MEK1_CAEEL (Dual specificity mitogen-activated protein kinase kinase mek-1 OS=Caenorhabditis elegans OX=6239 GN=mek-1 PE=1 SV=2)

HSP 1 Score: 284.263 bits (726), Expect = 4.614e-87
Identity = 148/318 (46.54%), Postives = 205/318 (64.47%), Query Frame = 3
Query:  183 SPHSPS-SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERL---NSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            +PH PS S +  N+  L  +  + SG LT+   +    + E +    +GHG+CG V + R K   S+ MAVK M R+S+S E + RI  DLDV+    DCP+IV C+G FI+  +V +CME M+TCLD+LL  +  P PE +IGK+S +IIKAL YLKTKH IMHRD+KPSN+LL   G +KLCDFGI+ +L +S A+S+Q GC  YM PERL   N  +YD+R+DVWS G++LVELA G++P  G  +EF++M++I++ +PP L    +S  F + V SCLQ+D   RP YD L+   F   H     D+  W+  V
Sbjct:   31 APHHPSRSSNDHNVKNLMKQAEENSGYLTLQGNRRKADLKELQFVEDIGHGSCGTVTKCRYK---SVIMAVKTMPRTSNSYEMS-RILMDLDVICLSFDCPYIVRCFGYFITNFDVRVCMECMATCLDRLLIRIKQPIPERIIGKLSVSIIKALHYLKTKHQIMHRDVKPSNILLDWSGVIKLCDFGIAGRLIESRAHSKQAGCPLYMGPERLDPNNFDSYDIRSDVWSFGVTLVELATGQYPYAG--TEFDMMSKILNDEPPRLDPAKFSPDFCQLVESCLQRDPTMRPNYDMLLQHPFVVHHEKIETDVEEWFADV 342          
BLAST of hemipterous vs. TrEMBL
Match: A0A089H043 (Hemipterous OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 500/503 (99.40%), Postives = 500/503 (99.40%), Query Frame = 3
Query:  294 MDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETXXXXXXXXXXXXXXXVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQEXXXXXXXXXXXXXXXXXXXXPKPEFSNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCXXXXXXXXXXXXXXXIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP 1802
            MDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTSSGYASACSDSSPGSLGSQSRSPSSSQLQQETSG LLPPNSSASLSLVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQESSNETANSHSHSNNNNILHSPKPE SNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCSSSSSSAAA AVSSSIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP
Sbjct:    1 MDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTSSGYASACSDSSPGSLGSQSRSPSSSQLQQETSGSLLPPNSSASLSLVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQESSNETANSHSHSNNNNILHSPKPELSNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCSSSSSSAAAGAVSSSIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP 503          
BLAST of hemipterous vs. TrEMBL
Match: A0A4S2LFC3 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009296 PE=4 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 7.028e-118
Identity = 197/347 (56.77%), Postives = 244/347 (70.32%), Query Frame = 3
Query:   96 NRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDK---LNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
             RP  L+T   RS SP+T+     +D  VS    S ID+    +   L+ EL +KSG+L    + ++ KMD+F  E  LG GTC  VY+MR +  P + MAVK MRRSS   EENKRI RDL VVT+C+DC +IV C+GIF++ S+VWICME MSTCLDKLL+ L+ PFPE V+GKV+ +I  AL YLK KH++MHRD+KPSNMLLS  G VKLCDFGIS +LKDSIA SRQ GCIGYMAPERL SS+YDVRADVWSLG+SL+ELA G FP  G + EF IM++II   PPSLP  +  S AF  F+  CL+KD   RPKY  L++ DF+R HNV P  +L W + +
Sbjct:   45 QRPTALMTGRNRSESPATRSKSRPSDLSVS----SPIDENALCDPESLQTELEKKSGMLVFGVQSLSAKMDDFISECLLGSGTCSEVYKMRHRTKPELVMAVKHMRRSSTCPEENKRIMRDLYVVTKCNDCEYIVHCFGIFLTASDVWICMEIMSTCLDKLLRDLHRPFPEKVLGKVTVSITTALDYLKRKHNVMHRDVKPSNMLLSYEGIVKLCDFGISGELKDSIARSRQLGCIGYMAPERLESSSYDVRADVWSLGISLLELATGSFPYKGTEIEFAIMSKIISEPPPSLPHHIPCSSAFRHFIDLCLKKDHRQRPKYHALMNTDFFRRHNVPPRHVLDWLQCI 387          
BLAST of hemipterous vs. TrEMBL
Match: A0A183NVF9 (Protein kinase domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS6095 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 2.735e-117
Identity = 192/343 (55.98%), Postives = 235/343 (68.51%), Query Frame = 3
Query:   99 RPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            RP  L+    RS SP+T       D  V  +S    D+ +   L+ E+ ++SG+L   N+ +  K D+F  E  LG GTC +VY+MR +  P+I MAVKQMR SS   EENKRI  DL++VT+C DC +IV CYGIF S  +VWICME MSTCLDKL   L+ PFPE V+GKV+ AI  AL YLK KH++MHRD+KPSNMLLS +G +KLCDFGIS  LKDSIA SRQPGC GYMAPERLN+STYDVRAD+WSLG+SL+ELA G FP  G   EF IM +II   PPSLP  + ++ AF +FV  CL KD   RPKY  L+S  F+  HN EP D+L W R +
Sbjct:   44 RPTALLCERQRSESPATHSKSRQQDASV--NSNKQNDRYDFESLQKEIAKRSGVLLFGNKVLLAKTDDFANEGCLGSGTCSSVYKMRHRTKPNIVMAVKQMRVSSTYEEENKRIMMDLNIVTKCFDCSYIVECYGIFFSGGDVWICMEVMSTCLDKLYHDLHRPFPEKVLGKVTVAITTALDYLKRKHNVMHRDVKPSNMLLSYQGVIKLCDFGISGILKDSIARSRQPGCTGYMAPERLNNSTYDVRADIWSLGISLLELATGSFPYTGTHIEFAIMTKIISDPPPSLPHHIPFTPAFRQFVELCLTKDHTQRPKYRSLMSTGFFVRHNKEPHDVLEWLRGL 384          
BLAST of hemipterous vs. TrEMBL
Match: A0A183N3J4 (Protein kinase domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS22869 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 3.034e-117
Identity = 191/343 (55.69%), Postives = 236/343 (68.80%), Query Frame = 3
Query:   99 RPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            RP  L+    RS SP+T       D  V+ +  +  D+ +   L+ E+ ++SG+L   N+ +  K D+F  E  LG GTC +VY+MR +  P+I MAVKQMR SS   EENKRI  DL++VT+C DC +IV CYGIF S  +VWICME MSTCLDKL   L+ PFPE V+GKV+ AI  AL YLK KH++MHRD+KPSNMLLS +G +KLCDFGIS  LKDSIA SRQPGC GYMAPERLN+STYDVRAD+WSLG+SL+ELA G FP  G   EF IM +II   PPSLP  + ++ AF +FV  CL KD   RPKY  L+S  F+  HN EP D+L W R +
Sbjct:   44 RPTALLCERQRSESPATHSKSRQQDAPVNANGQN--DRYDFESLQKEIAKRSGVLLFGNKVLLAKTDDFANEGCLGSGTCSSVYKMRHRTKPNIVMAVKQMRVSSTYEEENKRIMMDLNIVTKCFDCSYIVECYGIFFSGGDVWICMEVMSTCLDKLYHDLHRPFPEKVLGKVTVAITTALDYLKRKHNVMHRDVKPSNMLLSYQGVIKLCDFGISGILKDSIARSRQPGCTGYMAPERLNNSTYDVRADIWSLGISLLELATGSFPYTGTHIEFAIMTKIISDPPPSLPHHIPFTPAFRQFVELCLTKDHTQRPKYRSLMSTGFFVRHNKEPHDVLEWLRGL 384          
BLAST of hemipterous vs. TrEMBL
Match: H2KQT1 (Dual specificity mitogen-activated protein kinase kinase 7 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_104644 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 3.319e-115
Identity = 182/300 (60.67%), Postives = 223/300 (74.33%), Query Frame = 3
Query:  228 LKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            L+ EL +KSG+L    + ++ KMD+F  E  LG GTC  VY+MR +  P + MAVK MRRSS   EENKRI RDL VVT+C+DC +IV C+GIF++ S+VWICME MSTCLDKLL+ L+ PFPE V+GKV+ +I  AL YLK KH++MHRD+KPSNMLLS  G VKLCDFGIS +LKDSIA SRQ GCIGYMAPERL SS+YDVRADVWSLG+SL+ELA G FP  G + EF IM++II   PPSLP  +  S AF  F+  CL+KD   RPKY  L++ DF+R HNV P  +L W + +
Sbjct:    8 LQTELEKKSGMLVFGVQSLSAKMDDFISECLLGSGTCSEVYKMRHRTKPELVMAVKHMRRSSTCPEENKRIMRDLYVVTKCNDCEYIVHCFGIFLTASDVWICMEIMSTCLDKLLRDLHRPFPEKVLGKVTVSITTALDYLKHKHNVMHRDVKPSNMLLSYEGIVKLCDFGISGELKDSIARSRQLGCIGYMAPERLESSSYDVRADVWSLGISLLELATGSFPYKGTEIEFAIMSKIISEPPPSLPHHIPCSSAFRHFIDLCLKKDHRQRPKYHALMNTDFFRRHNVPPRHVLDWLQCI 307          
BLAST of hemipterous vs. Ensembl Cavefish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 306.605 bits (784), Expect = 5.487e-95
Identity = 143/316 (45.25%), Postives = 212/316 (67.09%), Query Frame = 3
Query:  195 PSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            P S++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP  + +S  F  FV  CL KD   RPKY KL+   F R + V  +D+  W+++V
Sbjct:   93 PKSLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPECILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLSMGFSLDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVLEVDVAGWFQTV 406          
BLAST of hemipterous vs. Ensembl Cavefish
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 306.22 bits (783), Expect = 1.180e-94
Identity = 143/316 (45.25%), Postives = 212/316 (67.09%), Query Frame = 3
Query:  195 PSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            P S++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP  + +S  F  FV  CL KD   RPKY KL+   F R + V  +D+  W+++V
Sbjct:  109 PKSLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPECILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLSMGFSLDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVLEVDVAGWFQTV 422          
BLAST of hemipterous vs. Ensembl Cavefish
Match: map2k4b (dual specificity mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:103042940])

HSP 1 Score: 238.039 bits (606), Expect = 1.424e-70
Identity = 136/328 (41.46%), Postives = 192/328 (58.54%), Query Frame = 3
Query:  165 NTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEK-ITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPF----PEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSL---PEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRW 1112
            NT   ++  +PS     +I  L+    + SG L I+ E+      ++ +    +G G  G+V +M  K    I MAVK++R S+   +E K++  DLDVV R  DCP+IV  YG      + WICME MST  DK  K++ C      PE ++GK++ A +KAL +LK    I+HRDIKPSN+LL   G +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L ELA G+FP     S F+ + +++ G PP L    E  +S  F  FV+ CL KD + RPKY +L+   F +M+    +D+  +
Sbjct:   21 NTRLPIASSTPS-FQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQI-MAVKRIR-STVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYCSLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLINSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHPFIQMYEERVVDVASY 345          
BLAST of hemipterous vs. Ensembl Cavefish
Match: map2k4b (dual specificity mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:103042940])

HSP 1 Score: 238.424 bits (607), Expect = 4.688e-70
Identity = 136/328 (41.46%), Postives = 192/328 (58.54%), Query Frame = 3
Query:  165 NTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEK-ITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPF----PEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSL---PEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRW 1112
            NT   ++  +PS     +I  L+    + SG L I+ E+      ++ +    +G G  G+V +M  K    I MAVK++R S+   +E K++  DLDVV R  DCP+IV  YG      + WICME MST  DK  K++ C      PE ++GK++ A +KAL +LK    I+HRDIKPSN+LL   G +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L ELA G+FP     S F+ + +++ G PP L    E  +S  F  FV+ CL KD + RPKY +L+   F +M+    +D+  +
Sbjct:   71 NTRLPIASSTPS-FQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQI-MAVKRIR-STVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYCSLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLINSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHPFIQMYEERVVDVASY 395          
BLAST of hemipterous vs. Ensembl Cavefish
Match: map2k4b (dual specificity mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:103042940])

HSP 1 Score: 238.81 bits (608), Expect = 5.113e-70
Identity = 136/328 (41.46%), Postives = 192/328 (58.54%), Query Frame = 3
Query:  165 NTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEK-ITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPF----PEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSL---PEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRW 1112
            NT   ++  +PS     +I  L+    + SG L I+ E+      ++ +    +G G  G+V +M  K    I MAVK++R S+   +E K++  DLDVV R  DCP+IV  YG      + WICME MST  DK  K++ C      PE ++GK++ A +KAL +LK    I+HRDIKPSN+LL   G +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L ELA G+FP     S F+ + +++ G PP L    E  +S  F  FV+ CL KD + RPKY +L+   F +M+    +D+  +
Sbjct:   82 NTRLPIASSTPS-FQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQI-MAVKRIR-STVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYCSLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLINSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHPFIQMYEERVVDVASY 406          
BLAST of hemipterous vs. Ensembl Sea Lamprey
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 315.079 bits (806), Expect = 5.460e-100
Identity = 150/317 (47.32%), Postives = 211/317 (66.56%), Query Frame = 3
Query:  192 SPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            +P S++ + I++   E+  ++G LT++ ++    + E E    +G GTCG V++MR K    I +AVKQMRRS +  +ENKRI  DLDVV + HDCP+IV C+G FI+ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL  RG +KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP  + +S  F  FV  CL KD   RPKY+KL+   F R +    +D+  W+R V
Sbjct:   39 TPRSLESVEIDQKLQEIMNQTGFLTLDGKRYRADISELETLGEMGSGTCGQVWKMRYKPTSHI-LAVKQMRRSGNK-DENKRILMDLDVVLKSHDCPYIVQCHGSFITNTDVFIAMELMGTCAEKLKKRIQGPIPENILGKMTVAIVKALSYLKEKHGVIHRDVKPSNILLDSRGRIKLCDFGISGRLVDSKAKTRGAGCAAYMAPERIDPPDPTHPDYDIRADVWSLGISLVELATGQFPYQNCKTDFEVLTKVLQEDPPLLPSDMGFSLDFQAFVKDCLTKDHRKRPKYNKLLEHAFLRRYERVEVDVATWFRDV 353          
BLAST of hemipterous vs. Ensembl Sea Lamprey
Match: map2k4b (mitogen-activated protein kinase kinase 4b [Source:ZFIN;Acc:ZDB-GENE-080721-13])

HSP 1 Score: 241.506 bits (615), Expect = 1.807e-72
Identity = 144/366 (39.34%), Postives = 209/366 (57.10%), Query Frame = 3
Query:  108 KLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTIN-NEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCP----FPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSL---PEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWY-RSVNHKPIVANKPTSIN 1166
            KL   N  SC  + K  I      V P++P      +I  L+    + +G L ++  ++     D+ +    +G G  G+V +M+      I MAVK++R S+   +E K++  DLDVV    DCP+IV  +G      + WICME MST  DK  KF+ C      PE ++GK++ A +KAL YLK    I+HRD+KPSN+LL  RG +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L+ELA GKFP     S F+ + +++ G PP L    E  +S +F  FV+SCL KD + RPKY +L+   F  M+    +D+  ++ ++++  P     P  I+
Sbjct:    9 KLNFANPPSCKAAPK--IIFNPQQVVPNNP------HIERLRTHSMESAGKLKLSPGQQYDFTADDLKDLGEIGRGAYGSVNKMQHNHSAHI-MAVKRIR-STVDEKEQKQLLMDLDVVM-SSDCPYIVQFFGALFREGDCWICMELMSTSFDKFYKFVYCTSDDVIPEEILGKITLATVKALNYLKENLKIIHRDVKPSNILLDRRGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLIELATGKFPYPKWNSVFDQLTQVVKGDPPQLSNSEERQFSASFINFVNSCLTKDESRRPKYRELLKHPFILMYESRNVDVAVYFCKTLDRMPPSPVSPMYID 363          
BLAST of hemipterous vs. Ensembl Sea Lamprey
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:65239])

HSP 1 Score: 238.039 bits (606), Expect = 2.258e-71
Identity = 120/295 (40.68%), Postives = 184/295 (62.37%), Query Frame = 3
Query:  261 LTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFL---NCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPER----LNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            +TI+++    K D+ E    LG G  G V R+R     +I MAVK++R + +S +E KR+  DLD+  R  DCP+ VT YG      +VWICME M T LDK  K +       PE ++GK+S AI+KAL++L +K  ++HRD+KPSN+L++ +G VK+CDFGIS  L DS+A +   GC  YMAPER    +N   Y+V++D+WSLG++++ELAI KFP +   + F+ + ++++   P LP   +S  F  F + CL+K+ N RP Y +L+   F+ +HN +  D+  + + +
Sbjct:   52 ITIDDKNFEVKADDLESICELGRGAYGVVERVRHTPSGTI-MAVKRIRATVNS-QEQKRLLMDLDISMRTVDCPYTVTFYGALFREGDVWICMELMDTSLDKFYKKVIEKGLTIPEDILGKISVAIVKALEHLHSKLSVIHRDVKPSNVLINTQGHVKMCDFGISGYLVDSVAKTLDAGCKPYMAPERINPEINQKGYNVKSDIWSLGITMIELAILKFPYESWGTPFQQLKQVVEEPSPQLPPENFSPEFVDFSTLCLKKNPNERPTYAELMDNTFFGIHNAKDTDVATFVKLI 344          
BLAST of hemipterous vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004725.1 (pep scaffold:Pmarinus_7.0:GL477683:141377:157028:-1 gene:ENSPMAG00000004255.1 transcript:ENSPMAT00000004725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 5.171e-51
Identity = 115/314 (36.62%), Postives = 171/314 (54.46%), Query Frame = 3
Query:  204 IDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEM-STCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPI--------DGLKSE-------------------------------------FEIMARIIDGKPPSLPEGVYSEAFNKFVS 1007
            +++L ++E + +  +    LT   +    K D+FE  S LG G  G V ++ L +  ++ MA K +         N+ I R+L V+  C + P+IV  YG F S  E+ ICME M    LD +LK      PE ++GKVS A+IK L YL+ KH IMHRD+KPSN+L++ RGE+KLCDFG+S +L DS+ANS   G   YM+PERL  + Y V++D+WS+G+SLVE+AIG++PI        +G+  +                                     FE++  I++  PP LP  V+++ F  FV+
Sbjct:   15 LEELELDEQQKKRLE--AFLTQKQKVGELKDDDFEKLSELGAGNGGVVTKV-LHKPSALIMARKLIHLEIKPAIRNQ-IIRELQVLHEC-NSPYIVGFYGAFYSDGEISICMEHMDGGSLDLVLKKAGR-IPEEILGKVSIAVIKGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFV-GTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPEAKELEGIFGKAVTEGAEAMQNNTSPRPRPPGRPGSAYNMDARPPMAIFELLDYIVNEPPPKLPCTVFTQDFQDFVN 321          
BLAST of hemipterous vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 135.191 bits (339), Expect = 3.907e-34
Identity = 91/261 (34.87%), Postives = 147/261 (56.32%), Query Frame = 3
Query:  303 FEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMS--TCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIK--PSNMLLSDRGEVKLCDFGISAKLKDS-IANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADF 1070
            F  +  +G G+ G V++    R   + +A+K +       E      +++ V+++C D P++   +G ++  +++WI ME +   + LD L+K    P  E+ I  +   I+K L YL ++  I HRDIK   +N+LLS++G+VKL DFG++ +L D+ I  +   G   +MAPE +  S YD +AD+WSLG++ +ELA G+ P   L     ++  I    PP+L EG YS+AF +FV SCL KD   RP   +L+   F
Sbjct:   26 FTKQERIGKGSFGEVFKGIDNRTKEV-VAIKIIDLEEAEDEIEDIQ-QEITVLSQC-DSPYVTHYFGSYLKGTKLWIIMEYLGGGSALD-LIK--PGPLEEHQIATILREILKGLDYLHSERKI-HRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHP-MRVLFLIPKNNPPTL-EGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKF 277          
BLAST of hemipterous vs. Ensembl Yeast
Match: PBS2 (MAP kinase kinase of the HOG signaling pathway; activated under severe osmotic stress; mitophagy-specific regulator; plays a role in regulating Ty1 transposition [Source:SGD;Acc:S000003664])

HSP 1 Score: 179.104 bits (453), Expect = 9.800e-48
Identity = 108/281 (38.43%), Postives = 165/281 (58.72%), Query Frame = 3
Query:  294 MDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENK--RIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEM-STCLDKLLKFLN--CPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLS-DRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNS-----STYDVRADVWSLGMSLVELAIGKFPI--DGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADF---YRMHNV 1088
            +DE E    LGHG  GNV ++ L +  ++ MA K++R     ++E K  +I  +L+V+ +C + P+IV  YG F     V++CME M    LDK+    +      E  +  ++ A+I  L+ LK +H+I+HRD+KP+N+L S ++G VKLCDFG+S  L  S+A +   GC  YMAPER+ S     +TY V++D+WSLG+S++E+A+G++P   +   + F  ++ I+DG PP LP   +S     FVS CLQK    RP Y  L    +   YR  +V
Sbjct:  357 LDELEFLDELGHGNYGNVSKV-LHKPTNVIMATKEVRLE---LDEAKFRQILMELEVLHKC-NSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDESSEIGGIDEPQLAFIANAVIHGLKELKEQHNIIHRDVKPTNILCSANQGTVKLCDFGVSGNLVASLAKTNI-GCQSYMAPERIKSLNPDRATYTVQSDIWSLGLSILEMALGRYPYPPETYDNIFSQLSAIVDGPPPRLPSDKFSSDAQDFVSLCLQKIPERRPTYAALTEHPWLVKYRNQDV 631          
BLAST of hemipterous vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 155.992 bits (393), Expect = 6.242e-41
Identity = 101/278 (36.33%), Postives = 150/278 (53.96%), Query Frame = 3
Query:  270 NNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISP--SEVWICMEEMST-CLDKLLKFL---NCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLK-----SEFEIMARIIDGKPP--SLPEG--VYSEAFNKFVSSCLQKDFNNRPKYDKLV 1058
            N  K     D  E    LG G  G+V + +LK    I  A+K +   +   E  K+IFR+L    R     +IV  YG+F     S ++I ME M    LD + K L        E V+GK++ A+++ L YL  K  ++HRDIKP N+LL++ G+VKLCDFG+S +  +S+A +   G   YMAPER+    Y V +DVWSLG++++E+A GKFP    K     + FE++  I+   P     PE   ++S +F  F+  CL+KD   RP   +++
Sbjct:  210 NGWKYANLKDRIETLGILGEGAGGSVSKCKLKNGSKI-FALKVINTLNTDPEYQKQIFRELQF-NRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKK-VIHRDIKPQNILLNENGQVKLCDFGVSGEAVNSLATTFT-GTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMI 483          
BLAST of hemipterous vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 149.058 bits (375), Expect = 1.665e-38
Identity = 95/264 (35.98%), Postives = 144/264 (54.55%), Query Frame = 3
Query:  297 DEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFI--SPSEVWICMEEMST-CLDKLLKFL---NCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLK-----SEFEIMARIIDGKP-----PSLPEGVYSEAFNKFVSSCLQKDFNNRP 1040
            DE      LG G  G+V + RLK    +  A+K +   +   E  K+IFR+L    +     +IV  YG+F     S ++I ME M    L+   K L        E VIGK++ ++++ L YL  +  ++HRDIKP N+LL+++GE+KLCDFG+S +  +S+A +   G   YMAPER+    Y V  DVWSLG++L+E+A G+FP +  K     +  E++  I+   P     P L +  +S+ F  F+  CL+KD   RP
Sbjct:  212 DEITTLGILGEGAGGSVAKCRLKNGKKV-FALKTINTMNTDPEYQKQIFRELQF-NKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERK-VIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTFT-GTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPEL-DISWSKTFRSFIDYCLKKDARERP 470          
BLAST of hemipterous vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 139.428 bits (350), Expect = 3.088e-35
Identity = 97/301 (32.23%), Postives = 158/301 (52.49%), Query Frame = 3
Query:  321 LGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENK-----RIFRDLDVVTRCHDCPFIVTCYGIFISP---SEVWICMEEMSTC--LDKLL----KFLN--------CPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSE----FEIMARIIDGKPPSLPEG-VYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPL--DILR-WYRSVNHK 1133
            +G G  G V  ++   +P   +  K+    +  VE+N      ++ R+L +V        I+T YG + +    +E+ I ME  S C  LDK+L    +F+           F E  I K++  ++  L +L  ++ I+HRDIKPSN+L++ +G++KLCDFG+S KL +SIA++   G   YM+PER+  + Y ++ DVWSLG+ ++EL  G+FP+ G         +++ RI++   P LP+  +YS+    FV+ C  K+   R    +L+  D   M  V P   D  R W R +  K
Sbjct:  197 IGAGNSGTV--VKALHVPDSKIVAKK----TIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILME-YSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTF-VGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLI-MKYVSPSKDDKFRHWCRKIKSK 488          
BLAST of hemipterous vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 129.798 bits (325), Expect = 3.890e-31
Identity = 86/279 (30.82%), Postives = 144/279 (51.61%), Query Frame = 3
Query:  303 FEIESSLGHGTCGNVYR---MRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCP--FPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKL-KDSIANSRQPGCIGYMAPERLNSST-YDVRADVWSLGMSLVELAIGKFP---IDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILR 1109
            F+    +G G  G VY+   ++  R+     A+K +   S S +E + + R++  +        I   YG ++  + +WI ME    C    L+ L  P    E  IG +   ++ AL+ +  K +++HRDIK +N+L+++ G VKLCDFG++A++ + S+      G   +MAPE +     YD + D+WSLG++  E+A G  P   ++ L++    M  II  KPP L +  YS +  +F++ CL +D   R   D L+ + F R H   P  IL+
Sbjct:   23 FKRTEVIGRGKFGVVYKGYNVKTGRV----YAIKVLNLDSDS-DEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEH---CAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIH-KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRA----MQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILK 288          
BLAST of hemipterous vs. Ensembl Nematostella
Match: EDO43384 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU8])

HSP 1 Score: 311.612 bits (797), Expect = 4.114e-99
Identity = 151/300 (50.33%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  237 ELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEG-VYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYR 1118
            E+ Q++G+L + ++K    +D+ E+   +G+GTCG V +M+ K+   + +AVK+M RS H+ EE KRI  DL+VV + HDCP+IVTC G  IS S+V+ICME M+TCLDKLLK L  P PE+++GK++ AI+KAL YLK +H +MHRD+KPSNMLL   G VKLCDF IS +L DS A ++  GC  YMAPER++     +  YDVRADVWSLG+SLVELA G+FP     +EFE++ R++   PPSLP    +S  F+ FV  CL KDF+ RPKY+KL+   F   ++ + +D+  W +
Sbjct:   21 EIKQQTGILKLGDKKYDFSLDDLEMSGEIGYGTCGQVCKMKHKKSGQV-LAVKRMARS-HNKEEQKRILMDLEVVMKSHDCPYIVTCMGALISKSDVFICMELMATCLDKLLKRLQNPIPEHILGKMAVAIVKALHYLKEEHGVMHRDVKPSNMLLDSAGCVKLCDFSISGRLVDSKAKTKSAGCAAYMAPERIDPPDPMNPNYDVRADVWSLGISLVELATGEFPYRNCTTEFEVLTRVMGEDPPSLPGSKGFSHDFSSFVDECLTKDFHYRPKYNKLLVHPFITSYDSKEVDVAGWLK 318          
BLAST of hemipterous vs. Ensembl Nematostella
Match: EDO38062 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX6])

HSP 1 Score: 237.654 bits (605), Expect = 4.668e-71
Identity = 120/292 (41.10%), Postives = 178/292 (60.96%), Query Frame = 3
Query:  261 LTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLK-FLNCP---FPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSS----TYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRW 1112
            +T+  ++   + D+ +    LGHG  G VY M L    S  MAVK++R + +S E+ KR+  DLD+  R  D P+ V  YG      +VWICME M T L  L K   + P    PE V+GK++ +++ AL+YL +   ++HRD+KPSN+L+ +RG  KLCDFGIS +L DS+A +   GC  YMAPER+N       YD+R+D+WSLG++++ELA GKFP    K+ FE + +++    PSLPEG +S  F  FV+  L K++  RP Y++L+   F ++H    +D+  W
Sbjct:   44 ITVGGQEFDCQADDLQEIRELGHGAYGYVYEM-LHVPTSTVMAVKKIRANVNSTEQ-KRLLMDLDISMRVSDYPYTVHFYGALFREGDVWICMELMKTSLYDLYKQVFSKPDRRIPEEVLGKIAVSVVSALEYLHSNLKVIHRDVKPSNILVDERGNFKLCDFGISGQLVDSLAKTVDAGCKPYMAPERINPDRDMKGYDIRSDIWSLGITMIELATGKFPYTQWKTPFEQLKQVVHEPSPSLPEGPFSLNFRDFVTKSLIKNYKERPNYNQLLEHPFIKVHMGRNVDVASW 333          
BLAST of hemipterous vs. Ensembl Nematostella
Match: EDO48408 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJN6])

HSP 1 Score: 228.024 bits (580), Expect = 4.406e-68
Identity = 118/281 (41.99%), Postives = 173/281 (61.57%), Query Frame = 3
Query:  315 SSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPF----PEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSL---PEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
              +G G  G V +M L    +  MAVK++R S+   ++ K++  DLDVV R  +CPFIV  YG   +  + WICME M    DK  K +        PE ++ KV+ A++KAL YLK + +I+HRD+KPSN+LL   G +KLCDFGIS  L DSIA +R  GC  YMAPER++ S+    YD+R+DVWS G++++EL+ G FP     S F+ +++++DG PP L   PE + S     FV+ CL K+   RPKY++L++  F +++   P+D+  W + V
Sbjct:   13 GEIGRGAYGTVNKM-LHPNSNTFMAVKRIR-STVDQKDQKQLLMDLDVVMRSSNCPFIVRFYGALFTEGDAWICMELMEISFDKCYKLVYGSIEQIIPEEILSKVAYAVVKALDYLKRELNIIHRDVKPSNILLDRNGAIKLCDFGISGHLVDSIAKTRDAGCKPYMAPERIDPSSCRQGYDIRSDVWSFGITMIELSTGVFPYPKWNSVFDQLSQVVDGDPPQLSNTPEMMRSPELLNFVNICLSKEVEKRPKYNELLNHQFIQLYQERPVDVGAWLQEV 291          
BLAST of hemipterous vs. Ensembl Nematostella
Match: EDO45553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSF4])

HSP 1 Score: 178.718 bits (452), Expect = 1.289e-49
Identity = 123/353 (34.84%), Postives = 181/353 (51.27%), Query Frame = 3
Query:  204 IDKLNINELKDELFQKSGLLTINNEKITTKM---DEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSH-SVEENKR--IFRDLDVVTRCHDC--PFIVTCYGIFISPSEVWICMEEM-STCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPI-----------------------------------DGLKSE------FEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRW 1112
            +D LN++E+     Q+  L    NEK        D+FE  + LG G  G V ++  K     P  +   R+  H  V+   R  I R+L V+   HDC  P+IV  +G F S  E+ ICME M    LD +LK      PE ++GK+S A++K L YL+  H I+HRD+KPSN+L++ RGE+K+CDFG+S +L DS+ANS   G   YM+PERL  + Y +++D+WS G+SLVE+AIG++PI                                    G+ +E      FE++  I++  PP LP   +S  F +FV  CL K+   R     L++  F    +   +D  +W
Sbjct:    8 LDDLNLDEI-----QRRRLEEFLNEKRKIGELSNDDFEKITELGAGNGGVVTKVLHK-----PTGLIMARKLIHLEVKPAIRTQIIRELKVL---HDCNSPYIVGFFGAFYSDGEISICMEHMDGGSLDLILKKAGR-IPEDILGKISIAVLKGLCYLREIHQIIHRDVKPSNILVNSRGEIKMCDFGVSGQLIDSMANSFV-GTRSYMSPERLQGNQYTIQSDIWSFGLSLVEMAIGRYPIPPPDPQEIEKVLSREPSSMASPMSVGRLPPGVRPPSGVNNETRPMAIFELLDYIVNEPPPILPGAHFSPEFCEFVQKCLVKNPKQRADLTYLMTHKFIAKADKSNVDFAKW 345          
BLAST of hemipterous vs. Ensembl Nematostella
Match: EDO40740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6F5])

HSP 1 Score: 155.221 bits (391), Expect = 1.532e-40
Identity = 109/342 (31.87%), Postives = 177/342 (51.75%), Query Frame = 3
Query:  165 NTDTHVSPHSPSSIDKLNINELKDELFQKSGLLT---INNEKITTKMDEFEIESSLGHGTCGNVYRM------RLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEM-STCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPI----DGLKSEF-----------EIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWY 1115
            NT   +SP   +S+     + L+ +      +L    +N E+I       EI   LG+G  G VY+       R+  +  IP+ V        + E  ++I  ++++  +C   P+I+  YG F   + + +C E M    LD     +    PE V+G+++ A++K L YL     IMHRD+KPSN+L++ RG+VKLCDFG+S +L +SIA +   G   YMAPER+    Y + ++VWSLG+SL+E+A G+FP       L S F           E++  I+   PP LP+ ++S  F  FV+ C+QK  + R   + ++   F RM +   +D++  +
Sbjct:  111 NTRAPLSPSGQTSMPAPMNSHLQHQPTTAPSILAGGQLNQEQI----QHLEI---LGYGNGGTVYKAIHLTTRRIIAVKVIPLDV--------TPEVQRQIISEMEISFQCAS-PYIIEFYGAFFVENRISMCTEYMDGGSLD-----MYGSIPEPVLGRIAVAVVKGLAYL-WGLKIMHRDVKPSNILVNTRGQVKLCDFGVSRQLVNSIATTYV-GTNAYMAPERILGDEYSILSEVWSLGVSLLEMASGRFPYLKVSIQLASYFFFGNHCFLVPIELLQCIVHEAPPRLPDHLFSPVFVDFVAQCMQKSPSTRLTPEAVLDHIFIRMSDDGNIDMISMW 429          
BLAST of hemipterous vs. Ensembl Medaka
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:NCBI gene;Acc:101164950])

HSP 1 Score: 307.76 bits (787), Expect = 1.589e-95
Identity = 142/314 (45.22%), Postives = 212/314 (67.52%), Query Frame = 3
Query:  201 SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            S++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP G+ +S  F  FV  CL KD   RPKY +L+   F R + V  +D+  W+++V
Sbjct:  103 SLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVSDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEQILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLLEHSFIRRYEVLEVDVAGWFQTV 414          
BLAST of hemipterous vs. Ensembl Medaka
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:NCBI gene;Acc:101164950])

HSP 1 Score: 308.145 bits (788), Expect = 2.575e-95
Identity = 142/314 (45.22%), Postives = 212/314 (67.52%), Query Frame = 3
Query:  201 SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            S++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP G+ +S  F  FV  CL KD   RPKY +L+   F R + V  +D+  W+++V
Sbjct:   87 SLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVSDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEQILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLLEHSFIRRYEVLEVDVAGWFQTV 398          
BLAST of hemipterous vs. Ensembl Medaka
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:NCBI gene;Acc:101164950])

HSP 1 Score: 307.76 bits (787), Expect = 3.283e-95
Identity = 142/314 (45.22%), Postives = 212/314 (67.52%), Query Frame = 3
Query:  201 SIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLN-----SSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV 1124
            S++   I++   E+ +++G L I+ ++   ++ +   E  +G GTCG V+++R K+   + +AVKQMRR+ +  +ENKRI  DLDVV + HDCP+I+ CYG  ++ ++V+I ME M TC +KL K +  P PE ++GK++ AI+KAL YLK KH ++HRD+KPSN+LL  +G++KLCDFGIS +L DS A +R  GC  YMAPER++        YD+RADVWSLG+SLVELA G+FP    K++FE++ +++   PP LP G+ +S  F  FV  CL KD   RPKY +L+   F R + V  +D+  W+++V
Sbjct:  103 SLENAEIDQKLQEIMKQTGYLKIDGQRYPAEVSDLISEGEIGSGTCGQVFKVRFKKTGHV-IAVKQMRRTGNK-DENKRILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEQILGKMTVAIVKALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPLLPLGMGFSLDFQSFVKDCLTKDHRKRPKYHQLLEHSFIRRYEVLEVDVAGWFQTV 414          
BLAST of hemipterous vs. Ensembl Medaka
Match: map2k4a (mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:101174917])

HSP 1 Score: 242.276 bits (617), Expect = 1.376e-71
Identity = 142/359 (39.55%), Postives = 204/359 (56.82%), Query Frame = 3
Query:  132 SCSPSTKFSIENTDTHV-SPHSPSSIDKLNINELKDELFQKSGLLTINNEK-ITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPF----PEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLP---EGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWY-RSVNHKPIVANKPTSIN 1166
            S  P T+FS+        +PH         I  L+    + SG L I+ E+      ++ +    +G G  G+V +M  K    I MAVK++R S+   +E K++  DLDVV R  DCP+IV  YG      + WICME M+T LDK  KF+ C      PE ++GK++ A +KAL +LK    I+HRDIKPSN+LL  +G +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L ELA G+FP     S F+ + +++ G PP L    E  +S  F  FV+ CL K+ + RPKY +L+   F +M+    +D+  +  R ++  P   + P  ++
Sbjct:   64 SIKPMTRFSLNTAGPQFQNPH---------IERLRTHSIESSGKLKISAEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSNQI-MAVKRIR-STVDEKEQKQLLMDLDVVVRSSDCPYIVQFYGALFREGDCWICMELMATSLDKFYKFVYCSLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVRGDPPQLSNSDERRFSPKFISFVNVCLTKEESKRPKYRELLRDPFIQMYEERSVDVAGYVCRIMDQMPASPSSPMYMD 411          
BLAST of hemipterous vs. Ensembl Medaka
Match: map2k4a (mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:101174917])

HSP 1 Score: 242.276 bits (617), Expect = 2.957e-71
Identity = 142/359 (39.55%), Postives = 204/359 (56.82%), Query Frame = 3
Query:  132 SCSPSTKFSIENTDTHV-SPHSPSSIDKLNINELKDELFQKSGLLTINNEK-ITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPF----PEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSST----YDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLP---EGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWY-RSVNHKPIVANKPTSIN 1166
            S  P T+FS+        +PH         I  L+    + SG L I+ E+      ++ +    +G G  G+V +M  K    I MAVK++R S+   +E K++  DLDVV R  DCP+IV  YG      + WICME M+T LDK  KF+ C      PE ++GK++ A +KAL +LK    I+HRDIKPSN+LL  +G +KLCDFGIS +L DSIA +R  GC  YMAPER++ S     YDVR+DVWSLG++L ELA G+FP     S F+ + +++ G PP L    E  +S  F  FV+ CL K+ + RPKY +L+   F +M+    +D+  +  R ++  P   + P  ++
Sbjct:   81 SIKPMTRFSLNTAGPQFQNPH---------IERLRTHSIESSGKLKISAEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSNQI-MAVKRIR-STVDEKEQKQLLMDLDVVVRSSDCPYIVQFYGALFREGDCWICMELMATSLDKFYKFVYCSLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVRGDPPQLSNSDERRFSPKFISFVNVCLTKEESKRPKYRELLRDPFIQMYEERSVDVAGYVCRIMDQMPASPSSPMYMD 428          
BLAST of hemipterous vs. Planmine SMEST
Match: SMESG000007331.1 (SMESG000007331.1)

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 573/576 (99.48%), Postives = 573/576 (99.48%), Query Frame = 3
Query:   75 MILSMHRNRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETXXXXXXXXXXXXXXXVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQEXXXXXXXXXXXXXXXXXXXXPKPEFSNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCXXXXXXXXXXXXXXXIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP 1802
            MILSMHRNRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTSSGYASACSDSSPGSLGSQSRSPSSSQLQQETSG LLPPNSSASLSLVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQESSNETANSHSHSNNNNILHSPKPE SNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCSSSSSSAAA AVSSSIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP
Sbjct:    1 MILSMHRNRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTSSGYASACSDSSPGSLGSQSRSPSSSQLQQETSGSLLPPNSSASLSLVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQESSNETANSHSHSNNNNILHSPKPELSNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCSSSSSSAAAGAVSSSIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP 576          
BLAST of hemipterous vs. Planmine SMEST
Match: SMESG000007331.1 (SMESG000007331.1)

HSP 1 Score: 990.334 bits (2559), Expect = 0.000e+0
Identity = 569/572 (99.48%), Postives = 569/572 (99.48%), Query Frame = 3
Query:   87 MHRNRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETXXXXXXXXXXXXXXXVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQEXXXXXXXXXXXXXXXXXXXXPKPEFSNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCXXXXXXXXXXXXXXXIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP 1802
            MHRNRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTSSGYASACSDSSPGSLGSQSRSPSSSQLQQETSG LLPPNSSASLSLVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQESSNETANSHSHSNNNNILHSPKPE SNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCSSSSSSAAA AVSSSIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP
Sbjct:    1 MHRNRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNINELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSVNHKPIVANKPTSINANALINSCQTSSGYASACSDSSPGSLGSQSRSPSSSQLQQETSGSLLPPNSSASLSLVTNVRSNNFTLIHQLTRNLHINSQPTSALSSIPQESSNETANSHSHSNNNNILHSPKPELSNNDKSSFTNLKHRRYFLRLLNSSIDETYQSKKLVDPFVFPTSCSSSSSSAAAGAVSSSIRGSRKVCRKYCIGPVDHKSVVISNNSKCCTNSTKP 572          
BLAST of hemipterous vs. Planmine SMEST
Match: SMESG000000893.1 (SMESG000000893.1)

HSP 1 Score: 413.305 bits (1061), Expect = 7.178e-124
Identity = 217/227 (95.59%), Postives = 220/227 (96.92%), Query Frame = 3
Query: 1869 RLTGSETIFIGNSETIIKEIKSNSEADFHENNSPKEIDSTEDYFSMKIPMKFQAVENRNNNLEIIFREKINFNASEIENQLFHFPKQFVSPVESISTKHFPSNCCRVSERESLCKIDSIRKSSKSADISMENKTINFRNNQNLTELSLLSSQTANSTGFVVADSSHIQLSKREKNSFFSKFWXXXXXXXXXXXXXXXXYKDQLSQICNCLAFGQLLYPKISSSGHPV 2549
            RLTGSETIFIGNSETIIKEIKSNSEADFHENNSPKEIDSTEDYFSMKIPMKFQAVENRNNNLEIIFREKIN N SEIENQLFHFPKQFVSPVESISTKHFPSNCCRVSERESLCKIDSIRKSSKSADISMENKTINFRNNQNLTELSLLSSQTANSTGFVVADSSHIQLSKREKNSFFSKFW  ++ + LILIFVLVLYK QLSQICNCLAFGQLLYPKISSSGHPV
Sbjct: 1912 RLTGSETIFIGNSETIIKEIKSNSEADFHENNSPKEIDSTEDYFSMKIPMKFQAVENRNNNLEIIFREKINSNVSEIENQLFHFPKQFVSPVESISTKHFPSNCCRVSERESLCKIDSIRKSSKSADISMENKTINFRNNQNLTELSLLSSQTANSTGFVVADSSHIQLSKREKNSFFSKFW--LLIVALILIFVLVLYKGQLSQICNCLAFGQLLYPKISSSGHPV 2136          
BLAST of hemipterous vs. Planmine SMEST
Match: SMESG000057661.1 (SMESG000057661.1)

HSP 1 Score: 227.639 bits (579), Expect = 6.480e-67
Identity = 115/276 (41.67%), Postives = 169/276 (61.23%), Query Frame = 3
Query:  315 SSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKF----LNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPER----LNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEGV-YSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWY 1115
              +G G  G+V RM + R     MAVK++R S+    +      DLDV+ +  +CPFIV  YG      + WICME MST LDK  ++    L    PE ++GKV+   +KAL YLK +  ++HRD+KPSN+L+   G +KLCDFGIS +L DSIA SR  GC  YMAPER    L++  YD+R+DVWSLG++++EL  GKFP    +S FE +  ++ G PPS+ + + +S  F  F+  CL+KD++ RP+YD+L    F+     + +++  ++
Sbjct:   58 GEIGRGAYGSVNRM-IHRKTDQLMAVKRIR-STLDESQQYSTLNDLDVIMKSANCPFIVRFYGALFREGDCWICMELMSTSLDKFYRYVYVHLKEKIPEKILGKVAVGTVKALDYLKVELRVIHRDVKPSNVLIDRDGNIKLCDFGISGQLIDSIAKSRDAGCKPYMAPERIHPKLSAKGYDIRSDVWSLGITMIELGTGKFPYPAWESVFEQLTCVLHGDPPSVNDSMGFSRQFQNFIERCLEKDYSKRPRYDELKQHPFFINSEFDQINVSEYF 331          
BLAST of hemipterous vs. Planmine SMEST
Match: SMESG000040748.1 (SMESG000040748.1)

HSP 1 Score: 196.052 bits (497), Expect = 1.445e-55
Identity = 107/280 (38.21%), Postives = 162/280 (57.86%), Query Frame = 3
Query:  267 INNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCP-----FPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERL----NSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPE-GVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYR 1076
            +N EKIT  M + E  + LG G  G V +M L +  ++  AVKQ+R S    +++ RI  DL++  R   CP++V  YG      +VWICME + + LDK  K ++        PE ++  ++  I+ AL+YL     ++HRD+KPSN+L+   G VK+CDFGIS  L +S+A +   G   Y+APER+    ++S + +R+DVWSLG+S++ELAI KFP     S + ++  + +G PPSLPE   YS     F+S CL     +R  Y +L+  D  +
Sbjct:   42 VNGEKITISMSDLETLNELGKGQFGIVEQM-LHKPSNLVFAVKQLRCSKDDKKQD-RILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNL-GTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLK 318          
The following BLAST results are available for this feature:
BLAST of hemipterous vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP2K72.206e-10046.25mitogen-activated protein kinase kinase 7 [Source:... [more]
MAP2K75.073e-10046.25mitogen-activated protein kinase kinase 7 [Source:... [more]
MAP2K71.596e-9745.26mitogen-activated protein kinase kinase 7 [Source:... [more]
MAP2K64.755e-7040.54mitogen-activated protein kinase kinase 6 [Source:... [more]
MAP2K45.919e-6941.77mitogen-activated protein kinase kinase 4 [Source:... [more]
back to top
BLAST of hemipterous vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mek-13.627e-8846.54Dual specificity mitogen-activated protein kinase ... [more]
jkk-18.178e-6445.02Dual specificity mitogen-activated protein kinase ... [more]
mkk-42.556e-6243.07MAP kinase kinase mkk-4 [Source:UniProtKB/Swiss-P... [more]
sek-11.742e-6140.79Dual specificity mitogen-activated protein kinase ... [more]
sek-11.742e-6140.79Dual specificity mitogen-activated protein kinase ... [more]
back to top
BLAST of hemipterous vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hep1.474e-9346.75gene:FBgn0010303 transcript:FBtr0330397[more]
hep1.474e-9346.75gene:FBgn0010303 transcript:FBtr0073748[more]
hep8.975e-8946.54gene:FBgn0010303 transcript:FBtr0340303[more]
hep9.742e-8946.54gene:FBgn0010303 transcript:FBtr0073747[more]
hep9.809e-8946.54gene:FBgn0010303 transcript:FBtr0330396[more]
back to top
BLAST of hemipterous vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k79.970e-9641.83mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k71.008e-9541.83mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k72.262e-8938.62mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k72.397e-8938.62mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k4a2.789e-7040.91mitogen-activated protein kinase kinase 4a [Source... [more]
back to top
BLAST of hemipterous vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d232.731e-9846.50TBC1 domain family member 23 [Source:Xenbase;Acc:X... [more]
tbc1d235.009e-9846.50TBC1 domain family member 23 [Source:Xenbase;Acc:X... [more]
tbc1d234.018e-9544.92TBC1 domain family member 23 [Source:Xenbase;Acc:X... [more]
tbc1d235.631e-9544.92TBC1 domain family member 23 [Source:Xenbase;Acc:X... [more]
tbc1d234.704e-9342.62TBC1 domain family member 23 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of hemipterous vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map2k71.174e-10146.56mitogen-activated protein kinase kinase 7 [Source:... [more]
Map2k72.715e-10146.56mitogen-activated protein kinase kinase 7 [Source:... [more]
Map2k73.972e-10146.56mitogen-activated protein kinase kinase 7 [Source:... [more]
Map2k76.609e-10146.56mitogen-activated protein kinase kinase 7 [Source:... [more]
Map2k79.339e-10146.56mitogen-activated protein kinase kinase 7 [Source:... [more]
back to top
BLAST of hemipterous vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4KSH7|MP2K7_RAT7.249e-10046.56Dual specificity mitogen-activated protein kinase ... [more]
sp|O14733|MP2K7_HUMAN1.059e-9946.25Dual specificity mitogen-activated protein kinase ... [more]
sp|Q8CE90|MP2K7_MOUSE4.186e-9846.56Dual specificity mitogen-activated protein kinase ... [more]
sp|Q23977|HEP_DROME9.765e-8846.54Dual specificity mitogen-activated protein kinase ... [more]
sp|Q21307|MEK1_CAEEL4.614e-8746.54Dual specificity mitogen-activated protein kinase ... [more]
back to top
BLAST of hemipterous vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A089H0430.000e+099.40Hemipterous OS=Schmidtea mediterranea OX=79327 PE=... [more]
A0A4S2LFC37.028e-11856.77Protein kinase domain-containing protein OS=Opisth... [more]
A0A183NVF92.735e-11755.98Protein kinase domain-containing protein OS=Schist... [more]
A0A183N3J43.034e-11755.69Protein kinase domain-containing protein OS=Schist... [more]
H2KQT13.319e-11560.67Dual specificity mitogen-activated protein kinase ... [more]
back to top
BLAST of hemipterous vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k75.487e-9545.25mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k71.180e-9445.25mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k4b1.424e-7041.46dual specificity mitogen-activated protein kinase ... [more]
map2k4b4.688e-7041.46dual specificity mitogen-activated protein kinase ... [more]
map2k4b5.113e-7041.46dual specificity mitogen-activated protein kinase ... [more]
back to top
BLAST of hemipterous vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k75.460e-10047.32mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k4b1.807e-7239.34mitogen-activated protein kinase kinase 4b [Source... [more]
map2k62.258e-7140.68mitogen-activated protein kinase kinase 6 [Source:... [more]
ENSPMAT00000004725.15.171e-5136.62pep scaffold:Pmarinus_7.0:GL477683:141377:157028:-... [more]
stk25a3.907e-3434.87serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of hemipterous vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PBS29.800e-4838.43MAP kinase kinase of the HOG signaling pathway; ac... [more]
MKK16.242e-4136.33MAPKK involved in the protein kinase C signaling p... [more]
MKK21.665e-3835.98MAPKK involved in the protein kinase C signaling p... [more]
STE73.088e-3532.23Signal transducing MAP kinase kinase; involved in ... [more]
KIC13.890e-3130.82Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of hemipterous vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433844.114e-9950.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380624.668e-7141.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484084.406e-6841.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455531.289e-4934.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407401.532e-4031.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of hemipterous vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k71.589e-9545.22mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k72.575e-9545.22mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k73.283e-9545.22mitogen-activated protein kinase kinase 7 [Source:... [more]
map2k4a1.376e-7139.55mitogen-activated protein kinase kinase 4 [Source:... [more]
map2k4a2.957e-7139.55mitogen-activated protein kinase kinase 4 [Source:... [more]
back to top
BLAST of hemipterous vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007331.10.000e+099.48SMESG000007331.1[more]
SMESG000007331.10.000e+099.48SMESG000007331.1[more]
SMESG000000893.17.178e-12495.59SMESG000000893.1[more]
SMESG000057661.16.480e-6741.67SMESG000057661.1[more]
SMESG000040748.11.445e-5538.21SMESG000040748.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025593
GenBankAIP89945.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025593 ID=SMED30025593|Name=hemipterous|organism=Schmidtea mediterranea sexual|type=transcript|length=2604bp
CTTTGTTTGACTTTGCATAATAAATAGCGCGACATTTTGTTGGCAATGCT
AAAATTTTTATTATAACGTTGTAAATGATTTTATCTATGCATAGAAATAG
ACCTAATAAATTAATTACAACTAATACAAGGTCATGTTCTCCATCAACAA
AGTTTTCTATCGAAAATACTGATACTCATGTGTCACCACACTCACCATCA
TCAATTGACAAACTAAATATTAATGAATTAAAAGATGAACTGTTTCAGAA
AAGCGGATTATTGACAATAAACAATGAAAAAATTACTACAAAGATGGACG
AATTTGAAATAGAATCTAGTTTAGGTCATGGAACATGTGGTAACGTTTAT
CGAATGCGTCTTAAACGATTACCATCAATACCAATGGCTGTGAAACAGAT
GAGACGTAGTTCTCATTCAGTTGAGGAAAATAAAAGAATTTTCCGTGATC
TCGATGTTGTAACCAGATGTCATGATTGTCCATTTATTGTTACATGCTAT
GGAATATTCATATCTCCGAGTGAGGTGTGGATTTGCATGGAAGAAATGTC
AACCTGCCTCGATAAATTGCTCAAATTTCTTAACTGCCCTTTCCCAGAAT
ATGTAATTGGAAAAGTCTCTTGTGCAATCATTAAAGCTCTACAGTATCTT
AAAACCAAGCACGACATTATGCACCGAGATATAAAACCGTCGAATATGTT
GCTCAGTGATCGTGGAGAAGTTAAATTATGTGACTTTGGTATCAGTGCGA
AACTCAAGGATTCAATCGCTAACTCACGACAACCCGGTTGTATTGGTTAT
ATGGCCCCCGAAAGACTAAATTCTTCAACTTACGACGTAAGGGCCGATGT
TTGGTCACTTGGGATGAGCTTAGTTGAATTAGCAATTGGGAAATTTCCTA
TAGATGGATTGAAATCTGAATTTGAAATAATGGCTCGTATTATCGATGGA
AAGCCTCCTTCATTACCAGAAGGCGTGTATTCCGAGGCATTCAATAAATT
CGTATCTTCCTGTCTGCAAAAAGATTTCAATAATCGTCCGAAATATGATA
AATTGGTGTCTGCAGATTTCTATCGGATGCACAATGTCGAACCGTTGGAT
ATATTGCGCTGGTATCGATCTGTTAATCACAAACCGATCGTCGCCAATAA
ACCGACTAGTATCAATGCAAATGCTTTAATTAACTCCTGTCAGACCTCGT
CGGGATATGCATCCGCATGTTCCGATAGCAGTCCCGGCTCACTCGGCAGT
CAGAGTCGATCTCCGAGCTCGTCTCAGTTGCAGCAAGAAACCAGTGGGGG
TTTACTGCCTCCAAACTCCTCAGCCTCGTTGTCATTGGTTACCAATGTCC
GATCGAACAATTTCACACTCATCCATCAGCTGACGAGAAATCTCCACATC
AACTCTCAGCCGACATCGGCTCTCTCGTCGATACCCCAGGAGTCGTCCAA
TGAGACCGCCAATTCCCATTCTCACTCGAACAACAATAATATCCTCCACT
CACCGAAACCTGAATTCTCGAACAATGACAAATCATCTTTCACCAATCTG
AAACATCGAAGATATTTTCTAAGACTCCTCAATTCGTCGATCGATGAAAC
CTATCAATCGAAAAAACTCGTCGATCCTTTTGTGTTTCCTACAAGTTGCT
CATCGTCATCCTCCTCAGCAGCAGCAGTGGCGGTGTCATCCTCAATTCGA
GGTAGCAGAAAGGTCTGTCGGAAGTATTGCATCGGCCCGGTCGACCATAA
ATCCGTTGTCATTAGCAACAACAGTAAATGCTGCACTAATTCAACAAAAC
CCAACAATCTCGTCCAGCAATCATCATCATCATCATCATCATTCAATTCC
GTTAACAATGACAACAACCGTCTCACTGGATCGGAAACGATTTTCATCGG
AAATTCTGAAACAATTATCAAAGAAATCAAGTCTAATTCCGAAGCAGATT
TCCACGAAAATAATTCTCCGAAAGAAATTGATTCTACAGAGGATTATTTC
TCCATGAAAATTCCGATGAAGTTCCAAGCAGTTGAAAACAGAAATAATAA
TCTCGAAATAATCTTTCGGGAAAAGATAAATTTCAATGCATCAGAAATTG
AAAACCAATTGTTCCATTTTCCCAAGCAATTCGTCTCTCCAGTGGAATCG
ATTTCGACAAAGCACTTTCCGAGTAATTGTTGTCGAGTGTCAGAGAGAGA
ATCTCTTTGTAAAATCGATTCCATTCGGAAATCCAGCAAAAGTGCCGACA
TTTCTATGGAAAACAAAACAATCAATTTCAGAAACAATCAAAACCTCACA
GAATTATCATTATTATCATCCCAAACTGCGAACTCGACTGGATTTGTTGT
CGCGGATTCTTCACATATTCAATTGTCAAAGAGAGAGAAAAACTCTTTTT
TCTCAAAATTTTGGTTATTAATTGTTGCTTTGATTTTGATTTTGATTTTC
GTTCTCGTACTCTACAAAGATCAACTTTCTCAGATTTGCAATTGTCTCGC
ATTCGGCCAATTGCTTTATCCAAAGATTTCATCATCTGGCCATCCAGTTT
AGCAGTTGACGTTTCTCGGTCTTGATCAGTTATTAATTATATACTCATTT
TAAC
back to top

protein sequence of SMED30025593-orf-1

>SMED30025593-orf-1 ID=SMED30025593-orf-1|Name=SMED30025593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=826bp
MILSMHRNRPNKLITTNTRSCSPSTKFSIENTDTHVSPHSPSSIDKLNIN
ELKDELFQKSGLLTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLP
SIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSE
VWICMEEMSTCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMH
RDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNS
STYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPEG
VYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYRMHNVEPLDILRWYRSV
NHKPIVANKPTSINANALINSCQTSSGYASACSDSSPGSLGSQSRSPSSS
QLQQETSGGLLPPNSSASLSLVTNVRSNNFTLIHQLTRNLHINSQPTSAL
SSIPQESSNETANSHSHSNNNNILHSPKPEFSNNDKSSFTNLKHRRYFLR
LLNSSIDETYQSKKLVDPFVFPTSCSSSSSSAAAVAVSSSIRGSRKVCRK
YCIGPVDHKSVVISNNSKCCTNSTKPNNLVQQSSSSSSSFNSVNNDNNRL
TGSETIFIGNSETIIKEIKSNSEADFHENNSPKEIDSTEDYFSMKIPMKF
QAVENRNNNLEIIFREKINFNASEIENQLFHFPKQFVSPVESISTKHFPS
NCCRVSERESLCKIDSIRKSSKSADISMENKTINFRNNQNLTELSLLSSQ
TANSTGFVVADSSHIQLSKREKNSFFSKFWLLIVALILILIFVLVLYKDQ
LSQICNCLAFGQLLYPKISSSGHPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation