porcupine-like protein

Overview
Nameporcupine-like protein (ABW97518.1)
Smed IDSMED30025591
Uniprot Best hit3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Pdpk1 PE=1 SV=2 (E=1.63933e-110)
Length (bp)3526
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of porcupine-like protein (SMED30025591) t-SNE clustered cells

Violin plots show distribution of expression levels for porcupine-like protein (SMED30025591) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of porcupine-like protein (SMED30025591) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for porcupine-like protein (SMED30025591) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

porcupine-like protein ( porcn-A ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the digestive system and gut

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30025591

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30025591SMESG000051516.1 dd_Smed_v4_413_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
gutSMED30025591SMESG000051516.1 dd_Smed_v4_413_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
intestinal phagocyteSMED30025591SMESG000078720.1 Contig5235GPL15192PMID:23079596FACS sorted cell populationasexual adultcDNA to DNA expression microarray evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:23318635whole organismasexual adultcolorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:18063757whole organismasexual adultcolorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:22125640whole organismasexual adultcolorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:20707997whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791.1smed_ncbi_20200123PMID:29557542whole organismasexual adultcolorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 SMESG000051515.1 SMED30025591smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 SMESG000051515.1 SMED30025591smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 SMESG000051515.1 SMED30025591smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791smed_ncbi_20200123PMID:18063757whole organismasexual adultcolorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 EU130791smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30025591SMESG000051516.1 ABW97518.1smed_ncbi_20200123PMID:20707997whole organismasexual adultfluorescence in situ hybridization evidence
intestinal phagocyteSMED30025591SMESG000051516.1 dd_Smed_v6_413_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
intestinal phagocyteSMED30025591SMESG000051516.1 Contig5235GPL15192PMID:23079596FACS sorted cell populationasexual adultcDNA to DNA expression microarray evidence
Homology
BLAST of porcupine-like protein vs. Ensembl Human
Match: PDPK1 (3-phosphoinositide dependent protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:8816])

HSP 1 Score: 356.681 bits (914), Expect = 3.100e-110
Identity = 202/506 (39.92%), Postives = 293/506 (57.91%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI---------------------PVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + +       N+D +                       G  +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   54 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS 522          
BLAST of porcupine-like protein vs. Ensembl Human
Match: PDPK1 (3-phosphoinositide dependent protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:8816])

HSP 1 Score: 357.451 bits (916), Expect = 3.427e-110
Identity = 202/506 (39.92%), Postives = 293/506 (57.91%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI---------------------PVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + +       N+D +                       G  +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   81 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS 549          
BLAST of porcupine-like protein vs. Ensembl Human
Match: PDPK1 (3-phosphoinositide dependent protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:8816])

HSP 1 Score: 272.707 bits (696), Expect = 2.032e-80
Identity = 145/328 (44.21%), Postives = 208/328 (63.41%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + + + D
Sbjct:   81 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDED 371          
BLAST of porcupine-like protein vs. Ensembl Human
Match: MBOAT2 (membrane bound O-acyltransferase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25193])

HSP 1 Score: 251.521 bits (641), Expect = 4.398e-72
Identity = 150/443 (33.86%), Postives = 238/443 (53.72%), Query Frame = 1
Query: 1933 PLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGY--------DDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCST---DY---QRMHMT----RRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQL-YHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYF 3198
            PLSN + +P+DQ+NF+VC L ++      R     SK S   R ++    G+ + LFCFG+   + L+QS +SY I++ +  +   +    + + ++ +  + R++ +DYG Y+ D SGP+MI TQK+TSLA  + DG  R ++ +   QR+    AV+++P  +++  Y   F G+LAGP   Y +Y  +I G         ++       ++   +   +V+  LL   ++  F ++ +C+T   +Y   +    T     +I++  IS    R KYYFAW++ +A   + G G+ G D+NG   W  + N     IE  +S K+ +D WNI T  WL+ + YER   F  TI  F +SA WHG YPGYYL FLT  L T  AR +R + R  FI  P  L+L Y V+T I T +A++Y   PF LL  +  L F+  +Y+
Sbjct:   14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLF-HLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFI-EPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450          
BLAST of porcupine-like protein vs. Ensembl Human
Match: MBOAT1 (membrane bound O-acyltransferase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21579])

HSP 1 Score: 233.032 bits (593), Expect = 7.640e-66
Identity = 158/491 (32.18%), Postives = 249/491 (50.71%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYW-CMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESH--AVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHI-------------------PCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR---RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIIND--KVNIMNNVFTRKAQ 3303
            GST L PLS ++GIP+DQ+NF+VC L+++      R    P   S   R  +   FGI  V+FCFG+   +L +   + Y I++   S  + H  +++  M ++ I H+ R++ + YG  T D SGP+MI TQK+T+LAF + DG     G + +  + E H  A+K  P  +++  Y   F  V+AGP    N +K+YI   + KHI                   P     +   L ++++  LL   +   FP    C  D   +H      R+ +  +     + KYYFAW++ +A   + G G+ G DKNG   W  + N +   IE+ +S K+ ++ WNI T  WL+ + Y+R P +  T+L F +SA WHG YPGYY  FLT  L T  AR VR + R  F+ S     +Y   T   T LA++Y   PF +L  +  +  +K  YF+ H++++  +L L  +P  +   +   +N++  RK  
Sbjct:   16 GSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMV-TASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG----LGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPC---NNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFP--VTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQRRPQTLNSINKRKTD 495          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: pdk-1 (3-phosphoinositide-dependent protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y1J3])

HSP 1 Score: 263.462 bits (672), Expect = 1.717e-75
Identity = 159/510 (31.18%), Postives = 255/510 (50.00%), Query Frame = 1
Query:   79 ASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRIN-----HQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSE-IEVKRTSSPD--NSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNI-----EPIVQSNWDEIPVGFEEAWKFNI--------------------------------KKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEY 1473
            ++DF F + +G G++S V   +E++T+  +A K++ K ++++ + ++ ++ EK +L  ++     H F   L   F D  R+YF+I   E G+L   L     FD+  ++F+++EI+  L++LH   +VHRD+KP+N+L+ ++ HI I DFGSA       L    FT   Q  S              YSDE   ++   +  +      SP+     ++    D W LGCI++Q L+G+ PF    + ++Y + ++I+ L + FP GF + A + ++K+LV +P  R+ +        L AH  F ++D+  I + KPP+L   I     EP   SN   +  G ++   F +                                     E  +A + + L+ Q   NPFH F  N LI+KQG L K+RGLF R+RMFLLTEGPHL Y+D   +  K EV       +E+KN   F+I T  R Y+L D   KADEW ++I  +   Y
Sbjct:   66 SNDFMFLQSMGEGAYSQVFRCREVATDAMFAVKVLQKSYLNRHQKMDAIIREKNILTYLSQECGGHPFVTQLYTHFHDQARIYFVIGLVENGDLGESLCHFGSFDMLTSKFFASEILTGLQFLHDNKIVHRDMKPDNVLIQKDGHILITDFGSAQAFGGLQLSQEGFTDANQ-ASSRSSDSGSPPPTRFYSDEEEENTARRTTFVGTALYVSPEMLADGDVGPQTDIWGLGCILFQCLAGQPPF---RAVNQYHLLKRIQELDFSFPEGFPEEASEIIAKILVRDPSTRITS------QELMAHKFFENVDWVNIANIKPPVLHAYIPATFGEPEYYSNIGPVEPGLDDRALFRLMNLGNDASASQPSTPSNVEHRGDPFVSEIAPRANSEAEKNRAARAQKLEEQRVKNPFHIFTNNSLILKQGYLEKKRGLFARRRMFLLTEGPHLLYIDVPNLVLKGEVPWTPCMQVELKNSGTFFIHTPNRVYYLFDLEKKADEWCKAINDVRKRY 565          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: pdk-1 (3-phosphoinositide-dependent protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y1J3])

HSP 1 Score: 261.536 bits (667), Expect = 7.424e-75
Identity = 163/519 (31.41%), Postives = 257/519 (49.52%), Query Frame = 1
Query:   79 ASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRIN-----HQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTS--------SPD--NSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNI-----EPIVQSNWDEIPVGFEEAWKFNI----------------------------------KKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEY 1473
            ++DF F + +G G++S V   +E++T+  +A K++ K ++++ + ++ ++ EK +L  ++     H F   L   F D  R+YF+I   E G+L   L     FD+  ++F+++EI+  L++LH   +VHRD+KP+N+L+ ++ HI I DFGSA       L    FT   Q  S              YSDE     E   E   +RT+        SP+     ++    D W LGCI++Q L+G+ PF    + ++Y + ++I+ L + FP GF + A + ++K+LV +P  R+ +        L AH  F ++D+  I + KPP+L   I     EP   SN   +  G ++   F +                                       E  +A + + L+ Q   NPFH F  N LI+KQG L K+RGLF R+RMFLLTEGPHL Y+D   +  K EV       +E+KN   F+I T  R Y+L D   KADEW ++I  +   Y
Sbjct:   66 SNDFMFLQSMGEGAYSQVFRCREVATDAMFAVKVLQKSYLNRHQKMDAIIREKNILTYLSQECGGHPFVTQLYTHFHDQARIYFVIGLVENGDLGESLCHFGSFDMLTSKFFASEILTGLQFLHDNKIVHRDMKPDNVLIQKDGHILITDFGSAQAFGGLQLSQEGFTDANQ-ASSRSSDSGSPPPTRFYSDE-----EVPEENTARRTTFVGTALYVSPEMLADGDVGPQTDIWGLGCILFQCLAGQPPF---RAVNQYHLLKRIQELDFSFPEGFPEEASEIIAKILVRDPSTRITS------QELMAHKFFENVDWVNIANIKPPVLHAYIPATFGEPEYYSNIGPVEPGLDDRALFRLMNLGNDASASQPSTFRPSNVEHRGDPFVSEIAPRANSEAEKNRAARAQKLEEQRVKNPFHIFTNNSLILKQGYLEKKRGLFARRRMFLLTEGPHLLYIDVPNLVLKGEVPWTPCMQVELKNSGTFFIHTPNRVYYLFDLEKKADEWCKAINDVRKRY 569          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: mboa-3 (Lysophospholipid acyltransferase; Membrane Bound O-Acyl transferase, MBOAT [Source:UniProtKB/TrEMBL;Acc:G5EC53])

HSP 1 Score: 234.572 bits (597), Expect = 4.929e-67
Identity = 149/464 (32.11%), Postives = 225/464 (48.49%), Query Frame = 1
Query: 1906 FYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSK-------------KQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQ--FRPI 3252
            FY GS IL PL+  +GI  D++NF++      G+  + R      +++   R ++ A  GI IV FCFG  +K+LL  +  SY I+ F P      +V  + M ++  +H YR       Y+LD++GP+M+  +K T +AFNL DG   +Q    +++  ES  +K++P  ++F  + F F  VL GP    N Y +YI   D+KH+   K             K   S   L+++  L   Y         V +  Y  +   +   +  I+ F +R  YYFAW   +A    +G G+ G DK G   W    N     +E   SLK  +DGWNI T  WLR++ YERAP   RT+  +T+SA WHG   GYY+ F T  LFT  A+T R+ +R  F+        Y + + I + +AL Y    F  +         K  YF  H++A   +  L   F+P+
Sbjct:    7 FYDGSKILEPLAETIGIEADRVNFVLSLFACFGISYVYRKTCSLKQVNRQVRTVVPAVVGIGIVFFCFGRAIKHLLANALGSYAIMYFAPPTQVHKIVLLFSMGYLFFIHCYRWAI-LESYSLDVTGPIMVAVEKATMMAFNLKDGKAKDQSKLTEEQKRES--LKEIPSLLEFMSFMFNFQTVLTGP---ANNYYDYIKFLDEKHLVADKHGKLPSPTGAAMKKFYQSLFFLAIVVTLGGKYKVED-----VGTQPYFALPFFQWFFWWFITIFFIRCAYYFAWVFADAICNMSGFGFSGYDKEGNAEWKLCTNVLPYQVEMAQSLKETLDGWNIQTGFWLRKVGYERAPKSIRTVATYTLSAVWHGVSIGYYMAFFTCGLFTVAAQTFRRSMRWRFLDDHNKKFAYDIFSFIISKIALAYATYSFVTMHMYPAYDVLKRVYFIPHIVAFAVIFALPKFFKPL 459          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: mboa-3 (Lysophospholipid acyltransferase; Membrane Bound O-Acyl transferase, MBOAT [Source:UniProtKB/TrEMBL;Acc:G5EC53])

HSP 1 Score: 234.572 bits (597), Expect = 4.929e-67
Identity = 149/464 (32.11%), Postives = 225/464 (48.49%), Query Frame = 1
Query: 1906 FYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSK-------------KQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQ--FRPI 3252
            FY GS IL PL+  +GI  D++NF++      G+  + R      +++   R ++ A  GI IV FCFG  +K+LL  +  SY I+ F P      +V  + M ++  +H YR       Y+LD++GP+M+  +K T +AFNL DG   +Q    +++  ES  +K++P  ++F  + F F  VL GP    N Y +YI   D+KH+   K             K   S   L+++  L   Y         V +  Y  +   +   +  I+ F +R  YYFAW   +A    +G G+ G DK G   W    N     +E   SLK  +DGWNI T  WLR++ YERAP   RT+  +T+SA WHG   GYY+ F T  LFT  A+T R+ +R  F+        Y + + I + +AL Y    F  +         K  YF  H++A   +  L   F+P+
Sbjct:    7 FYDGSKILEPLAETIGIEADRVNFVLSLFACFGISYVYRKTCSLKQVNRQVRTVVPAVVGIGIVFFCFGRAIKHLLANALGSYAIMYFAPPTQVHKIVLLFSMGYLFFIHCYRWAI-LESYSLDVTGPIMVAVEKATMMAFNLKDGKAKDQSKLTEEQKRES--LKEIPSLLEFMSFMFNFQTVLTGP---ANNYYDYIKFLDEKHLVADKHGKLPSPTGAAMKKFYQSLFFLAIVVTLGGKYKVED-----VGTQPYFALPFFQWFFWWFITIFFIRCAYYFAWVFADAICNMSGFGFSGYDKEGNAEWKLCTNVLPYQVEMAQSLKETLDGWNIQTGFWLRKVGYERAPKSIRTVATYTLSAVWHGVSIGYYMAFFTCGLFTVAAQTFRRSMRWRFLDDHNKKFAYDIFSFIISKIALAYATYSFVTMHMYPAYDVLKRVYFIPHIVAFAVIFALPKFFKPL 459          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: mboa-4 (Membrane Bound O-Acyl transferase, MBOAT [Source:UniProtKB/TrEMBL;Acc:H9G2W5])

HSP 1 Score: 219.164 bits (557), Expect = 2.403e-61
Identity = 141/489 (28.83%), Postives = 237/489 (48.47%), Query Frame = 1
Query: 1906 FYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKK-------------QLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCG-KDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQ--FRPIINDKVNIMNNVFTRKAQYRFQKLK 3324
            FY   T+L P+S  + + +DQ+NF+   LLS GLG   R +F     S +TR  +    G++   FC+G  + +L +    SY++++ +P Q     V  + M ++ ++H YR  Y    Y LD++G +M+   K+T LA  + DG  + +  K      +  AVK++P  + F  Y F F  V+ GP   Y+ +  ++   + KH+P ++K             +  +A+  SV++ +L +Y+    P            ++    + T+ +  + R  YYFAW++ ++    +G GY G  D+  E  WS+  N   + +E G + K +VD WNI T  WLR ++YER     RT+ V+   A WHG   GYY  FLT +LFT  A T R+ +R  F+ + +   +Y +   + +  A+ Y   PFY++ F   L  ++      H +A+F  L L   F P    K+   N   T     R  ++ 
Sbjct:   15 FYDPVTLLRPVSRAISMNLDQLNFVTVLLLSFGLGYWFRVQF--CDASRTTRAAVTTSVGLIFTYFCYGNAIAHLFINGFGSYLLMVSVPPQHVHKSVFAFAMGYLVLIHSYRWMYQ-KTYCLDVTGSMMVAVGKITLLASAITDG--MGRDPKALNSGQKRDAVKEVPSLLDFASYMFNFQTVIVGPMNHYSTWSAFL---ELKHVPKNEKTGKPYDPTSTAMKKFEAAIAFSVVYTILGSYL----PMSLTNDPSINEYNLLIWWLITVAASTVHRLPYYFAWTISDSICNISGFGYDGLADETLEPKWSRTTNVKPLLVEFGQNYKEMVDNWNIWTVAWLRRVVYERVEGPYRTLAVYVTGAAWHGLAVGYYFSFLTSALFTLSAATFRRCMRHRFLGNSMHKLMYDIFGMLVSKFAIGYIHWPFYVMHFWPSLFMYRKLLMIPHFIALFIYLYLPQIFSPQPKSKITGPNASATSVNTDRISEIS 491          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (gene:FBgn0020386 transcript:FBtr0072467)

HSP 1 Score: 297.745 bits (761), Expect = 1.771e-86
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  163 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 684          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (gene:FBgn0020386 transcript:FBtr0072466)

HSP 1 Score: 297.745 bits (761), Expect = 1.771e-86
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  163 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 684          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (gene:FBgn0020386 transcript:FBtr0072465)

HSP 1 Score: 297.745 bits (761), Expect = 1.771e-86
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  163 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 684          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (gene:FBgn0020386 transcript:FBtr0072468)

HSP 1 Score: 297.745 bits (761), Expect = 7.913e-86
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  227 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 748          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (gene:FBgn0020386 transcript:FBtr0333218)

HSP 1 Score: 297.745 bits (761), Expect = 1.033e-85
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  244 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 765          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: pdpk1a (3-phosphoinositide dependent protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-061013-109])

HSP 1 Score: 357.836 bits (917), Expect = 6.288e-111
Identity = 202/500 (40.40%), Postives = 286/500 (57.20%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFEEAWKF--------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            K  DF FGK +G GSFSTV++AKE++T K YA KI++K  I K+   + V+ EK++L  I+H FFV L +TFQD ++LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH + ++HRD+KPENILL E+MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WA+GCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+P +RLG    G    LK H  F ++ +E +  Q PP L P +  + +       N++++   F                    NI++   +++             +K+ LLQ Q   NP+H+FV N LI K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +    Y
Sbjct:   62 KKEDFSFGKILGEGSFSTVVLAKELATGKEYAMKILEKNHIRKENKAHYVIREKDILSCIDHPFFVKLFFTFQDSQKLYFALSYAKNGELLRYIRKIGSFDETCTRFYTAEIVCALEYLHTVGIIHRDLKPENILLCEDMHIQITDFGTAKQLSSDSAQTRANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWAMGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVQRLLSLDPRKRLGCEEMGGFGPLKGHMFFETVSWENLPLQTPPKLTPYLPAMAEDDEDYYGNYEDLLSQFSSLQVVPSSSAQIVPPRPCSNIEQYIHDLDSNSFELDLQFSSEEKRLLLQKQTSGNPWHQFVENNLIYKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEVWGTVY 524          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: pdpk1a (3-phosphoinositide dependent protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-061013-109])

HSP 1 Score: 358.221 bits (918), Expect = 8.053e-111
Identity = 202/500 (40.40%), Postives = 286/500 (57.20%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFEEAWKF--------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            K  DF FGK +G GSFSTV++AKE++T K YA KI++K  I K+   + V+ EK++L  I+H FFV L +TFQD ++LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH + ++HRD+KPENILL E+MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WA+GCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+P +RLG    G    LK H  F ++ +E +  Q PP L P +  + +       N++++   F                    NI++   +++             +K+ LLQ Q   NP+H+FV N LI K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +    Y
Sbjct:   73 KKEDFSFGKILGEGSFSTVVLAKELATGKEYAMKILEKNHIRKENKAHYVIREKDILSCIDHPFFVKLFFTFQDSQKLYFALSYAKNGELLRYIRKIGSFDETCTRFYTAEIVCALEYLHTVGIIHRDLKPENILLCEDMHIQITDFGTAKQLSSDSAQTRANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWAMGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVQRLLSLDPRKRLGCEEMGGFGPLKGHMFFETVSWENLPLQTPPKLTPYLPAMAEDDEDYYGNYEDLLSQFSSLQVVPSSSAQIVPPRPCSNIEQYIHDLDSNSFELDLQFSSEEKRLLLQKQTSGNPWHQFVENNLIYKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEVWGTVY 535          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1820])

HSP 1 Score: 349.362 bits (895), Expect = 1.624e-107
Identity = 204/514 (39.69%), Postives = 287/514 (55.84%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDE------------------IPVGFEEAW-KFNIKKEFQE-----------ME------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            R  +  DF+FGK +G GSFSTV++AKE +T K YA KI++K  I K+     V  E++++  ++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FYSAEI+ ALEYLH   ++HRD+KPENILLSE MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+  +R+G    G +  LK+HP F S+ ++ +  Q PP L   +  + +       N+D+                  +PV  E +   +N      +           ME        +K+ LL  Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +  + Y
Sbjct:   53 RKKRPEDFRFGKILGEGSFSTVVLAKEHTTGKEYAIKILEKRHIMKENKAQYVKRERDIMSHLDHPFFVKLYFTFQDEEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHQKGIIHRDLKPENILLSEEMHIQITDFGTAKQLSSDSKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVEQLLSLDSCKRIGCDEMGGYGPLKSHPFFESVGWDDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFSCMQVAQPGPAPLVPVTGETSQPTYNPSPSVDQFIHIHELDSNSMELDLQYSNEEKRILLDKQSAANPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEVWRKIY 529          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: mboat2b (membrane bound O-acyltransferase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-041001-185])

HSP 1 Score: 261.151 bits (666), Expect = 7.382e-76
Identity = 153/468 (32.69%), Postives = 237/468 (50.64%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDG-----HRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKH----------------IPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDY-QRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRP 3249
            GS +L P+S +  +P+DQ+NF+VC L ++      R    PSK S   R ++    GI   LFCFG+   + LLQS ++Y I++    +          + +++   + R++ +DYG Y+ D +GP+M+ TQK+TS+AF + DG      ++NQG KL        A++++P  +++F Y   F G+LAGP   YN+Y  +I G   +H                 P    ++   L    I  L+   V   FP       D+        ++++  +S    R KYYF W++ +A   + G G+ G D +G   W  + N   + IE  +S KV +D WNI T  WL+ + YER P +  T   F +SA WHG YPGYYL FLT  + T  AR VR ++RP F+ SP    +Y V+T   T +A+ Y   PF LL     L F++ +YF  H+  +   + L  +P
Sbjct:   11 GSNLLQPISEMTNLPLDQVNFVVCQLCALLTAVWFRLYLHPSKTSPFVRHVVATLLGIYFALFCFGWYALHFLLQSGITYGIMILTGVEHMHKYCLVVALGYLSFCQITRVYVFDYGMYSADFTGPMMVITQKITSVAFEIHDGMARKVEQLNQGQKLL-------AIRRMPSLLEYFSYNCNFMGILAGPTCSYNDYIAFIEGTPYRHRDLEPKGKVNGKSRLNDPSPNTEVIRKLSTCFISLLVFLSVCKVFPVERNVDDDFIATSPFYVQVVYLYLSMLTTRPKYYFVWTLADAINNAAGFGFNGYDSDGSPRWDLLSNIRILNIELATSFKVFLDNWNIQTAHWLKRVCYERCP-YNPTAATFLLSAMWHGAYPGYYLTFLTGIVITLAARAVRHNVRPHFLGSPSHKFVYDVITWAATQIAICYTVVPFVLLSVGPSLKFYRSWYFCLHIGCILLAIALPVKP 470          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: mboat2a (membrane bound O-acyltransferase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-041210-257])

HSP 1 Score: 254.988 bits (650), Expect = 9.946e-74
Identity = 151/468 (32.26%), Postives = 248/468 (52.99%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITG--YDDKHIPCSKKQ-------------------LSSALCLSVIHGLLTAYVAPQFPY-IFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR 3246
            GST+L P+S ++ +P+DQ+NF+VC L ++      R    PSK S   R ++    G  + LFCFG+   + L+QS ++Y +++F   +          M +++  H+ R++ +DYG Y+ D +GP+M+ TQK+TSLAF + DG  +  + +K  Q+     AV+K+P  +++  Y   F G+LAGP   YN+Y ++I G  Y+ KH+  + K+                    + ALCL++   + TA    +  +  F+ S  +       +++F  IS   +R KYYF W++ +A   + G G+ G + +G   W ++ N   + IE  +S K+ +D WNI T  WL+ + YER P +  T   F +SA WHG YPGYYL F+T    T  AR VR ++R  F+ S     +Y V+T   T +A+ Y   PF LL     + F++ +Y   H++ +   L L  +
Sbjct:    9 GSTLLQPISKMIDLPLDQVNFVVCQLFALVTAFWFRLYLHPSKTSPFIRHVVATLLGFYLALFCFGWYALHFLVQSGLAYGVMIFTSVEHMHKYCFVVTMGYLSFCHVTRVYVFDYGMYSADFTGPMMVITQKITSLAFEIHDGLVKREEHLKPSQK---YLAVRKMPSLLEYLSYNCNFMGILAGPTCSYNDYIDFIEGRGYESKHLETNGKENGKFKQIEPSPKRDVIQKVCTCALCLTIYLVIHTACPTERVTHESFMASNPFYI-----QVLFLYISMLSLRPKYYFVWTLADAINNAAGFGFNGYNTDGTPKWDRISNLRILNIEFATSFKMFLDNWNIQTALWLKRVCYERCP-YNPTAATFLLSAMWHGVYPGYYLTFVTGIAVTMAARAVRHNVRQHFLGSSTLKLIYDVITWFSTQIAICYTVVPFVLLAVGPSIKFYRSWYCCIHLICVLLALVLPVK 467          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: sema4a (sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A [Source:Xenbase;Acc:XB-GENE-5914424])

HSP 1 Score: 363.614 bits (932), Expect = 3.684e-113
Identity = 207/510 (40.59%), Postives = 294/510 (57.65%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF---------------------EEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            R  +  DFKFGK +G GSFSTV++AKE++T + YA KI+ K  I K+  V  V  EK+V+ R++H FFV L +TFQDPE+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A +   D   ++ +SF GTAQ+VSPE+L                      +E    ++S            D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLLV++P +RLG    G +  LKAHP F ++ ++ +  Q PP L   +  + +       N+D++   F                      +    NI++   +++           +A+K+ LL+ Q   N +H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +    Y
Sbjct:   28 RKKRPQDFKFGKILGEGSFSTVVLAKELTTGREYAVKILQKRHIMKENKVQYVNREKDVMSRLDHPFFVKLYFTFQDPEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVCALEYLHENGIIHRDLKPENILLSEDMHIQITDFGTAKVSSSDSKQVRANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIVYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLVIDPTKRLGCEELGGYGPLKAHPFFETVTWQDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFGCMQVATSASSPSLAPLEPLLSQRCGSNIEQYIHDLDNNSFELDLQFSEAEKRLLLEKQVGGNQWHQFVENNLIVKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRY 500          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: sema4a (sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A [Source:Xenbase;Acc:XB-GENE-5914424])

HSP 1 Score: 340.887 bits (873), Expect = 2.206e-104
Identity = 200/506 (39.53%), Postives = 283/506 (55.93%), Query Frame = 1
Query:   58 ENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF---------------------EEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESI 1461
            +  R  +  DFKFGK +G GSFSTV++AKE++T + YA KI+ K  I K+  V  V  EK+V+ R++H FFV L +TFQDPE+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A        K SS               S   + N+YS                +         I+   D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLLV++P +RLG    G +  LKAHP F ++ ++ +  Q PP L   +  + +       N+D++   F                      +    NI++   +++           +A+K+ LL+ Q   N +H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +
Sbjct:   52 QQPRKKRPQDFKFGKILGEGSFSTVVLAKELTTGREYAVKILQKRHIMKENKVQYVNREKDVMSRLDHPFFVKLYFTFQDPEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVCALEYLHENGIIHRDLKPENILLSEDMHIQITDFGTA--------KVSS---------------SDSKQGNTYS----------------KLFYQTLKYVIMCFSDLWALGCIVYQLVAGLPPF---RAGNEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLVIDPTKRLGCEELGGYGPLKAHPFFETVTWQDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFGCMQVATSASSPSLAPLEPLLSQRCGSNIEQYIHDLDNNSFELDLQFSEAEKRLLLEKQVGGNQWHQFVENNLIVKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEV 515          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: sema4a (sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A [Source:Xenbase;Acc:XB-GENE-5914424])

HSP 1 Score: 340.502 bits (872), Expect = 4.848e-104
Identity = 200/503 (39.76%), Postives = 282/503 (56.06%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF---------------------EEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESI 1461
            R  +  DFKFGK +G GSFSTV++AKE++T + YA KI+ K  I K+  V  V  EK+V+ R++H FFV L +TFQDPE+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A        K SS               S   + N+YS                +         I+   D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLLV++P +RLG    G +  LKAHP F ++ ++ +  Q PP L   +  + +       N+D++   F                      +    NI++   +++           +A+K+ LL+ Q   N +H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +
Sbjct:   76 RKKRPQDFKFGKILGEGSFSTVVLAKELTTGREYAVKILQKRHIMKENKVQYVNREKDVMSRLDHPFFVKLYFTFQDPEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVCALEYLHENGIIHRDLKPENILLSEDMHIQITDFGTA--------KVSS---------------SDSKQGNTYS----------------KLFYQTLKYVIMCFSDLWALGCIVYQLVAGLPPF---RAGNEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLVIDPTKRLGCEELGGYGPLKAHPFFETVTWQDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFGCMQVATSASSPSLAPLEPLLSQRCGSNIEQYIHDLDNNSFELDLQFSEAEKRLLLEKQVGGNQWHQFVENNLIVKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEV 536          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: sema4a (sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A [Source:Xenbase;Acc:XB-GENE-5914424])

HSP 1 Score: 340.502 bits (872), Expect = 6.465e-104
Identity = 200/503 (39.76%), Postives = 282/503 (56.06%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF---------------------EEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESI 1461
            R  +  DFKFGK +G GSFSTV++AKE++T + YA KI+ K  I K+  V  V  EK+V+ R++H FFV L +TFQDPE+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A        K SS               S   + N+YS                +         I+   D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLLV++P +RLG    G +  LKAHP F ++ ++ +  Q PP L   +  + +       N+D++   F                      +    NI++   +++           +A+K+ LL+ Q   N +H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +
Sbjct:   81 RKKRPQDFKFGKILGEGSFSTVVLAKELTTGREYAVKILQKRHIMKENKVQYVNREKDVMSRLDHPFFVKLYFTFQDPEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVCALEYLHENGIIHRDLKPENILLSEDMHIQITDFGTA--------KVSS---------------SDSKQGNTYS----------------KLFYQTLKYVIMCFSDLWALGCIVYQLVAGLPPF---RAGNEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLVIDPTKRLGCEELGGYGPLKAHPFFETVTWQDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFGCMQVATSASSPSLAPLEPLLSQRCGSNIEQYIHDLDNNSFELDLQFSEAEKRLLLEKQVGGNQWHQFVENNLIVKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEV 541          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: sema4a (sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A [Source:Xenbase;Acc:XB-GENE-5914424])

HSP 1 Score: 340.117 bits (871), Expect = 6.675e-104
Identity = 200/503 (39.76%), Postives = 282/503 (56.06%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF---------------------EEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESI 1461
            R  +  DFKFGK +G GSFSTV++AKE++T + YA KI+ K  I K+  V  V  EK+V+ R++H FFV L +TFQDPE+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A        K SS               S   + N+YS                +         I+   D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLLV++P +RLG    G +  LKAHP F ++ ++ +  Q PP L   +  + +       N+D++   F                      +    NI++   +++           +A+K+ LL+ Q   N +H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +
Sbjct:   75 RKKRPQDFKFGKILGEGSFSTVVLAKELTTGREYAVKILQKRHIMKENKVQYVNREKDVMSRLDHPFFVKLYFTFQDPEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVCALEYLHENGIIHRDLKPENILLSEDMHIQITDFGTA--------KVSS---------------SDSKQGNTYS----------------KLFYQTLKYVIMCFSDLWALGCIVYQLVAGLPPF---RAGNEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLVIDPTKRLGCEELGGYGPLKAHPFFETVTWQDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFGCMQVATSASSPSLAPLEPLLSQRCGSNIEQYIHDLDNNSFELDLQFSEAEKRLLLEKQVGGNQWHQFVENNLIVKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEV 535          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 356.681 bits (914), Expect = 2.234e-110
Identity = 204/512 (39.84%), Postives = 295/512 (57.62%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   51 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS 525          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 356.295 bits (913), Expect = 7.359e-110
Identity = 204/512 (39.84%), Postives = 295/512 (57.62%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS 552          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 331.257 bits (848), Expect = 5.150e-101
Identity = 192/481 (39.92%), Postives = 277/481 (57.59%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVT 1389
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHT 521          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 273.863 bits (699), Expect = 6.132e-81
Identity = 146/334 (43.71%), Postives = 209/334 (62.57%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + + + D
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDED 374          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Mboat2 (membrane bound O-acyltransferase domain containing 2 [Source:MGI Symbol;Acc:MGI:1914466])

HSP 1 Score: 254.218 bits (648), Expect = 3.559e-73
Identity = 145/447 (32.44%), Postives = 229/447 (51.23%), Query Frame = 1
Query: 1933 PLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYI------------TGYDDKH---IPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAM 3219
            PLSN + +P+DQ+NF+VC L ++      R     SK S   R ++    G+ +  FCFG+   + L+QS +SY I++    +        + + ++++  + R++ +DYG Y+ D SGP+MI TQK+TSLA+ + DG  R ++ +   QR     AV+++P  +++  YT  F G+LAGP   Y +Y  +I             G D++H    P     ++  L +  +  L    ++   P  +     +Q       +  +  +S    R KYYFAW++ +A   + G G+ G DKNG   W  + N     IE  +S K+ +D WNI T  WL+ + YERA  F  TI  F +SA WHG YPGYYL FLT  L T  AR VR + R  F+  P     Y ++T + T + ++Y   PF LL  +    F+  +Y+  HV ++
Sbjct:   14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMQQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGL---AVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTIQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVPFVLLSIKPSFTFYSSWYYCLHVCSI 456          
BLAST of porcupine-like protein vs. UniProt
Match: sp|O55173|PDPK1_RAT (3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Pdpk1 PE=1 SV=2)

HSP 1 Score: 360.533 bits (924), Expect = 1.639e-110
Identity = 206/522 (39.46%), Postives = 296/522 (56.70%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD---------------------------EIPVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGSFKLSPGTCTQ 1512
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F SI +E +  Q PP L   +  + + + D                            +     +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S   SP    Q
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPDSKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSAVDASLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS---SPDAAVQ 559          
BLAST of porcupine-like protein vs. UniProt
Match: sp|O15530|PDPK1_HUMAN (3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PDPK1 PE=1 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.646e-109
Identity = 202/506 (39.92%), Postives = 293/506 (57.91%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI---------------------PVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + +       N+D +                       G  +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   81 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS 549          
BLAST of porcupine-like protein vs. UniProt
Match: sp|Q9Z2A0|PDPK1_MOUSE (3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus OX=10090 GN=Pdpk1 PE=1 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 5.147e-109
Identity = 204/512 (39.84%), Postives = 295/512 (57.62%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS 552          
BLAST of porcupine-like protein vs. UniProt
Match: sp|Q9W0V1|PDPK1_DROME (3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster OX=7227 GN=Pdk1 PE=1 SV=4)

HSP 1 Score: 297.745 bits (761), Expect = 1.036e-84
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  244 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 765          
BLAST of porcupine-like protein vs. UniProt
Match: sp|Q6A1A2|PDPK2_HUMAN (Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PDPK2P PE=5 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 2.103e-79
Identity = 144/328 (43.90%), Postives = 208/328 (63.41%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+M+I+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + + + D
Sbjct:   54 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMYIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDED 344          
BLAST of porcupine-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20338972 (tr|B1NWW2|B1NWW2_SCHMD Porcupine-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=Porcn-a PE=2 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 337/337 (100.00%), Postives = 337/337 (100.00%), Query Frame = 1
Query: 2299 QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR 3309
            QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR
Sbjct:    1 QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR 337          
BLAST of porcupine-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20907512 (tr|F1CDE0|F1CDE0_SCHPL Porcupine-1 (Fragment) OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 328/337 (97.33%), Postives = 334/337 (99.11%), Query Frame = 1
Query: 2299 QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR 3309
            QTQKLTSLAFNLLDGHRI+QG+KL Q+NHESHAV+KLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSL TFCAR+VRKHIRPLF+VSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVN MNNVFTRKAQYR
Sbjct:    1 QTQKLTSLAFNLLDGHRIDQGMKLDQKNHESHAVRKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLSTFCARSVRKHIRPLFVVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNQMNNVFTRKAQYR 337          
BLAST of porcupine-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17181164 (tr|C1L448|C1L448_SCHJA Putative 3-phosphoinositide dependent protein kinase-1 OS=Schistosoma japonicum OX=6182 GN=hPDK1 PE=2 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 4.482e-163
Identity = 242/496 (48.79%), Postives = 342/496 (68.95%), Query Frame = 1
Query:   49 TKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEF----QEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS-----FKLSPGTCT 1509
            T   N+   K SDFKFGKEIGHGSFSTV + +EIST+  +A K++DK  + + + V++V++EKEVL+R NH F + L+ TFQD  RL++++ YA  GELLS+LT  +   + CT+FY+AEI++AL+YLH +++VHRD+KPEN+LL++ MHIK+ DFGSA+I++ P++K  +FTGT ++VSPEML        +  S + NS S +             NS+++ YLMDFWA GCI+YQ++SG  PF      HEYE FQKI +L Y F   FD  AKD V KLLV++P ERLG+PS G   +++ H  F  I ++ +  Q+PPLL+PN+EPI    WD++PVGFE+A K+++ +E      E+ + D+ +LL  QE+ NPF+RFVR RLI+KQGIL+KRRGLF+RKRMFLLTEGPHLFYVD + M  K EV+ +    +EV+++K+F+I    +TY+LEDPS  AD+W + I ++  +Y+       F   P T T
Sbjct:    6 TNEINRHIPKPSDFKFGKEIGHGSFSTVYVVQEISTSSEFAMKVVDKQRVWRYKAVDSVLMEKEVLKRTNHVFIIRLHCTFQDSTRLFYLLEYARCGELLSYLTHFTSLSVHCTRFYAAEILMALDYLHSVSIVHRDLKPENVLLTDRMHIKLADFGSAVILNSPNIKAPNFTGTPEYVSPEML--------SRISRQGNSSSND------------GNSQDLTYLMDFWAFGCIIYQLISGFPPFRKSGPAHEYETFQKILSLSYTFASNFDPIAKDLVEKLLVISPSERLGSPSHGGSVSVRQHMFFSEIKWDTLPHQEPPLLVPNLEPIAPEGWDDLPVGFEDAEKYHLSRELSLVASEITEDDRIRLLNTQERHNPFNRFVRGRLILKQGILFKRRGLFSRKRMFLLTEGPHLFYVDMENMTLKGEVAWSSSLTLEVRSNKLFFIHVPNKTYYLEDPSGHADDWVKQIAAVKTQYFSDTPQTLFSNYPSTST 481          
BLAST of porcupine-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22930518 (tr|A0A4S2MBV1|A0A4S2MBV1_OPIFE Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001158 PE=4 SV=1)

HSP 1 Score: 498.819 bits (1283), Expect = 3.720e-161
Identity = 234/472 (49.58%), Postives = 325/472 (68.86%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEFQE----MEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            + SDF+FGKEIG GSFS V + +EI++N   A K+++K  + + + V +V +EK VL R+NH F + L+YTFQD  RL+F++ YA  GELL+HL RL+ FDL C++FY+AEI++AL YLH  ++VHRDIKPEN+LL+E MHIK+ DFGSAII++ P +K   FTGT ++VSPEML         S++DE +  S      E           +  YLMD+WA GC++YQ++SGR PF      H Y+IF++I  L Y+F  GFD  A+D V KLLV+NP++RLG+P++G  AA++ HP F  ID++ + +Q  P+LLPN+EPI  S+WD +P GF+E   + +  EF      + + ++ +LL  QE+ NP+HRFVRNRLI+KQG+L+KRRGLF RKRMFLLTEGPHLFYVD DAM  K EV  +    +E+K+DK+F+I    RT++LEDPS KA  W   + ++   YY 
Sbjct:   32 RPSDFRFGKEIGQGSFSNVYVVREIASNAELAMKVVEKQHVVRNKAVESVHMEKAVLTRVNHVFIIRLHYTFQDASRLFFVLEYARGGELLTHLNRLTSFDLPCSRFYAAEILVALNYLHTQSIVHRDIKPENVLLTEAMHIKLADFGSAIILNDPKVKAPGFTGTPEYVSPEMLS------SRSFADESSLSSSHSFSFE-----------DTAYLMDYWAFGCVLYQLISGRPPFRTEKHHHAYDIFEQILGLCYKFLDGFDAVARDLVQKLLVINPMDRLGSPTNGGPAAVQEHPFFSGIDWDSLPNQPAPILLPNLEPIAPSDWDSLPTGFDEGQMYLLSCEFASAVTPIPETERSRLLSAQERQNPYHRFVRNRLILKQGVLFKRRGLFARKRMFLLTEGPHLFYVDMDAMSLKGEVPWSSFLTLELKSDKLFFIRIPNRTFYLEDPSGKAAAWVAQLSAVKQAYYA 486          
BLAST of porcupine-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16243131 (tr|A0A183A8J4|A0A183A8J4_9TREM Protein kinase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3279 PE=4 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 5.073e-160
Identity = 243/472 (51.48%), Postives = 328/472 (69.49%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHA-ALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEF----QEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            + SDF+FGKEIG GSFSTV + +E++TN  +A K++DK  + + R V +V++EKEVL+R NH F + L YTFQD  RL++++ YA  G LL +LTRL+ FD+ C +FY+AEI +ALEYLH   +VHRD+KPEN+LL+ENMHIK+ DFGSAII++   +K  SFTGT ++VSPEML  S  +R +   DE N +++     + K   +P +  E  YLMD+WA GC++YQ LSGR PF    + H YE F KI NL Y F  GFD  AKD V +LLV++PL+RLG+P++G    A++ H  F+ ID++ + +Q PP+L PN+EPI  + WD  P GF+E  KF    E      ++   ++ KLL  QE+ NPFHRFVRNRLIIKQGIL+KRRGLF RKRMFLLTEGPHLFYVD D+M  K EV  +    +E K+DK+F+I+   RTY+LEDPS  A +W + I ++   Y+
Sbjct:   16 RPSDFRFGKEIGQGSFSTVYVVREVATNAEFAMKVVDKQHVRRNRAVESVIMEKEVLKRTNHIFIIRLYYTFQDESRLFYVLEYARGGALLDYLTRLTSFDIPCARFYAAEIFIALEYLHKQCIVHRDLKPENVLLTENMHIKLADFGSAIILNDSKVKAPSFTGTPEYVSPEML--SPCSRIDEDDDEDNDEAK-----QTKTEPNPYSYEETAYLMDYWAFGCVIYQFLSGRPPFRPERNGHAYETFGKILNLSYSFADGFDPVAKDLVKQLLVIDPLKRLGSPANGNGPRAIQTHEFFQGIDWDTLPNQNPPILHPNVEPIAPAGWDTAPQGFKEIEKFLTSNELGLSASQVTDNERPKLLALQERQNPFHRFVRNRLIIKQGILFKRRGLFARKRMFLLTEGPHLFYVDVDSMNLKGEVLWSSFLTLEQKSDKLFFIIVPNRTYYLEDPSGNASDWVEQISAVHSIYF 480          
BLAST of porcupine-like protein vs. Ensembl Cavefish
Match: pdpk1a (3-phosphoinositide-dependent protein kinase 1 [Source:NCBI gene;Acc:103022926])

HSP 1 Score: 355.91 bits (912), Expect = 5.040e-110
Identity = 203/513 (39.57%), Postives = 290/513 (56.53%), Query Frame = 1
Query:   64 QRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF----------EEAWKF-----------NIKKEFQEMEK-----------ADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            QR  +A DFKFGK +G GSFSTV++AKE+ST K YA KI++K  I K+   + V  E+++L  +++ FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AE++ AL+YLH + ++HRD+KPENILL+E MHI+I DFG+A     D    + +SF GTAQ+VSPE+L                           K+++   +        D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLL  +  +RLG    G +  L+AHP F  + +E +  Q PP L P +  + +       N+D++   F           +A              NI++   +++             +K  LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DP+  AD W + I+ +    Y S
Sbjct:   58 QRKKRAEDFKFGKILGEGSFSTVVLAKELSTGKEYAIKILEKTHIRKENKAHYVKRERDILSSLDNPFFVKLYFTFQDAEKLYFGLSYAKNGELLRYIRKIGSFDETCTRFYTAELVSALQYLHSVGIIHRDLKPENILLNEEMHIQITDFGTAKQFSSDSTQTRANSFVGTAQYVSPELL--------------------------TKKSACKSS--------DLWALGCIVYQLVAGLPPFR---AANEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLCSDATKRLGCEEMGGYNPLRAHPFFEGVSWENLHLQTPPKLTPYLPAMAEDDEEYYGNYDDLLSQFTNLEVVQSTSSQALSLPATLVPLRSSSNIEQYIHDLDNNSFELDLQFSSEEKLLLLKKQTNGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEPKNFKTFFVHTPHRTYYLMDPNGNADRWCKKIQEVWGTIYHS 533          
BLAST of porcupine-like protein vs. Ensembl Cavefish
Match: pdpk1b (3-phosphoinositide-dependent protein kinase 1 [Source:NCBI gene;Acc:103033547])

HSP 1 Score: 353.984 bits (907), Expect = 2.474e-109
Identity = 206/518 (39.77%), Postives = 287/518 (55.41%), Query Frame = 1
Query:   49 TKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFE---------------------------------------EAWKFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESI 1461
            ++    R  +  DFKFGK +G GSFSTV++AKE ST K YA KI++K  I K+     V  E++V+  ++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FYSAEI+ ALEYLH   ++HRD+KPENILLSE MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AK+ V +LL+L+P +R+G    G +  LK+HP F SI ++ +  Q PP L P +  + +       N+D++   F                                        ++    +  +F E E   K+ LL  Q   NP+H+FV N LI K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +
Sbjct:   47 SQPAQPRKKRPEDFKFGKILGEGSFSTVVLAKEHSTGKEYAIKILEKRHIMKENKAQYVKRERDVMSILDHPFFVKLYFTFQDEEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHQKGIIHRDLKPENILLSEEMHIQITDFGTAKQLSSDSRQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKNLVEQLLLLDPCKRIGCEEMGGYEPLKSHPFFESISWDDLHLQTPPKLTPYLPAMSEDDEDCYGNYDDLLSQFSSMQVAQPGPTPSADEPSESLLPVCNPAPSVDQFIHIHELDSNSMELDLQFSEEE---KRLLLDKQSAANPWHQFVENNLIFKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEV 524          
BLAST of porcupine-like protein vs. Ensembl Cavefish
Match: pdpk1b (3-phosphoinositide-dependent protein kinase 1 [Source:NCBI gene;Acc:103033547])

HSP 1 Score: 330.102 bits (845), Expect = 8.458e-101
Identity = 199/520 (38.27%), Postives = 281/520 (54.04%), Query Frame = 1
Query:   49 TKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAA--KIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFE---------------------------------------EAWKFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESI 1461
            ++    R  +  DFKFGK +G GSFSTV +   ++    Y    KI++K  I K+     V  E++V+  ++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FYSAEI+ ALEYLH   ++HRD+KPENILLSE MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AK+ V +LL+L+P +R+G    G +  LK+HP F SI ++ +  Q PP L P +  + +       N+D++   F                                        ++    +  +F E E   K+ LL  Q   NP+H+FV N LI K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +
Sbjct:   23 SQPAQPRKKRPEDFKFGKILGEGSFSTVHVLL-VNNVCFYVCLVKILEKRHIMKENKAQYVKRERDVMSILDHPFFVKLYFTFQDEEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHQKGIIHRDLKPENILLSEEMHIQITDFGTAKQLSSDSRQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKNLVEQLLLLDPCKRIGCEEMGGYEPLKSHPFFESISWDDLHLQTPPKLTPYLPAMSEDDEDCYGNYDDLLSQFSSMQVAQPGPTPSADEPSESLLPVCNPAPSVDQFIHIHELDSNSMELDLQFSEEE---KRLLLDKQSAANPWHQFVENNLIFKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEV 501          
BLAST of porcupine-like protein vs. Ensembl Cavefish
Match: mboat2b (membrane-bound O-acyltransferase domain-containing protein 2-like [Source:NCBI gene;Acc:103039741])

HSP 1 Score: 258.84 bits (660), Expect = 3.671e-75
Identity = 151/464 (32.54%), Postives = 248/464 (53.45%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCS-------KKQLSS-ALCLSVIHGLLTAYVAPQFPYIFVC-------STDYQRMHMT---RRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRP 3249
            GS++L P+S ++ +P+DQ+NF+VC L ++      R    PSK S   R ++    G+   LFCFG+   + L+QS ++Y I++    +          +A++    + R++ +DYG Y+ D +GP+M+ TQK+TS+AF + DG    +  +L Q + +  A++++P  +++F Y   F G+LAGP   Y +Y  +I G   +H           K +L+  +  + V+  L T +++    ++ VC       +TD   +  T    ++++  +S    R KYYF W++ +A   + G G+ G D +G+  W  + N   M IE  +S KV +D WNI T  WL+ + YER P +  T   F +SA WHG YPGYYL FLT  + T  AR VR ++RP F+ SP    +Y V+T   T +A+ Y   PF LL     L F++ +YF  H+  +   + L  +P
Sbjct:   11 GSSLLQPISEIINLPLDQVNFVVCQLCALLTAFWFRLYLHPSKTSPFVRHVVATLLGLYFALFCFGWYALHFLMQSGITYGIMIIAGVEHMHKYCLVVALAYLGFCQITRVYVFDYGMYSADFTGPMMVITQKITSIAFEIHDGMARKED-QLTQ-SQKLLAIRRMPSLLEYFSYNCNFMGILAGPTCSYKDYIAFIEGKPFRHRELENNGKLQGKTRLNDPSPNMEVVRKLGTCFLS-LLVFLSVCKVFPVERNTDDDFIATTPIYAKVVYLYLSMLTTRPKYYFVWTLADAINNAAGFGFNGYDSDGKPQWDLISNLRIMNIELATSFKVFLDNWNIQTAHWLKRVCYERCP-YNPTAATFLLSAMWHGAYPGYYLTFLTGIVVTLAARAVRHNVRPYFLGSPTHKFVYDVITWASTQIAICYTVVPFVLLSVGPSLKFYRSWYFCLHIGCVLLAIALPVKP 470          
BLAST of porcupine-like protein vs. Ensembl Cavefish
Match: mboat2a (membrane-bound O-acyltransferase domain-containing protein 2-like [Source:NCBI gene;Acc:103046785])

HSP 1 Score: 247.669 bits (631), Expect = 3.472e-71
Identity = 156/473 (32.98%), Postives = 245/473 (51.80%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDG-HRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYI--TGYDDKHI--------------PCSKKQL-----SSALCLSVIHGLLTAY-VAP-----QFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR 3246
            GST+L P+S ++ +P+DQ+NF+VC L ++      R    PSK S   R ++    G  + LFCFG+   + L+QS ++Y I++F   +          + ++ +  + R++ +DYG Y+ D +GP+M+ TQK+TSLAF + DG  +  + +K  Q+     AV+K+P  +++  Y   F G+LAGP   YN+Y  +I  TGY  KH+              P  K+ +     + ALCL V    LT Y + P     Q PY       +       R+++  +S   +R KYYF W++ +A   + G G+ G +K+G   W  + N   + IE  +S K  +D WNI T  WL+ + YER P +  T   F +SA WHG YPGYYL F++    T  AR VR ++R  F+ S     +Y V+T   T +A+ Y   PF +L     L F+  +YF  H+  +  +L L  +
Sbjct:   10 GSTVLQPISEMIDLPLDQVNFVVCQLFALFTACWFRLYLHPSKTSPFIRHVVATLLGFYLALFCFGWYALHFLVQSGLTYGIMIFTGLEHMHRYSFVVALGYLMLCQITRVYVFDYGMYSADFTGPMMVITQKITSLAFEIHDGLTKKEEHLKPSQK---YLAVRKMPSLLEYLSYNCNFLGILAGPTCSYNDYIAFIEGTGYQHKHLESNGKENGKCKQSDPSPKRDVILKMSTCALCLLV---YLTFYRICPVDRVIQDPY-------FTSQPFYLRVLYIYLSMLCLRPKYYFVWTLADAINNAAGFGFNGYNKDGTPKWDMISNLRILDIEFATSFKSFLDNWNIQTALWLKRVCYERCP-YHPTAATFLLSAMWHGVYPGYYLTFVSGIGVTLAARAVRHNVRQHFLGSSTHKLIYDVITWASTQIAICYTVVPFVVLAVGPSLRFYWSWYFCLHLACVILILALPVK 468          
BLAST of porcupine-like protein vs. Ensembl Sea Lamprey
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1820])

HSP 1 Score: 357.836 bits (917), Expect = 7.029e-112
Identity = 207/519 (39.88%), Postives = 292/519 (56.26%), Query Frame = 1
Query:   55 AENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF------------------------------------EEAWKFNIKKEFQ-EMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            A + R  +  DFKFGK +G GSFSTV++AKE++T K YA KI++K  I K++ V  V  EKEVL R+NH FFV L +TFQD E+LYF +SYA+ GE+L ++ +   FD  CT+FYSA+I+ +LE+LH + ++HRD+KPENILL+E+MHI+I DFG+A I+  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V KLLV +P++RLG    G +  LK+HP F  I ++ +  Q PP L   +  + +       N+D++  GF                                    E   + +++ +F   + + D++ LL  Q + NP+H FV N LI K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DP   A  W + IE +    Y
Sbjct:   13 AAHPRKKRPEDFKFGKILGEGSFSTVVLAKEVATGKEYAIKILEKRHIIKEKKVPYVNREKEVLSRLNHPFFVKLFFTFQDEEKLYFGLSYAKNGEMLKYIRKHRSFDENCTRFYSAQIVSSLEHLHSLGIIHRDLKPENILLNEDMHIQITDFGTAKILSDNSKHARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---APNEYLIFQKIIKLEYEFPEKFFPKAKDLVEKLLVSDPMQRLGCDECGGYPPLKSHPFFSEISWDDLHLQTPPKLTAYLPAMTEDDEECYGNYDDLLSGFGNMQVEETQPIPIPSVARVPSSGGCSSGGSYRDYILENEDEHSLELDFNLALSQDDRKLLLNKQARANPWHPFVENNLIFKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSRELRPEAKNFKTFFVHTPNRTYYLMDPRCNAHTWCKKIEEVWKRTY 494          
BLAST of porcupine-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 2.463e-44
Identity = 108/330 (32.73%), Postives = 169/330 (51.21%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHG-INVVHRDIKPENILLSENMHIKICDFG--SAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            ++F + K +G G+F  V++ +E +T ++YA KI+ K  I  +  V   + E  VL+   H F   L Y+FQ  +RL F++ Y   GEL  HL+R   F    T+FY AEI+ AL+YLH   NVV+RD+K EN++L ++ HIKI DFG     I D   +K  +F GT ++++PE+L       DN Y                               +D+W LG ++Y+M+ GR+PF+  +  HE ++F+ I      FP    + A+  +S LL  +P +RLG   D     ++ H  F  I ++ +  +K   + P  +P V S  D
Sbjct:  148 NNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMK--TFCGTPEYLAPEVL------EDNDYG----------------------------RAVDWWGLGVVMYEMMCGRLPFY--NQDHE-KLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMR-HSFFAGIIWQDVYDRK---MTPPFKPQVASETD 434          
BLAST of porcupine-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.081 bits (414), Expect = 8.939e-44
Identity = 103/316 (32.59%), Postives = 159/316 (50.32%), Query Frame = 1
Query:   73 TKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVL-RRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPP 1017
             K SDF F   +G GSF  V++AK  S    YA K++ K  I +++    +M E+ VL + + H F V L+Y+FQ  ++LYF++ Y   GEL  HL R   F  +  QFY+AEI  A+ YLH +N+V+RD+KPENILL    HI + DFG       P     +F GT ++++PE+L   K   D +                                +D+W LGC++Y+ML G  PF+ ++ +  YE    I +   +      + A   +  LL  +P +RLG  SD     +K H  F +I++  + +++ P
Sbjct:   87 AKPSDFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVL--KKHPYDRT--------------------------------VDWWCLGCVLYEMLYGLPPFYSKNLKQMYE---SILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSD--ILEIKNHVFFSTINWNDLDAKRIP 363          
BLAST of porcupine-like protein vs. Ensembl Sea Lamprey
Match: MBOAT2 (membrane bound O-acyltransferase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25193])

HSP 1 Score: 155.992 bits (393), Expect = 4.534e-42
Identity = 92/330 (27.88%), Postives = 163/330 (49.39%), Query Frame = 1
Query: 1966 QINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTY-WCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDK---------------HIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDY-QRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRE 2898
            Q+NF++C LL++ +    R    P   S   R  +    G    +FCFG+   +  +Q   SY I++ + ++ + H  T+ + M ++ +  + R++ +  G ++ D SGP+M+ TQK+TSLAF + DG  + +Q + ++QR   S   ++LP  ++F  +   F  +LAGP   + +Y  +I G   K               H P     ++S L + ++  +    ++  FP        +     +  R+ +  +S    R KYYFAW++ +A   + G G+ G DKNG + W  V N +   IE+ +S K+ +D WNI T  WL+ 
Sbjct:    1 QVNFVMCQLLALAMAFFFRLYLHPRAASERVRHGLATLLGSYFAIFCFGWYATHFFVQVIASYAIIVLVDTR-NVHKYTFIFAMGYLTVCQISRVYIFTSGVFSTDFSGPMMVMTQKITSLAFEIHDGMIKEDQDLTVEQRRLAS---RRLPTLLQFLSFNLNFLSILAGPSSSFKDYTAFIEGSHYKGWERSGACGRENGPLHEPSPAAAVTSKLLMVLLSLVFYLTLSKAFPVSLNADEAFIASAPLHARLCYLYVSCQGGRPKYYFAWTLADAINNAAGFGFNGYDKNGRSKWDLVSNLNIWNIETATSFKMFIDNWNIQTALWLKR 326          
BLAST of porcupine-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.358e-37
Identity = 88/309 (28.48%), Postives = 155/309 (50.16%), Query Frame = 1
Query:  154 TNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEML---GFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQK--PPLLLPNIEPIVQSNWDE 1065
              +H + K   +  + K + V   + EK +L+ I+  F V L Y+F+D   LY ++ Y   GE+ SHL R+  F    ++FY+A+I+LA EYLH +++++RD+KPEN+L+ +  +I++ DFG A  +     +  +  GT ++++PE++   G++K                                      +D+WALG ++Y+M +G  PF    +    +I++KI + K  FP  F    KD +  LL ++  +R GN  +G +  +K H  F + D+  I  +K   P +     P   SN+D+
Sbjct:    3 VGQHVSLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKG---RTWTLCGTPEYLAPEIILSKGYNKA-------------------------------------VDWWALGVLIYEMAAGYPPF---FADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVN-DIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDD 267          
BLAST of porcupine-like protein vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 215.312 bits (547), Expect = 1.296e-57
Identity = 123/329 (37.39%), Postives = 185/329 (56.23%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQ-FFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIID-------KPD----LKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFE--IIGSQKPPLLLP 1029
            DFKFG  IG G++STVM+A  I T K YAAK+++K ++ +Q+ V  V IEK  L+++N+    V L  TFQD   LYF++ YA  G+ LS + +    D TC ++Y+A+II A++YLH   ++HRDIKPENILL   M IK+ DFG+A +++       KP+     +  SF GTA++VSPE+L       ++S++D                           Y  D WA GCI++QM++G+ PF    + +EY  FQK+  ++Y F  GF    +D V K+LV N   RL        + +K H  F+ ++F+   + S+ PP + P
Sbjct:  178 DFKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSPELL-------NDSFTD---------------------------YRCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLT------ISQIKEHHFFKDLNFKDGSVWSKTPPEIKP 463          
BLAST of porcupine-like protein vs. Ensembl Yeast
Match: PKH1 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh2p; PKH1 has a paralog, PKH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002898])

HSP 1 Score: 211.075 bits (536), Expect = 2.751e-57
Identity = 121/331 (36.56%), Postives = 184/331 (55.59%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINH-QFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII-----DKPDLKP--------SSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFE--IIGSQKPPLLLP 1029
            DFKFG+++G GS+S+V++A    + K YA K++ K ++ +Q+ V  V +EK  L+++N  +    L +TFQD   LYF++ YA  G+ L  + +    + TC ++Y+++II A++ LH I ++HRDIKPENILL +NM +K+ DFG+A I+     +  D KP         SF GTA++VSPE+L       +++Y+D                      SR      D WA GCI+YQML+G+ PF    + +EY  FQK+  ++Y F  GF    KD V KLLV +P +RL          +KAH  F  ++FE   +    PP + P
Sbjct:  124 DFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELL-------NDNYTD----------------------SR-----CDIWAFGCILYQMLAGKPPFK---AANEYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRL------TIKQIKAHLFFHEVNFEDGSVWDDNPPEIQP 411          
BLAST of porcupine-like protein vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 184.111 bits (466), Expect = 8.016e-49
Identity = 113/333 (33.93%), Postives = 173/333 (51.95%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEM---LGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLG-NPSDGKHAALKAHPLFRSIDFE--IIGSQKPPLLLPNIEPIVQSNWDE 1065
            DF   K IG GSF  VM  ++  T K YA K I K +I  +  V   + E+ VL R++  F V L ++FQ PE+LYF++++   GEL  HL +   FDL+  +FY+AE++ AL+ LH ++VV+RD+KPENILL    HI +CDFG   +  K D K  +F GT ++++PE+   LG++K                                      +D+W LG ++Y+ML+G  P+   +     ++++KI      FP GFD  AKD +  LL  +P  RLG N +D     ++ HP F  + ++  ++    PP        +  SN+DE
Sbjct:  346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKA-------------------------------------VDWWTLGVLLYEMLTGLPPY---YDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGYNGAD----EIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDE 634          
BLAST of porcupine-like protein vs. Ensembl Yeast
Match: ALE1 (Broad-specificity lysophospholipid acyltransferase; part of MBOAT family of membrane-bound O-acyltransferases; key component of Lands cycle; may have role in fatty acid exchange at sn-2 position of mature glycerophospholipids [Source:SGD;Acc:S000005701])

HSP 1 Score: 177.178 bits (448), Expect = 6.529e-47
Identity = 131/473 (27.70%), Postives = 223/473 (47.15%), Query Frame = 1
Query: 1918 STILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEA----FFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLY-RMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQG-IKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQL-------------SSALCL-SVIHGL----LTAYVAPQFPYIFVCSTD-YQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGEN-NWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYER------APLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFI----VSPITLQLYHVLTKIFT-NLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFC 3225
              +L  +    GI    + + +C L S  L  I++ + P  ++      II       FG+L ++  F    + L + +  +Y+I  F  S+   HL   + M  +AI H++ +   +    T+DI+   M+   KLTS A++  DG   ++   K    + +S AV+  P  +KF  Y F++  +L GP   Y ++  ++     + +P SKK +             +  L L  V+ GL    L+      FP  +V   D +       RI +  +  F+ R KYY AW++ E   +  GLGY G D   +   W +V+N D   +E+  + + +++ WN++T +WL+  +Y R       P F  T+  F  SAFWHG  PGYYL F T +L+  C +  R++ RP+F+    V+P+  +  + L  I+   LA  Y   PF +L+ +  L+ W   YF+ H++  F 
Sbjct:    6 DAVLTKIITNYGIDSFTLRYAICLLGSFPLNAILK-RIPEKRIGLKCCFIISMSMFYLFGVLNLVSGF----RTLFISTMFTYLISRFYRSKFMPHLNFMFVMGHLAINHIHAQFLNEQTQTTVDITSSQMVLAMKLTSFAWSYYDGSCTSESDFKDLTEHQKSRAVRGHPPLLKFLAYAFFYSTLLTGPSFDYADFDSWLNCEMFRDLPESKKPMRRHHPGERRQIPKNGKLALWKVVQGLAWMILSTLGMKHFPVKYVLDKDGFPTRSFIFRIHYLFLLGFIHRFKYYAAWTISEGSCILCGLGYNGYDSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMNTNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYRRNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYVHIIVAFS 473          
BLAST of porcupine-like protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 170.629 bits (431), Expect = 1.730e-46
Identity = 104/326 (31.90%), Postives = 172/326 (52.76%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            DF+  + +G GSF  V + +     ++YA K++ K  + + + V     E+ +L  + H F + +  TFQD ++++ I+ Y E GEL S L +   F     +FY+AE+ LALEYLH  ++++RD+KPENILL +N HIKI DFG A  +  PD+   +  GT  +++PE++           S +P + S                       +D+W+ G ++Y+ML+G  PF+  ++   YE   KI N +  FP  F++  KD +S+L+  +  +RLGN  +G    +K HP F+ + +E + S+   +  P   PI Q   D
Sbjct:   86 DFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV--PDVT-YTLCGTPDYIAPEVV-----------STKPYNKS-----------------------IDWWSFGILIYEMLAGYTPFYDSNTMKTYE---KILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTE-DVKNHPWFKEVVWEKLLSRN--IETPYEPPIQQGQGD 368          
BLAST of porcupine-like protein vs. Ensembl Nematostella
Match: EDO48026 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKQ3])

HSP 1 Score: 297.745 bits (761), Expect = 4.365e-92
Identity = 155/328 (47.26%), Postives = 208/328 (63.41%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKP---SSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEP 1041
            +  K SDF+FGK +G GS+STV +A+EIST K YA K+++K  I K++ V  V  EKEVL R+NH FFV L +TFQD ++LYF +SYA++GELL ++TRL  FD  CTQFYSAEII ALE+LHG+ ++HRD+KPENILL ENMHIKI DFG+A I++K + K    +SF GTAQ+VSPE+L   +  + +                                  D WALGCI+YQ+LSG  P+    + +EY+IFQKI    Y FP GF +  KD V +LL+L+P +RLG    G  + LK H  +  +D++ +   K P LLP + P
Sbjct:    2 KKKKTSDFRFGKLLGEGSYSTVYVAQEISTGKEYAIKVLEKRHIQKEKKVAQVSREKEVLSRLNHPFFVILYFTFQDRDKLYFGLSYAKKGELLPYITRLGSFDEKCTQFYSAEIISALEHLHGLQIIHRDLKPENILLDENMHIKITDFGTAKILNKDEEKNKGRNSFVGTAQYVSPELLTDKRACKSS----------------------------------DIWALGCIIYQLLSGLTPY---RAGNEYQIFQKIIKNDYSFPSGFPEIPKDLVEQLLILDPTKRLGCEECGGFSELKKHQFYEGVDWDGLPESKAPELLPYLPP 292          
BLAST of porcupine-like protein vs. Ensembl Nematostella
Match: EDO40788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6B5])

HSP 1 Score: 207.994 bits (528), Expect = 7.837e-59
Identity = 130/408 (31.86%), Postives = 210/408 (51.47%), Query Frame = 1
Query: 2020 RHKFPPSKLSGSTRGIIEAFFGILIVLF--CFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDG-HRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITG--YDDKHIPC------------SKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR---RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFW 3183
            R    PS++S  TR  +    G+ +     C+ + + + L+         +F  S      V+   M  ++  HLYR    YG Y LD +GP+MI TQK+  +AF++ DG  R    +  +Q+  +   +KK+P  +++FGY F++  +L GP   Y+EY ++ITG  ++ K  P             +KK     L  +++  ++    +P+FP     + D   +  T    R+++  +S    R +YYFA+   EA     GLG+ G D+ G  +W+K+ N +   +E   ++K+L+D WNIST  WLR ++Y+R     RT+  F +SAFWHGFY GYYL F+T  +    AR  R+ +R  F  S +T + Y V+T + T + + Y   PF LL+   GL FW
Sbjct:    3 RKVLHPSRVSSKTRQTVGLLAGLFLSWLKQCWSWFLLHFLMFCVYVLNSGVFSKSYAKNQYVSVVAMGILSAAHLYRQITVYGSYVLDYTGPLMIITQKIIYVAFSVHDGMGRDESNLNAEQKKEK---LKKVPSPLEYFGYVFHYSNILIGPVGTYHEYTDFITGTVFNTKVGPVGTCHTVPWAAFNTKKATVEKLSSAILCVVVFVVASPRFP--VASNADPYFIDNTPFIYRLIYAWLSIVATRMRYYFAFKAGEAINNICGLGFGGYDEEGNPSWNKMSNANITKLELAQNMKMLLDNWNISTAVWLRRIVYDRVTSH-RTLATFLLSAFWHGFYGGYYLTFITCQILVEAARVARRTLREHFQGSKMTSRFYDVITCVVTMVFVTYATVPFVLLDPWKGLRFW 404          
BLAST of porcupine-like protein vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 170.629 bits (431), Expect = 7.361e-47
Identity = 113/352 (32.10%), Postives = 186/352 (52.84%), Query Frame = 1
Query:   49 TKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDT-AKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQ--KPPLLLPNIEPIVQSNWDEIPVGFEEAWK 1095
            T+ +++RTT   DF+  K +G G+F  V++A++    + YA KI++   + + + V  V  EK +L  I H F V L +T  D   LY ++ YA  GEL ++L     F+     F+ +EI+ A++YLHG ++V+RD+KPENILL  + H+K+ DFG A  +     K  +  GT ++++PE++                  S+ H++                  +D+WALG ++Y+ML G  PF      + + I++KI + K E+P   D+T AKD + KLLV +   RLG+  +G    +K H  F+ ID+ ++  +  KPP+      P    N+D+ P   EE W+
Sbjct:    6 TRKKDKRTT-LQDFELSKTLGTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKEVHD---KTWTLCGTPEYLAPEII-----------------QSKGHNKA-----------------VDWWALGILIYEMLVGYPPF---FDDNPFGIYEKILSGKVEWPKHMDNTSAKDLIKKLLVHDRTRRLGSMKNGSE-DVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYP---EEDWR 312          
BLAST of porcupine-like protein vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 168.703 bits (426), Expect = 2.471e-45
Identity = 107/328 (32.62%), Postives = 167/328 (50.91%), Query Frame = 1
Query:   61 NQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVL-RRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFG-SAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDF-EIIGSQKPPLLLPNI 1035
            N    K SDF F K IG GSF  V ++K    +K YA K+++K  I K+     +M E+ VL + + H F V L+Y+FQ  ++LYF++ Y   GEL  HL R   F  +  +FY+AEI  A+ YLHG+ +++RD+KPENILL    HI + DFG     ID+     S+F GT ++++PE+L   K+  D S                                +D+W LG ++Y+M+ G  PF   +SR   E++  I +           +A+  +  LL  +  +RLG+  +G    ++ H  FRSI++ +++     P   PN+
Sbjct:   65 NNPKAKPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTT-STFCGTPEYLAPEVL--RKQDYDKS--------------------------------VDWWCLGAVLYEMMYGLPPF---YSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGS-GEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNV 353          
BLAST of porcupine-like protein vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 162.155 bits (409), Expect = 4.147e-41
Identity = 98/333 (29.43%), Postives = 171/333 (51.35%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLR-RINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            R     DF F K +G GSF  V++A+   T++ YA KI+ K  + +   V   MIE+ VL     H F   L+ +FQ  ERL+F++ Y   G+L+  + +   FD   ++FY+AE++LAL++LH   V++RD+K +N+LL  + HIK+ DFG       P    ++F GT  +++PE+L      ++  Y                             + +D+WALG ++Y+M++G+ PF    + +E ++F+ I +    +PV     A   +   +  N L+RLG       ++++ H  FR I+FE + +++   + P  +P ++S  D
Sbjct:  376 RKMTLKDFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQDDDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEIL------QEQPYG----------------------------FSVDWWALGVLMYEMMAGQPPF---EAENEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQ---INPPFKPKIRSRTD 668          
BLAST of porcupine-like protein vs. Ensembl Medaka
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1 [Source:NCBI gene;Acc:101164682])

HSP 1 Score: 353.984 bits (907), Expect = 2.215e-109
Identity = 207/513 (40.35%), Postives = 288/513 (56.14%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFE-----------------------------------EAWKFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            R  K  DFKFGK +G GSFSTV++A+E +T K +A KI++K  I K+  V  V  E++++  ++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FYSAEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+P +R+G    G +  LK HP F +I +  +  Q PP L P +  + +       N+D++   F                                    ++  F +  +F E E   K+ LL  Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +L    E KN K F++ T  RTY+L DPS  AD W + I+ +  + Y
Sbjct:   58 RKKKPEDFKFGKILGEGSFSTVVLAREHATGKEFAIKILEKRHIMKENKVQYVKRERDLMSSLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHIKGIIHRDLKPENILLSEDMHIQITDFGTAKQLSSDSKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVEQLLSLDPSKRIGCEEMGGYEPLKQHPFFDTISWCDLHLQTPPKLTPYLPAMSEDDEDCYGNYDDLLSQFSNMQVAQSSSSQSLSPHDSTPPQRSSSNIEQYIHDLDSNSFELDLQFTEEE---KRLLLDKQTIGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNRVLKGEIPWSLELRPEAKNFKTFFVHTPNRTYYLMDPSGNADRWCKKIQEVWRKIY 530          
BLAST of porcupine-like protein vs. Ensembl Medaka
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1 [Source:NCBI gene;Acc:101164682])

HSP 1 Score: 353.599 bits (906), Expect = 7.588e-109
Identity = 207/513 (40.35%), Postives = 288/513 (56.14%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFE-----------------------------------EAWKFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            R  K  DFKFGK +G GSFSTV++A+E +T K +A KI++K  I K+  V  V  E++++  ++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FYSAEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+P +R+G    G +  LK HP F +I +  +  Q PP L P +  + +       N+D++   F                                    ++  F +  +F E E   K+ LL  Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +L    E KN K F++ T  RTY+L DPS  AD W + I+ +  + Y
Sbjct:   88 RKKKPEDFKFGKILGEGSFSTVVLAREHATGKEFAIKILEKRHIMKENKVQYVKRERDLMSSLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHIKGIIHRDLKPENILLSEDMHIQITDFGTAKQLSSDSKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVEQLLSLDPSKRIGCEEMGGYEPLKQHPFFDTISWCDLHLQTPPKLTPYLPAMSEDDEDCYGNYDDLLSQFSNMQVAQSSSSQSLSPHDSTPPQRSSSNIEQYIHDLDSNSFELDLQFTEEE---KRLLLDKQTIGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNRVLKGEIPWSLELRPEAKNFKTFFVHTPNRTYYLMDPSGNADRWCKKIQEVWRKIY 560          
BLAST of porcupine-like protein vs. Ensembl Medaka
Match: mboat2a (membrane bound O-acyltransferase domain containing 2 [Source:NCBI gene;Acc:101170063])

HSP 1 Score: 250.366 bits (638), Expect = 3.944e-72
Identity = 146/449 (32.52%), Postives = 234/449 (52.12%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITG--YDDKH---------------IPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDY--QRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFF 3201
            GST+L PLS ++ +P+DQ+NF+ C L ++ +    R    PSK S   R ++    G  + LFCFG+   + L+QS +SY +++F   +          + ++ +  + R++ +DYG Y+ D +GP+M+ TQK+TS+AF + DG  + +       N +  A+ ++P  +++  Y   F G+LAGP   Y +Y  +I G  Y  +H                P  K  + S LC   I   +   +    P  +    DY  +   +  ++++  ++   +R KYYF W++ +A   + G G+ G +K+G   W  + N   + IE  +S K+ +D WNI T  WL+ + YER P+   T   F +SA WHG YPGYYL F+T    T  AR VR +IRP F+VS     +Y V+T   T +A++Y   PF LL   S L F+  +YFF
Sbjct:   11 GSTLLQPLSEIINLPLDQVNFVACQLFALLMAMWFRIYLHPSKTSPFIRHVVATLLGFYLALFCFGWYSLHFLVQSGLSYGVMIFAGLEHMHKYCFIVTLGYLIVCQITRVYVFDYGMYSADFTGPMMVITQKITSMAFEIHDG--LAKKESQLTPNQKYLAISRMPSLLEYLSYNCNFMGILAGPTCSYRDYMAFIEGTCYQARHQENANGKENGKFKQSEPSPKNDVISKLCTCAISLAVYLSLYKLLPVEYSID-DYFVKSTPLYLQVIYLYLAMLALRPKYYFVWTLADAINNAAGFGFNGYNKDGSPRWDLISNLRILDIEFATSFKLFLDNWNIQTALWLKRVCYERCPV-NPTAATFLLSAMWHGVYPGYYLTFVTGIGMTMAARAVRHNIRPYFLVSDSHKLVYDVITWACTQVAISYTVVPFVLLAVGSSLKFYSSWYFF 455          
BLAST of porcupine-like protein vs. Ensembl Medaka
Match: mboat1 (membrane bound O-acyltransferase domain containing 1 [Source:NCBI gene;Acc:101157881])

HSP 1 Score: 238.81 bits (608), Expect = 5.818e-68
Identity = 150/479 (31.32%), Postives = 231/479 (48.23%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESH--AVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLS------------------SALC--LSVIHGLLTAY--VAPQFPYIFVCSTDY-QRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNI 3273
            GS +L P+S  +G P+DQ+NFI C L  + +    R    PS      R  +    G+  ++FCFG+   ++L      YVI+L               M ++ +  + R+  ++YG  + D SGP+M+ TQ++T+L F L DG       K +Q   E    A+++ P  I++  Y   F  +L GP   Y +Y ++I G   +HI    KQ S                  +A+C  L V  G +  +  V    P  +    D+    H   R+ +   S    R K+YFAW++ +A   + G G+ G D+NG+ +W  V N + + IE+ +S K  +D WNI T  WL+ + Y+RAP   R  L F +SA WHG YPGYY  FLT    T  AR +RK +R  F+ S      Y ++T   T LA+ Y   PF LL     L +++  YF  H+L++  V+TL  +    D  ++
Sbjct:   14 GSKLLLPVSEYLGFPLDQVNFIACQLFGLAVAFWFRLYLKPSHFKPLVRHTVATLLGVTFLVFCFGWYATHILAIVVAIYVIILKADINHVHRYSMVTAMGYLTVCQVSRVFIFNYGVLSTDFSGPLMMVTQRITTLVFQLHDG----MCKKSEQLTSEQKLMAIRERPSLIEYLSYNLNFLSILVGPCSNYRDYIDFIEG---RHISRRLKQHSGSCNGHNGYDKTPDLSPLNAVCRKLLVCCGCMLTFLIVTRSLPIKYNVEPDFVNNAHFLTRLTYAFFSIQAARPKFYFAWTLADAVNNAAGYGFLGIDENGKPSWDLVSNLNIVGIETATSFKTFIDNWNIRTGVWLKTVCYDRAPKH-RLALTFILSALWHGVYPGYYFTFLTAIPITMAARAIRKRVRHHFLNSKGLKLGYDIVTWAATQLAICYTVMPFLLLSIDQTLTYYRSMYFHVHILSILAVITLHGKHKPKDASSV 484          
BLAST of porcupine-like protein vs. Ensembl Medaka
Match: mboat2a (membrane bound O-acyltransferase domain containing 2 [Source:NCBI gene;Acc:101170063])

HSP 1 Score: 219.164 bits (557), Expect = 2.043e-61
Identity = 141/451 (31.26%), Postives = 223/451 (49.45%), Query Frame = 1
Query: 1912 GGSTILAPLSNVMGIPVDQ-INFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITG--YDDKH---------------IPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDY--QRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFF 3201
            G  T+L P   +    V Q +NF+ C L ++ +    R    PSK S   R ++    G  + LFCFG+   + L+QS +SY +++F   +          + ++ +  + R++ +DYG Y+ D +GP+M+ TQK+TS+AF + DG + N                ++P  +++  Y   F G+LAGP   Y +Y  +I G  Y  +H                P  K  + S LC   I   +   +    P  +    DY  +   +  ++++  ++   +R KYYF W++ +A   + G G+ G +K+G   W  + N   + IE  +S K+ +D WNI T  WL+ + YER P+   T   F +SA WHG YPGYYL F+T    T  AR VR +IRP F+VS     +Y V+T   T +A++Y   PF LL   S L F+  +YFF
Sbjct:    6 GVCTLLLPFIMMTLKKVLQFVNFVACQLFALLMAMWFRIYLHPSKTSPFIRHVVATLLGFYLALFCFGWYSLHFLVQSGLSYGVMIFAGLEHMHKYCFIVTLGYLIVCQITRVYVFDYGMYSADFTGPMMVITQKITSMAFEIHDG-KTNV---------------RMPSLLEYLSYNCNFMGILAGPTCSYRDYMAFIEGTCYQARHQENANGKENGKFKQSEPSPKNDVISKLCTCAISLAVYLSLYKLLPVEYSID-DYFVKSTPLYLQVIYLYLAMLALRPKYYFVWTLADAINNAAGFGFNGYNKDGSPRWDLISNLRILDIEFATSFKLFLDNWNIQTALWLKRVCYERCPV-NPTAATFLLSAMWHGVYPGYYLTFVTGIGMTMAARAVRHNIRPYFLVSDSHKLVYDVITWACTQVAISYTVVPFVLLAVGSSLKFYSSWYFF 438          
BLAST of porcupine-like protein vs. Planmine SMEST
Match: SMESG000051515.1 (SMESG000051515.1)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 491/491 (100.00%), Postives = 491/491 (100.00%), Query Frame = 1
Query:   46 MTKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGSFKLSPGTCTQTP 1518
            MTKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGSFKLSPGTCTQTP
Sbjct:    1 MTKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGSFKLSPGTCTQTP 491          
BLAST of porcupine-like protein vs. Planmine SMEST
Match: SMESG000051516.1 (SMESG000051516.1)

HSP 1 Score: 1001.12 bits (2587), Expect = 0.000e+0
Identity = 484/484 (100.00%), Postives = 484/484 (100.00%), Query Frame = 1
Query: 1897 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR 3348
            MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR
Sbjct:    1 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR 484          
BLAST of porcupine-like protein vs. Planmine SMEST
Match: SMESG000066852.1 (SMESG000066852.1)

HSP 1 Score: 349.747 bits (896), Expect = 3.959e-108
Identity = 191/457 (41.79%), Postives = 273/457 (59.74%), Query Frame = 1
Query: 1897 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSK------KQLSSAL------------CLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHM-TRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHV 3210
            MS FY GS I  P+S+ +G+ VDQ NF+ C L++ G G I        K+S + R IIE   G+ + +FCFG Q+ +LL QS   Y+++  + ++ + + +  + + F+++ HL RM+YDYGGYT+DI+GP+MIQTQKL+SLAFNL DG RI +   L++  H  HA+ K P  ++FF Y FYFHG++ GPFVF  +Y  +I G  ++ +   K      K  S+ L            CL  + GLLT +V P F   +  + +Y +  M  + IM T++S FLVRQKYYFAWS+     + +GLG+ G  +  +  +  VKN+DF  IE G+S K ++D WN+ T  WLRE +Y+R P    T+ VF  S+ WHG+YPGYYL F++ +LFT  +R  RK+IRPL   + + L  Y VLT +   LALNY   PF  LE Q     W   +F  HV
Sbjct:    1 MSNFYSGSKIFQPVSDAVGLTVDQFNFMFCQLVASGFGFIFSRYLNTDKISPTFRHIIELVCGVSLTIFCFGSQIWHLLGQSISVYIMMNAMSTKSARYFILGFVLLFLSVAHLARMYYDYGGYTMDITGPLMIQTQKLSSLAFNLHDGQRIKKNEPLRRDYHRKHALLKYPTLLEFFSYMFYFHGIMVGPFVFLADYLRFIEGRQEEVLDNEKEKEYFRKNKSTILAGWPEIGFYVKSCL--VFGLLTIFVQPHFDPDYFKTDEYLQSGMFYKYIMLTIVS-FLVRQKYYFAWSIGSMSNIFSGLGFSGFSEERKPIYDVVKNFDFFKIELGTSTKSIIDNWNVGTIYWLRECVYDRIPRAYGTLAVFVCSSIWHGYYPGYYLCFMSLALFTEASRAGRKYIRPLVHKASLNLP-YDVLTSLLGMLALNYCAIPFTQLEVQLTFYIWSKMFFIVHV 453          
BLAST of porcupine-like protein vs. Planmine SMEST
Match: SMESG000074104.1 (SMESG000074104.1)

HSP 1 Score: 341.658 bits (875), Expect = 9.736e-106
Identity = 182/454 (40.09%), Postives = 263/454 (57.93%), Query Frame = 1
Query: 1897 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDK---------HIPCSKKQLSSA-------LCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHV 3210
            MS F+ GS IL P S  +G+ +DQ NF+ C + + G+G +       +K++ + + I E   GIL+ LFCFG Q+ YLL QS   YV++  L  + + + +  + + F+++ H+ RM+YDYG YTLDI+GP+MIQTQKL+SLAFNL+DG R+    KL++  H+ HA+   P  ++FF YTFYFHG++ GPFVF  +Y  +I G  D+         H   +K Q+ SA       L   V + LL  ++ P F   F+ S ++ +    +R +   I+ FLVRQKYY AW+M     L  GLG+ G D+  +  +  VKN+ F   E G+S K ++D WN+ T  WLRE +Y+R P    TI VFT SA WHG+YPGYYL F + +L T  AR  R+  R  F  + + L  Y + T   +   LN+   PF LL+ + G + WK  Y  G V
Sbjct:    1 MSNFHSGSKILLPFSEAVGLKIDQFNFLFCQISACGIGYLFSRYLSRAKINPNYKHISEIILGILLTLFCFGLQIWYLLAQSISVYVMMNVLSVRKARYCILIFVLFFLSVAHIGRMYYDYGSYTLDITGPLMIQTQKLSSLAFNLMDGQRVKNKEKLRKDYHQVHAINHYPTVLEFFSYTFYFHGLMVGPFVFLGDYLRFIEGRQDELLINEDDKNHFKRNKFQILSAWPEISFHLFSLVCYSLLFFFIEPYFKPEFLLSDEFYQNGFFKRYLLMTITMFLVRQKYYIAWTMGSITNLFAGLGFSGFDEKQQPKYHIVKNFHFSRTEFGTSAKTMIDHWNVGTAIWLRECVYDRVPHSIGTITVFTCSAIWHGYYPGYYLAFASVALMTNAARCGRRLFRTYFHNAGLKLP-YDITTATMSMFCLNFSIIPFALLDIRKGFMVWKSLYILGPV 453          
BLAST of porcupine-like protein vs. Planmine SMEST
Match: SMESG000075570.1 (SMESG000075570.1)

HSP 1 Score: 328.176 bits (840), Expect = 1.246e-100
Identity = 174/478 (36.40%), Postives = 270/478 (56.49%), Query Frame = 1
Query: 1897 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQ----------------LSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDK-NGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVS---PITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVN 3270
            MS+FY G     PLS+  GI VDQ NF+ C   +  +G+  + K+    +S   R       G  + LFCFG+Q+ +L +   +SY I+ FLP Q S ++V  + M+++A+ HL R ++DYGGYTLDI+GP+M+  Q+L+ LAFNL DG +I +  KL   +   HAV + P  ++FF Y   F  ++ GPF+FY++Y  +I G + ++   SK++                      + +I G L  +V P F   F  + ++ +     +++F +I   L+RQ+YYFAWS+  A  L +GLG+ G +K +G+  +  + N+D   IE   ++K ++DGWN    +WLRE IY RAP    T  VF  SA WHGFYPGYYL F+T  +F   +R  R++IRP F+V+     T + Y VLT + +  A+NY   PF LL     + FW+ +YF GH+     ++ ++F P I  +++
Sbjct:    1 MSKFYAGVRFFEPLSSKFGIHVDQFNFVFCMFAACLMGRQFQTKYSIKNISAEQRHRFAFLGGFTLALFCFGHQIMHLFIPPIISYCIMYFLPYQHSRYIVLLFAMSYLAVTHLARQYWDYGGYTLDITGPLMVLVQRLSILAFNLYDGDQIKKKRKLDFDDAIKHAVLEHPTPLQFFSYVINFQTIMIGPFIFYSDYLRFIEGREIEYAETSKEKEYFVVHRTSILSPEDVTKKYFIIMLICGGLHLFVFPFFQPTFYLTPEFGQYSFINKVIFMLIVSPLLRQQYYFAWSLTSACCLCSGLGFSGFNKISGKPEYKLIDNFDMRNIEMAKNMKAIIDGWNKPANQWLRECIYNRAPKKFATPAVFICSAIWHGFYPGYYLFFVTAGIFLEISRMARRYIRPYFLVNFGDGQTSKFYDVLTTLISMFAINYMSVPFVLLGLSKSIQFWRQFYFCGHLAVPALLILIRFLPKIRTRIH 478          
The following BLAST results are available for this feature:
BLAST of porcupine-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDPK13.100e-11039.923-phosphoinositide dependent protein kinase 1 [Sou... [more]
PDPK13.427e-11039.923-phosphoinositide dependent protein kinase 1 [Sou... [more]
PDPK12.032e-8044.213-phosphoinositide dependent protein kinase 1 [Sou... [more]
MBOAT24.398e-7233.86membrane bound O-acyltransferase domain containing... [more]
MBOAT17.640e-6632.18membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdk-11.717e-7531.183-phosphoinositide-dependent protein kinase 1 [So... [more]
pdk-17.424e-7531.413-phosphoinositide-dependent protein kinase 1 [So... [more]
mboa-34.929e-6732.11Lysophospholipid acyltransferase; Membrane Bound O... [more]
mboa-34.929e-6732.11Lysophospholipid acyltransferase; Membrane Bound O... [more]
mboa-42.403e-6128.83Membrane Bound O-Acyl transferase, MBOAT [Source:... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdk11.771e-8635.48gene:FBgn0020386 transcript:FBtr0072467[more]
Pdk11.771e-8635.48gene:FBgn0020386 transcript:FBtr0072466[more]
Pdk11.771e-8635.48gene:FBgn0020386 transcript:FBtr0072465[more]
Pdk17.913e-8635.48gene:FBgn0020386 transcript:FBtr0072468[more]
Pdk11.033e-8535.48gene:FBgn0020386 transcript:FBtr0333218[more]
back to top
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdpk1a6.288e-11140.403-phosphoinositide dependent protein kinase 1a [So... [more]
pdpk1a8.053e-11140.403-phosphoinositide dependent protein kinase 1a [So... [more]
pdpk1b1.624e-10739.693-phosphoinositide dependent protein kinase 1b [So... [more]
mboat2b7.382e-7632.69membrane bound O-acyltransferase domain containing... [more]
mboat2a9.946e-7432.26membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema4a3.684e-11340.59sema domain, immunoglobulin domain (Ig), transmemb... [more]
sema4a2.206e-10439.53sema domain, immunoglobulin domain (Ig), transmemb... [more]
sema4a4.848e-10439.76sema domain, immunoglobulin domain (Ig), transmemb... [more]
sema4a6.465e-10439.76sema domain, immunoglobulin domain (Ig), transmemb... [more]
sema4a6.675e-10439.76sema domain, immunoglobulin domain (Ig), transmemb... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdpk12.234e-11039.843-phosphoinositide dependent protein kinase 1 [Sou... [more]
Pdpk17.359e-11039.843-phosphoinositide dependent protein kinase 1 [Sou... [more]
Pdpk15.150e-10139.923-phosphoinositide dependent protein kinase 1 [Sou... [more]
Pdpk16.132e-8143.713-phosphoinositide dependent protein kinase 1 [Sou... [more]
Mboat23.559e-7332.44membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55173|PDPK1_RAT1.639e-11039.463-phosphoinositide-dependent protein kinase 1 OS=R... [more]
sp|O15530|PDPK1_HUMAN1.646e-10939.923-phosphoinositide-dependent protein kinase 1 OS=H... [more]
sp|Q9Z2A0|PDPK1_MOUSE5.147e-10939.843-phosphoinositide-dependent protein kinase 1 OS=M... [more]
sp|Q9W0V1|PDPK1_DROME1.036e-8435.483-phosphoinositide-dependent protein kinase 1 OS=D... [more]
sp|Q6A1A2|PDPK2_HUMAN2.103e-7943.90Putative 3-phosphoinositide-dependent protein kina... [more]
back to top
BLAST of porcupine-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203389720.000e+0100.00tr|B1NWW2|B1NWW2_SCHMD Porcupine-like protein (Fra... [more]
gnl|BL_ORD_ID|209075120.000e+097.33tr|F1CDE0|F1CDE0_SCHPL Porcupine-1 (Fragment) OS=S... [more]
gnl|BL_ORD_ID|171811644.482e-16348.79tr|C1L448|C1L448_SCHJA Putative 3-phosphoinositide... [more]
gnl|BL_ORD_ID|229305183.720e-16149.58tr|A0A4S2MBV1|A0A4S2MBV1_OPIFE Protein kinase doma... [more]
gnl|BL_ORD_ID|162431315.073e-16051.48tr|A0A183A8J4|A0A183A8J4_9TREM Protein kinase doma... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdpk1a5.040e-11039.573-phosphoinositide-dependent protein kinase 1 [Sou... [more]
pdpk1b2.474e-10939.773-phosphoinositide-dependent protein kinase 1 [Sou... [more]
pdpk1b8.458e-10138.273-phosphoinositide-dependent protein kinase 1 [Sou... [more]
mboat2b3.671e-7532.54membrane-bound O-acyltransferase domain-containing... [more]
mboat2a3.472e-7132.98membrane-bound O-acyltransferase domain-containing... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdpk1b7.029e-11239.883-phosphoinositide dependent protein kinase 1b [So... [more]
ENSPMAT00000008480.12.463e-4432.73pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000006766.18.939e-4432.59pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
MBOAT24.534e-4227.88membrane bound O-acyltransferase domain containing... [more]
ENSPMAT00000001814.11.358e-3728.48pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PKH21.296e-5737.39Serine/threonine protein kinase; involved in sphin... [more]
PKH12.751e-5736.56Serine/threonine protein kinase; involved in sphin... [more]
YPK18.016e-4933.93S/T protein kinase; phosphorylates, downregulates ... [more]
ALE16.529e-4727.70Broad-specificity lysophospholipid acyltransferase... [more]
TPK11.730e-4631.90cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO480264.365e-9247.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407887.837e-5931.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352287.361e-4732.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378002.471e-4532.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355854.147e-4129.43Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdpk1b2.215e-10940.353-phosphoinositide dependent protein kinase 1 [Sou... [more]
pdpk1b7.588e-10940.353-phosphoinositide dependent protein kinase 1 [Sou... [more]
mboat2a3.944e-7232.52membrane bound O-acyltransferase domain containing... [more]
mboat15.818e-6831.32membrane bound O-acyltransferase domain containing... [more]
mboat2a2.043e-6131.26membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051515.10.000e+0100.00SMESG000051515.1[more]
SMESG000051516.10.000e+0100.00SMESG000051516.1[more]
SMESG000066852.13.959e-10841.79SMESG000066852.1[more]
SMESG000074104.19.736e-10640.09SMESG000074104.1[more]
SMESG000075570.11.246e-10036.40SMESG000075570.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025591
GenBankABW97518.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025591 ID=SMED30025591|Name=porcupine-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3526bp
TTCCGATCTTTTCTTTTGAAATTTTTGAAATTTTAAATAAAATTAATGAC
AAAGGCAGAAAATCAGAGAACTACTAAAGCATCCGACTTCAAATTTGGAA
AAGAAATCGGCCATGGCTCGTTCTCAACTGTAATGATAGCTAAGGAAATT
TCTACCAATAAACATTATGCTGCAAAAATTATTGATAAAGTTTTTATTTC
TAAACAGCGAATGGTTAATACTGTTATGATTGAAAAAGAAGTTCTCCGAA
GAATAAATCACCAGTTTTTTGTATGTCTCAATTATACATTCCAAGATCCA
GAGAGATTGTATTTTATTATATCATATGCCGAACGAGGAGAACTTTTATC
TCATTTAACAAGACTTTCGTGTTTTGATTTAACGTGCACACAATTTTATT
CCGCGGAAATTATTCTTGCATTAGAATATTTACATGGAATTAACGTTGTT
CATCGAGATATAAAACCAGAAAATATTTTACTGAGTGAAAATATGCATAT
AAAAATTTGTGATTTTGGCAGTGCAATTATTATCGATAAACCAGATCTCA
AGCCTTCTTCTTTTACAGGTACAGCTCAATTCGTTTCTCCAGAAATGCTG
GGATTCAGTAAAGAAACACGTGACAATAGCTATTCAGATGAACCGAATTC
TGATTCAGAGGAACATAGCGAAATTGAAGTTAAACGAACTAGTTCACCTG
ATAATTCTAGGGAAATATTATATCTAATGGACTTCTGGGCATTAGGATGC
ATCGTCTATCAAATGTTGTCTGGACGAATGCCATTTCACGTCAGGCATTC
ACGGCATGAATATGAAATTTTCCAAAAGATCCGAAATTTAAAATATGAGT
TTCCGGTTGGGTTTGATGATACTGCTAAAGATTTTGTCTCTAAACTTCTT
GTATTGAATCCACTGGAAAGATTAGGCAATCCATCCGATGGAAAGCACGC
TGCTTTAAAAGCCCACCCCCTTTTCCGTTCAATTGATTTCGAAATTATCG
GATCACAAAAACCTCCGCTATTACTTCCAAATATTGAGCCCATTGTTCAA
AGTAATTGGGACGAAATTCCTGTTGGTTTTGAAGAAGCATGGAAATTCAA
TATCAAAAAAGAGTTTCAAGAAATGGAAAAAGCCGATAAACAAAAATTAT
TGCAAAACCAAGAAAAACTAAATCCGTTTCATAGATTTGTACGCAATCGA
TTGATCATAAAACAAGGCATCTTGTACAAACGGCGTGGATTATTTACTCG
TAAAAGAATGTTTCTATTAACTGAAGGACCTCATTTATTTTATGTCGACC
CCGATGCTATGCAATTTAAAAAAGAAGTCAGTCTAAACTTAATTACTGGC
ATAGAAGTAAAAAATGACAAAGTATTTTATATCGTTACTAAAAGGCGAAC
ATATTTTCTCGAAGATCCTTCAGCAAAGGCTGATGAATGGCGACAGAGTA
TTGAATCGATTTGTGTAGAATATTATGGATCATTTAAATTATCCCCTGGC
ACTTGCACTCAAACGCCTCTAGTTACATCATCTGAATCATAACTTTCGGT
TTTATTTAAATTTATTTGTCATATAGAAAAAAATGTGAATTTAACGGTTT
TTAATATAATAATTTAATATTGGTTTGAATTCTTGTTTTTCATTTTAAAA
TTTAATGGATATAATTTAAATATTTTAATAAATAAAAATATTCACATTGT
TTTAATATTCTCTTTATGTCGTAATTGATAAATGATGCATTGTAAATGTA
TTTTACAACTGATCTAAATGAAACCAATAGGAAACGAGTGGTTCGATGTC
ATGTGAATCAGCATGCAACCAATCATAGTTTTGTGATTCATTAAATATAT
TTTAAATTTTTAAAACAAATTAAATCACTTAATTAATTTTTAGACAATGT
CACAATTTTATGGCGGATCCACGATATTGGCACCTCTATCGAACGTTATG
GGTATACCAGTGGATCAAATTAATTTTATTGTGTGTAGTTTATTGTCAAT
CGGACTGGGTCAAATTATGCGACACAAATTCCCTCCTTCTAAATTGTCAG
GAAGTACAAGAGGAATCATAGAAGCATTTTTTGGAATACTAATTGTTCTT
TTCTGCTTCGGATACCAAGTCAAGTATTTGTTACTACAATCAACAGTTTC
CTATGTAATACTATTATTTTTGCCTTCACAAATATCAGCGCATTTGGTAA
CGTATTGGTGTATGGCTTTCATGGCGATAGTCCATTTATACAGGATGCAT
TACGATTACGGAGGTTATACTCTCGATATATCTGGTCCGGTTATGATTCA
AACCCAAAAATTGACCAGCCTCGCATTTAATCTTCTAGATGGACATCGAA
TAAATCAAGGAATAAAACTGCAACAGAGAAATCATGAATCTCACGCTGTG
AAAAAACTACCAGATGCAATCAAGTTTTTCGGTTACACATTCTACTTTCA
TGGTGTATTAGCGGGTCCTTTTGTATTCTACAATGAATATAAAGAATATA
TCACTGGATATGACGACAAGCATATTCCATGCTCCAAAAAGCAATTATCT
TCAGCACTTTGTTTATCAGTGATCCATGGATTATTAACAGCATATGTCGC
ACCGCAGTTTCCATATATATTTGTTTGCAGCACCGATTACCAACGGATGC
ATATGACTCGTAGAATAATGTTCACAATGATTTCATTTTTCCTCGTAAGA
CAAAAGTATTACTTTGCCTGGTCAATGGTTGAAGCTGGTGCTCTTAGTAC
CGGATTGGGATATTGTGGAAAGGATAAAAACGGAGAGAATAATTGGTCGA
AAGTGAAAAATTACGATTTCATGGCAATCGAAAGCGGCAGTAGTTTGAAA
GTGCTAGTGGACGGATGGAATATTTCCACAACAAGATGGCTCAGAGAATT
AATTTATGAACGAGCTCCTTTATTCTGTCGGACAATTCTAGTTTTCACCG
TCAGTGCATTTTGGCATGGATTCTATCCTGGATATTATTTGATGTTTTTG
ACATTTTCTCTCTTTACGTTTTGCGCTAGAACCGTTAGGAAACACATTCG
ACCATTGTTCATTGTCAGTCCAATTACACTTCAACTCTATCATGTTCTAA
CGAAAATATTCACAAATCTGGCTTTAAATTACGGACAAGGACCATTTTAT
TTGCTGGAGTTTCAATCGGGACTTTTGTTTTGGAAGCCATATTACTTTTT
CGGACACGTTCTAGCAATGTTCTGCGTATTGACCTTGCAATTTCGGCCGA
TAATCAACGACAAAGTCAACATAATGAACAATGTTTTCACCAGAAAAGCC
CAATATCGGTTTCAGAAACTAAAGATCCATTTGCAGAAAAAGTTGAGATG
AAATTTTATTGATTTTGATAATTTATATAAAATATTATAATTTTGTTTTT
CGTTTTATTTTTATATCGATGAATTTATGATAAATGCTAAATATTCGATC
CGGAATGAATTATTATTAATCTGGTTTTTATAATTGTTCATTTTTAATAG
TTTTGTTTGTTTTTCGAAAATGGCGG
back to top

protein sequence of SMED30025591-orf-1

>SMED30025591-orf-1 ID=SMED30025591-orf-1|Name=SMED30025591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=485bp
MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKL
SGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHL
VTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKE
YITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
TVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHV
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR
PIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR*
back to top

protein sequence of SMED30025591-orf-2

>SMED30025591-orf-2 ID=SMED30025591-orf-2|Name=SMED30025591-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MTKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVF
ISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGEL
LSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENM
HIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEP
NSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVR
HSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGK
HAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWK
FNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLF
TRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKR
RTYFLEDPSAKADEWRQSIESICVEYYGSFKLSPGTCTQTPLVTSSES*
back to top
Aliases
The feature 'porcupine-like protein' has the following synonyms
Synonym
porcn-A
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000049digestive system
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR033931PDK1-typ_PH
IPR039046PDPK1
IPR004299MBOAT_fam
IPR000719Prot_kinase_dom
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000005Stage 5
PLANA:0000008Stage 8
PLANA:0000006Stage 6
PLANA:0000007Stage 7
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 15..310
e-value: 5.2E-83
score: 291.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 226..295
e-value: 2.6E-9
score: 36.9
coord: 16..194
e-value: 4.8E-44
score: 150.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 15..310
score: 43.495
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 387..476
e-value: 1.5E-5
score: 34.5
IPR033931PDK1-type, PH domainPFAMPF14593PH_3coord: 376..476
e-value: 3.2E-31
score: 107.5
IPR033931PDK1-type, PH domainCDDcd01262PH_PDK1coord: 372..477
e-value: 1.12431E-40
score: 139.657
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 346..481
e-value: 2.2E-39
score: 136.5
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 226..322
e-value: 6.7E-22
score: 79.8
coord: 99..187
e-value: 3.8E-60
score: 205.2
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 13..98
e-value: 3.8E-60
score: 205.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 190..215
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..215
NoneNo IPR availablePANTHERPTHR24356SERINE/THREONINE-PROTEIN KINASEcoord: 7..359
NoneNo IPR availableCDDcd05581STKc_PDK1coord: 13..310
e-value: 1.22289E-122
score: 358.066
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 304..478
IPR039046PDPK1 familyPANTHERPTHR24356:SF1633-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1-RELATEDcoord: 7..359
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 134..146
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 21..44
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 12..332