porcupine-like protein

Overview
Nameporcupine-like protein (ABW97518.1)
Smed IDSMED30025591
Uniprot Best hit3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 (E=2.82259e-109)
Length (bp)3526
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of porcupine-like protein (SMED30025591) t-SNE clustered cells

Violin plots show distribution of expression levels for porcupine-like protein (SMED30025591) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of porcupine-like protein (SMED30025591) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for porcupine-like protein (SMED30025591) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

porcupine-like protein ( porcn-A ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the definitive gut and digestive system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of porcupine-like protein vs. Ensembl Human
Match: PDPK1 (3-phosphoinositide dependent protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:8816])

HSP 1 Score: 356.681 bits (914), Expect = 4.932e-109
Identity = 202/506 (39.92%), Postives = 293/506 (57.91%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI---------------------PVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + +       N+D +                       G  +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   54 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS 522          
BLAST of porcupine-like protein vs. Ensembl Human
Match: PDPK1 (3-phosphoinositide dependent protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:8816])

HSP 1 Score: 357.451 bits (916), Expect = 5.375e-109
Identity = 202/506 (39.92%), Postives = 293/506 (57.91%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI---------------------PVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + +       N+D +                       G  +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   81 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS 549          
BLAST of porcupine-like protein vs. Ensembl Human
Match: PDPK1 (3-phosphoinositide dependent protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:8816])

HSP 1 Score: 272.707 bits (696), Expect = 7.030e-80
Identity = 145/328 (44.21%), Postives = 208/328 (63.41%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + + + D
Sbjct:   81 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDED 371          
BLAST of porcupine-like protein vs. Ensembl Human
Match: MBOAT2 (membrane bound O-acyltransferase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25193])

HSP 1 Score: 251.521 bits (641), Expect = 1.125e-71
Identity = 150/443 (33.86%), Postives = 238/443 (53.72%), Query Frame = 1
Query: 1933 PLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGY--------DDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCST---DY---QRMHMT----RRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQL-YHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYF 3198
            PLSN + +P+DQ+NF+VC L ++      R     SK S   R ++    G+ + LFCFG+   + L+QS +SY I++ +  +   +    + + ++ +  + R++ +DYG Y+ D SGP+MI TQK+TSLA  + DG  R ++ +   QR+    AV+++P  +++  Y   F G+LAGP   Y +Y  +I G         ++       ++   +   +V+  LL   ++  F ++ +C+T   +Y   +    T     +I++  IS    R KYYFAW++ +A   + G G+ G D+NG   W  + N     IE  +S K+ +D WNI T  WL+ + YER   F  TI  F +SA WHG YPGYYL FLT  L T  AR +R + R  FI  P  L+L Y V+T I T +A++Y   PF LL  +  L F+  +Y+
Sbjct:   14 PLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDL---AVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLF-HLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTS-FSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFI-EPSQLKLFYDVITWIVTQVAISYTVVPFVLLSIKPSLTFYSSWYY 450          
BLAST of porcupine-like protein vs. Ensembl Human
Match: MBOAT1 (membrane bound O-acyltransferase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21579])

HSP 1 Score: 233.032 bits (593), Expect = 2.394e-65
Identity = 158/491 (32.18%), Postives = 249/491 (50.71%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYW-CMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESH--AVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHI-------------------PCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTR---RIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIIND--KVNIMNNVFTRKAQ 3303
            GST L PLS ++GIP+DQ+NF+VC L+++      R    P   S   R  +   FGI  V+FCFG+   +L +   + Y I++   S  + H  +++  M ++ I H+ R++ + YG  T D SGP+MI TQK+T+LAF + DG     G + +  + E H  A+K  P  +++  Y   F  V+AGP    N +K+YI   + KHI                   P     +   L ++++  LL   +   FP    C  D   +H      R+ +  +     + KYYFAW++ +A   + G G+ G DKNG   W  + N +   IE+ +S K+ ++ WNI T  WL+ + Y+R P +  T+L F +SA WHG YPGYY  FLT  L T  AR VR + R  F+ S     +Y   T   T LA++Y   PF +L  +  +  +K  YF+ H++++  +L L  +P  +   +   +N++  RK  
Sbjct:   16 GSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMV-TASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDG----LGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPC---NNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFP--VTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCVCYQRVPWY-PTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKAVYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQRRPQTLNSINKRKTD 495          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: pdk-1 (3-phosphoinositide-dependent protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y1J3])

HSP 1 Score: 263.462 bits (672), Expect = 3.890e-75
Identity = 159/510 (31.18%), Postives = 255/510 (50.00%), Query Frame = 1
Query:   79 ASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRIN-----HQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSE-IEVKRTSSPD--NSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNI-----EPIVQSNWDEIPVGFEEAWKFNI--------------------------------KKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEY 1473
            ++DF F + +G G++S V   +E++T+  +A K++ K ++++ + ++ ++ EK +L  ++     H F   L   F D  R+YF+I   E G+L   L     FD+  ++F+++EI+  L++LH   +VHRD+KP+N+L+ ++ HI I DFGSA       L    FT   Q  S              YSDE   ++   +  +      SP+     ++    D W LGCI++Q L+G+ PF    + ++Y + ++I+ L + FP GF + A + ++K+LV +P  R+ +        L AH  F ++D+  I + KPP+L   I     EP   SN   +  G ++   F +                                     E  +A + + L+ Q   NPFH F  N LI+KQG L K+RGLF R+RMFLLTEGPHL Y+D   +  K EV       +E+KN   F+I T  R Y+L D   KADEW ++I  +   Y
Sbjct:   66 SNDFMFLQSMGEGAYSQVFRCREVATDAMFAVKVLQKSYLNRHQKMDAIIREKNILTYLSQECGGHPFVTQLYTHFHDQARIYFVIGLVENGDLGESLCHFGSFDMLTSKFFASEILTGLQFLHDNKIVHRDMKPDNVLIQKDGHILITDFGSAQAFGGLQLSQEGFTDANQ-ASSRSSDSGSPPPTRFYSDEEEENTARRTTFVGTALYVSPEMLADGDVGPQTDIWGLGCILFQCLAGQPPF---RAVNQYHLLKRIQELDFSFPEGFPEEASEIIAKILVRDPSTRITS------QELMAHKFFENVDWVNIANIKPPVLHAYIPATFGEPEYYSNIGPVEPGLDDRALFRLMNLGNDASASQPSTPSNVEHRGDPFVSEIAPRANSEAEKNRAARAQKLEEQRVKNPFHIFTNNSLILKQGYLEKKRGLFARRRMFLLTEGPHLLYIDVPNLVLKGEVPWTPCMQVELKNSGTFFIHTPNRVYYLFDLEKKADEWCKAINDVRKRY 565          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: pdk-1 (3-phosphoinositide-dependent protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y1J3])

HSP 1 Score: 261.536 bits (667), Expect = 1.636e-74
Identity = 163/519 (31.41%), Postives = 257/519 (49.52%), Query Frame = 1
Query:   79 ASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRIN-----HQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTS--------SPD--NSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNI-----EPIVQSNWDEIPVGFEEAWKFNI----------------------------------KKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEY 1473
            ++DF F + +G G++S V   +E++T+  +A K++ K ++++ + ++ ++ EK +L  ++     H F   L   F D  R+YF+I   E G+L   L     FD+  ++F+++EI+  L++LH   +VHRD+KP+N+L+ ++ HI I DFGSA       L    FT   Q  S              YSDE     E   E   +RT+        SP+     ++    D W LGCI++Q L+G+ PF    + ++Y + ++I+ L + FP GF + A + ++K+LV +P  R+ +        L AH  F ++D+  I + KPP+L   I     EP   SN   +  G ++   F +                                       E  +A + + L+ Q   NPFH F  N LI+KQG L K+RGLF R+RMFLLTEGPHL Y+D   +  K EV       +E+KN   F+I T  R Y+L D   KADEW ++I  +   Y
Sbjct:   66 SNDFMFLQSMGEGAYSQVFRCREVATDAMFAVKVLQKSYLNRHQKMDAIIREKNILTYLSQECGGHPFVTQLYTHFHDQARIYFVIGLVENGDLGESLCHFGSFDMLTSKFFASEILTGLQFLHDNKIVHRDMKPDNVLIQKDGHILITDFGSAQAFGGLQLSQEGFTDANQ-ASSRSSDSGSPPPTRFYSDE-----EVPEENTARRTTFVGTALYVSPEMLADGDVGPQTDIWGLGCILFQCLAGQPPF---RAVNQYHLLKRIQELDFSFPEGFPEEASEIIAKILVRDPSTRITS------QELMAHKFFENVDWVNIANIKPPVLHAYIPATFGEPEYYSNIGPVEPGLDDRALFRLMNLGNDASASQPSTFRPSNVEHRGDPFVSEIAPRANSEAEKNRAARAQKLEEQRVKNPFHIFTNNSLILKQGYLEKKRGLFARRRMFLLTEGPHLLYIDVPNLVLKGEVPWTPCMQVELKNSGTFFIHTPNRVYYLFDLEKKADEWCKAINDVRKRY 569          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: mboa-3 (Membrane Bound O-Acyl transferase, MBOAT [Source:RefSeq peptide;Acc:NP_508937])

HSP 1 Score: 234.572 bits (597), Expect = 1.552e-66
Identity = 149/464 (32.11%), Postives = 225/464 (48.49%), Query Frame = 1
Query: 1906 FYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSK-------------KQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQ--FRPI 3252
            FY GS IL PL+  +GI  D++NF++      G+  + R      +++   R ++ A  GI IV FCFG  +K+LL  +  SY I+ F P      +V  + M ++  +H YR       Y+LD++GP+M+  +K T +AFNL DG   +Q    +++  ES  +K++P  ++F  + F F  VL GP    N Y +YI   D+KH+   K             K   S   L+++  L   Y         V +  Y  +   +   +  I+ F +R  YYFAW   +A    +G G+ G DK G   W    N     +E   SLK  +DGWNI T  WLR++ YERAP   RT+  +T+SA WHG   GYY+ F T  LFT  A+T R+ +R  F+        Y + + I + +AL Y    F  +         K  YF  H++A   +  L   F+P+
Sbjct:    7 FYDGSKILEPLAETIGIEADRVNFVLSLFACFGISYVYRKTCSLKQVNRQVRTVVPAVVGIGIVFFCFGRAIKHLLANALGSYAIMYFAPPTQVHKIVLLFSMGYLFFIHCYRWAI-LESYSLDVTGPIMVAVEKATMMAFNLKDGKAKDQSKLTEEQKRES--LKEIPSLLEFMSFMFNFQTVLTGP---ANNYYDYIKFLDEKHLVADKHGKLPSPTGAAMKKFYQSLFFLAIVVTLGGKYKVED-----VGTQPYFALPFFQWFFWWFITIFFIRCAYYFAWVFADAICNMSGFGFSGYDKEGNAEWKLCTNVLPYQVEMAQSLKETLDGWNIQTGFWLRKVGYERAPKSIRTVATYTLSAVWHGVSIGYYMAFFTCGLFTVAAQTFRRSMRWRFLDDHNKKFAYDIFSFIISKIALAYATYSFVTMHMYPAYDVLKRVYFIPHIVAFAVIFALPKFFKPL 459          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: mboa-4 (Membrane Bound O-Acyl transferase, MBOAT [Source:RefSeq peptide;Acc:NP_001255544])

HSP 1 Score: 219.164 bits (557), Expect = 8.135e-61
Identity = 141/489 (28.83%), Postives = 237/489 (48.47%), Query Frame = 1
Query: 1906 FYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKK-------------QLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCG-KDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQ--FRPIINDKVNIMNNVFTRKAQYRFQKLK 3324
            FY   T+L P+S  + + +DQ+NF+   LLS GLG   R +F     S +TR  +    G++   FC+G  + +L +    SY++++ +P Q     V  + M ++ ++H YR  Y    Y LD++G +M+   K+T LA  + DG  + +  K      +  AVK++P  + F  Y F F  V+ GP   Y+ +  ++   + KH+P ++K             +  +A+  SV++ +L +Y+    P            ++    + T+ +  + R  YYFAW++ ++    +G GY G  D+  E  WS+  N   + +E G + K +VD WNI T  WLR ++YER     RT+ V+   A WHG   GYY  FLT +LFT  A T R+ +R  F+ + +   +Y +   + +  A+ Y   PFY++ F   L  ++      H +A+F  L L   F P    K+   N   T     R  ++ 
Sbjct:   15 FYDPVTLLRPVSRAISMNLDQLNFVTVLLLSFGLGYWFRVQF--CDASRTTRAAVTTSVGLIFTYFCYGNAIAHLFINGFGSYLLMVSVPPQHVHKSVFAFAMGYLVLIHSYRWMYQ-KTYCLDVTGSMMVAVGKITLLASAITDG--MGRDPKALNSGQKRDAVKEVPSLLDFASYMFNFQTVIVGPMNHYSTWSAFL---ELKHVPKNEKTGKPYDPTSTAMKKFEAAIAFSVVYTILGSYL----PMSLTNDPSINEYNLLIWWLITVAASTVHRLPYYFAWTISDSICNISGFGYDGLADETLEPKWSRTTNVKPLLVEFGQNYKEMVDNWNIWTVAWLRRVVYERVEGPYRTLAVYVTGAAWHGLAVGYYFSFLTSALFTLSAATFRRCMRHRFLGNSMHKLMYDIFGMLVSKFAIGYIHWPFYVMHFWPSLFMYRKLLMIPHFIALFIYLYLPQIFSPQPKSKITGPNASATSVNTDRISEIS 491          
BLAST of porcupine-like protein vs. Ensembl Celegans
Match: mboa-4 (Membrane Bound O-Acyl transferase, MBOAT [Source:RefSeq peptide;Acc:NP_001255544])

HSP 1 Score: 207.223 bits (526), Expect = 1.909e-56
Identity = 141/507 (27.81%), Postives = 237/507 (46.75%), Query Frame = 1
Query: 1906 FYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFH-------------------GVLAGPFVFYNEYKEYITGYDDKHIPCSKK-------------QLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCG-KDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQ--FRPIINDKVNIMNNVFTRKAQYRFQKL 3321
            FY   T+L P+S  + + +DQ+NF+   LLS GLG   R +F     S +TR  +    G++   FC+G  + +L +    SY++++ +P Q     V  + M ++ ++H YR  Y    Y LD++G +M+   K+T LA  + DG  + +  K      +  AVK++P  + F  Y F F                     V+ GP   Y+ +  ++   + KH+P ++K             +  +A+  SV++ +L +Y+    P            ++    + T+ +  + R  YYFAW++ ++    +G GY G  D+  E  WS+  N   + +E G + K +VD WNI T  WLR ++YER     RT+ V+   A WHG   GYY  FLT +LFT  A T R+ +R  F+ + +   +Y +   + +  A+ Y   PFY++ F   L  ++      H +A+F  L L   F P    K+   N   T     R  ++
Sbjct:   15 FYDPVTLLRPVSRAISMNLDQLNFVTVLLLSFGLGYWFRVQF--CDASRTTRAAVTTSVGLIFTYFCYGNAIAHLFINGFGSYLLMVSVPPQHVHKSVFAFAMGYLVLIHSYRWMYQ-KTYCLDVTGSMMVAVGKITLLASAITDG--MGRDPKALNSGQKRDAVKEVPSLLDFASYMFNFQVFYENLWLRSSSATTDHSGTVIVGPMNHYSTWSAFL---ELKHVPKNEKTGKPYDPTSTAMKKFEAAIAFSVVYTILGSYL----PMSLTNDPSINEYNLLIWWLITVAASTVHRLPYYFAWTISDSICNISGFGYDGLADETLEPKWSRTTNVKPLLVEFGQNYKEMVDNWNIWTVAWLRRVVYERVEGPYRTLAVYVTGAAWHGLAVGYYFSFLTSALFTLSAATFRRCMRHRFLGNSMHKLMYDIFGMLVSKFAIGYIHWPFYVMHFWPSLFMYRKLLMIPHFIALFIYLYLPQIFSPQPKSKITGPNASATSVNTDRVSRV 509          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (Phosphoinositide-dependent kinase 1 [Source:FlyBase gene name;Acc:FBgn0020386])

HSP 1 Score: 297.745 bits (761), Expect = 8.739e-86
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  163 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 684          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (Phosphoinositide-dependent kinase 1 [Source:FlyBase gene name;Acc:FBgn0020386])

HSP 1 Score: 297.745 bits (761), Expect = 8.739e-86
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  163 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 684          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (Phosphoinositide-dependent kinase 1 [Source:FlyBase gene name;Acc:FBgn0020386])

HSP 1 Score: 297.745 bits (761), Expect = 8.739e-86
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  163 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 684          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (Phosphoinositide-dependent kinase 1 [Source:FlyBase gene name;Acc:FBgn0020386])

HSP 1 Score: 297.745 bits (761), Expect = 3.515e-85
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  227 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 748          
BLAST of porcupine-like protein vs. Ensembl Fly
Match: Pdk1 (Phosphoinositide-dependent kinase 1 [Source:FlyBase gene name;Acc:FBgn0020386])

HSP 1 Score: 297.745 bits (761), Expect = 4.471e-85
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  244 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 765          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: pdpk1a (3-phosphoinositide dependent protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-061013-109])

HSP 1 Score: 357.836 bits (917), Expect = 9.379e-110
Identity = 202/500 (40.40%), Postives = 286/500 (57.20%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFEEAWKF--------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            K  DF FGK +G GSFSTV++AKE++T K YA KI++K  I K+   + V+ EK++L  I+H FFV L +TFQD ++LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH + ++HRD+KPENILL E+MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WA+GCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+P +RLG    G    LK H  F ++ +E +  Q PP L P +  + +       N++++   F                    NI++   +++             +K+ LLQ Q   NP+H+FV N LI K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +    Y
Sbjct:   62 KKEDFSFGKILGEGSFSTVVLAKELATGKEYAMKILEKNHIRKENKAHYVIREKDILSCIDHPFFVKLFFTFQDSQKLYFALSYAKNGELLRYIRKIGSFDETCTRFYTAEIVCALEYLHTVGIIHRDLKPENILLCEDMHIQITDFGTAKQLSSDSAQTRANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWAMGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVQRLLSLDPRKRLGCEEMGGFGPLKGHMFFETVSWENLPLQTPPKLTPYLPAMAEDDEDYYGNYEDLLSQFSSLQVVPSSSAQIVPPRPCSNIEQYIHDLDSNSFELDLQFSSEEKRLLLQKQTSGNPWHQFVENNLIYKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEVWGTVY 524          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: pdpk1a (3-phosphoinositide dependent protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-061013-109])

HSP 1 Score: 358.221 bits (918), Expect = 1.191e-109
Identity = 202/500 (40.40%), Postives = 286/500 (57.20%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGFEEAWKF--------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            K  DF FGK +G GSFSTV++AKE++T K YA KI++K  I K+   + V+ EK++L  I+H FFV L +TFQD ++LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH + ++HRD+KPENILL E+MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WA+GCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+P +RLG    G    LK H  F ++ +E +  Q PP L P +  + +       N++++   F                    NI++   +++             +K+ LLQ Q   NP+H+FV N LI K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +    Y
Sbjct:   73 KKEDFSFGKILGEGSFSTVVLAKELATGKEYAMKILEKNHIRKENKAHYVIREKDILSCIDHPFFVKLFFTFQDSQKLYFALSYAKNGELLRYIRKIGSFDETCTRFYTAEIVCALEYLHTVGIIHRDLKPENILLCEDMHIQITDFGTAKQLSSDSAQTRANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWAMGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVQRLLSLDPRKRLGCEEMGGFGPLKGHMFFETVSWENLPLQTPPKLTPYLPAMAEDDEDYYGNYEDLLSQFSSLQVVPSSSAQIVPPRPCSNIEQYIHDLDSNSFELDLQFSSEEKRLLLQKQTSGNPWHQFVENNLIYKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEVWGTVY 535          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1820])

HSP 1 Score: 349.362 bits (895), Expect = 2.184e-106
Identity = 204/514 (39.69%), Postives = 287/514 (55.84%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSA--IIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDE------------------IPVGFEEAW-KFNIKKEFQE-----------ME------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            R  +  DF+FGK +G GSFSTV++AKE +T K YA KI++K  I K+     V  E++++  ++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FYSAEI+ ALEYLH   ++HRD+KPENILLSE MHI+I DFG+A  +  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+YEFP  F   AKD V +LL L+  +R+G    G +  LK+HP F S+ ++ +  Q PP L   +  + +       N+D+                  +PV  E +   +N      +           ME        +K+ LL  Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  AD+W + I+ +  + Y
Sbjct:   53 RKKRPEDFRFGKILGEGSFSTVVLAKEHTTGKEYAIKILEKRHIMKENKAQYVKRERDIMSHLDHPFFVKLYFTFQDEEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYSAEIVCALEYLHQKGIIHRDLKPENILLSEEMHIQITDFGTAKQLSSDSKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYEFPEKFFPKAKDLVEQLLSLDSCKRIGCDEMGGYGPLKSHPFFESVGWDDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFSCMQVAQPGPAPLVPVTGETSQPTYNPSPSVDQFIHIHELDSNSMELDLQYSNEEKRILLDKQSAANPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSPELRPEAKNFKTFFVHTPNRTYYLMDPSGNADKWCKKIQEVWRKIY 529          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: mboat2b (membrane bound O-acyltransferase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-041001-185])

HSP 1 Score: 260.381 bits (664), Expect = 1.355e-74
Identity = 153/468 (32.69%), Postives = 237/468 (50.64%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDG-----HRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKH----------------IPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDY-QRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRP 3249
            GS +L P+S +  +P+DQ+NF+VC L ++      R    PSK S   R ++    GI   LFCFG+   + LLQS ++Y I++    +          + +++   + R++ +DYG Y+ D +GP+M+ TQK+TS+AF + DG      ++NQG KL        A++++P  +++F Y   F G+LAGP   YN+Y  +I G   +H                 P    ++   L    I  L+   V   FP       D+        ++++  +S    R KYYF W++ +A   + G G+ G D +G   W  + N   + IE  +S KV +D WNI T  WL+ + YER P +  T   F +SA WHG YPGYYL FLT  + T  AR VR ++RP F+ SP    +Y V+T   T +A+ Y   PF LL     L F++ +YF  H+  +   + L  +P
Sbjct:   81 GSNLLQPISEMTNLPLDQVNFVVCQLCALLTAVWFRLYLHPSKTSPFVRHVVATLLGIYFALFCFGWYALHFLLQSGITYGIMILTGVEHMHKYCLVVALGYLSFCQITRVYVFDYGMYSADFTGPMMVITQKITSVAFEIHDGMARKVEQLNQGQKLL-------AIRRMPSLLEYFSYNCNFMGILAGPTCSYNDYIAFIEGTPYRHRDLEPKGKVNGKSRLNDPSPNTEVIRKLSTCFISLLVFLSVCKVFPVERNVDDDFIATSPFYVQVVYLYLSMLTTRPKYYFVWTLADAINNAAGFGFNGYDSDGSPRWDLLSNIRILNIELATSFKVFLDNWNIQTAHWLKRVCYERCP-YNPTAATFLLSAMWHGAYPGYYLTFLTGIVITLAARAVRHNVRPHFLGSPSHKFVYDVITWAATQIAICYTVVPFVLLSVGPSLKFYRSWYFCLHIGCILLAIALPVKP 540          
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Match: mboat2a (membrane bound O-acyltransferase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-041210-257])

HSP 1 Score: 254.988 bits (650), Expect = 2.401e-73
Identity = 151/468 (32.26%), Postives = 248/468 (52.99%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITG--YDDKHIPCSKKQ-------------------LSSALCLSVIHGLLTAYVAPQFPY-IFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR 3246
            GST+L P+S ++ +P+DQ+NF+VC L ++      R    PSK S   R ++    G  + LFCFG+   + L+QS ++Y +++F   +          M +++  H+ R++ +DYG Y+ D +GP+M+ TQK+TSLAF + DG  +  + +K  Q+     AV+K+P  +++  Y   F G+LAGP   YN+Y ++I G  Y+ KH+  + K+                    + ALCL++   + TA    +  +  F+ S  +       +++F  IS   +R KYYF W++ +A   + G G+ G + +G   W ++ N   + IE  +S K+ +D WNI T  WL+ + YER P +  T   F +SA WHG YPGYYL F+T    T  AR VR ++R  F+ S     +Y V+T   T +A+ Y   PF LL     + F++ +Y   H++ +   L L  +
Sbjct:    9 GSTLLQPISKMIDLPLDQVNFVVCQLFALVTAFWFRLYLHPSKTSPFIRHVVATLLGFYLALFCFGWYALHFLVQSGLAYGVMIFTSVEHMHKYCFVVTMGYLSFCHVTRVYVFDYGMYSADFTGPMMVITQKITSLAFEIHDGLVKREEHLKPSQK---YLAVRKMPSLLEYLSYNCNFMGILAGPTCSYNDYIDFIEGRGYESKHLETNGKENGKFKQIEPSPKRDVIQKVCTCALCLTIYLVIHTACPTERVTHESFMASNPFYI-----QVLFLYISMLSLRPKYYFVWTLADAINNAAGFGFNGYNTDGTPKWDRISNLRILNIEFATSFKMFLDNWNIQTALWLKRVCYERCP-YNPTAATFLLSAMWHGVYPGYYLTFVTGIAVTMAARAVRHNVRQHFLGSSTLKLIYDVITWFSTQIAICYTVVPFVLLAVGPSIKFYRSWYCCIHLICVLLALVLPVK 467          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:Xenbase;Acc:XB-GENE-991549])

HSP 1 Score: 360.918 bits (925), Expect = 1.144e-110
Identity = 205/507 (40.43%), Postives = 292/507 (57.59%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPD----LKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF---------------------EEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESI 1461
            R  +  DFKFGK +G GSFSTV++AKE++T + YA KI+ K  I K+  V  V  EK+V+ R++H FFV L +TFQDPE+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A +         ++ +SF GTAQ+VSPE+L                      +E    ++S            D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLLV++P +RLG    G +  LKAHP F ++ ++ +  Q PP L   +  + +       N+D++   F                      +    NI++   +++           +A+K+ LL+ Q   N +H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +
Sbjct:   76 RKKRPQDFKFGKILGEGSFSTVVLAKELTTGREYAVKILQKRHIMKENKVQYVNREKDVMSRLDHPFFVKLYFTFQDPEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVCALEYLHENGIIHRDLKPENILLSEDMHIQITDFGTAKVSSSDSKQELVRANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIVYQLVAGLPPF---RAGNEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLVIDPTKRLGCEELGGYGPLKAHPFFETVTWQDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFGCMQVATSASSPSLAPLEPLLSQRCGSNIEQYIHDLDNNSFELDLQFSEAEKRLLLEKQVGGNQWHQFVENNLIVKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEV 545          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:Xenbase;Acc:XB-GENE-991549])

HSP 1 Score: 291.197 bits (744), Expect = 3.110e-86
Identity = 169/424 (39.86%), Postives = 243/424 (57.31%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEIPVGF---------------------EEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQG 1218
            R  +  DFKFGK +G GSFSTV++AKE++T + YA KI+ K  I K+  V  V  EK+V+ R++H FFV L +TFQDPE+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLH   ++HRD+KPENILLSE+MHI+I DFG+A +   D   ++ +SF GTAQ+VSPE+L                      +E    ++S            D WALGCIVYQ+++G  PF    + +EY IFQKI  L+Y+FP  F   AKD V KLLV++P +RLG    G +  LKAHP F ++ ++ +  Q PP L   +  + +       N+D++   F                      +    NI++   +++           +A+K+ LL+ Q   N +H+FV N LI+K G
Sbjct:  113 RKKRPQDFKFGKILGEGSFSTVVLAKELTTGREYAVKILQKRHIMKENKVQYVNREKDVMSRLDHPFFVKLYFTFQDPEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVCALEYLHENGIIHRDLKPENILLSEDMHIQITDFGTAKVSSSDSKQVRANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIVYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKAKDLVEKLLVIDPTKRLGCEELGGYGPLKAHPFFETVTWQDLHLQTPPKLTAYLPAMSEDDEDCYGNYDDLLSQFGCMQVATSASSPSLAPLEPLLSQRCGSNIEQYIHDLDNNSFELDLQFSEAEKRLLLEKQVGGNQWHQFVENNLIVKMG 499          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: mboat2 (membrane bound O-acyltransferase domain containing 2 [Source:Xenbase;Acc:XB-GENE-960892])

HSP 1 Score: 233.802 bits (595), Expect = 6.753e-66
Identity = 149/470 (31.70%), Postives = 240/470 (51.06%), Query Frame = 1
Query: 1897 MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDG--HRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITG--YDDKHIPCSKK------QLSSALCLSVIHGLLTAYVAPQF--------PYIFVCSTDYQRMH-MTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR 3246
            M+    GST+L PLS  + +PVDQ+NF+ C + ++      R     SK S   R ++    G+ + LFCFG+   + ++QS ++Y I++    +        + + ++ +  + R++ +DYG Y+ D SGP+MI TQK+TSLAF + DG   +  +    Q+R     AV+++P  +++  Y   F G+LAGP   Y +Y  +I G  Y  K    + K      Q       +VIH ++ + V+  F        P  +     +Q    +  RI++  +S    R KYYFAW++ +A   + G G+ G DKNGE NW  V N +   IE G+   + +    I  + +   + YERA  +  T   F +SA WHG YPGYY+ F T SL T  AR +R + R  F+ S   + +Y V+T I T +A++Y   PF LL  +  L F+  +Y+  H+  +  +L +  R
Sbjct:    1 MATSTTGSTLLLPLSRAVQLPVDQVNFVACQVFALLAAIWFRIYLHSSKTSPLIRHVVATLLGLYLALFCFGWYALHFIVQSGIAYYIMIAGRLENMHKFCFVFALGYLTLCQIARVYIFDYGQYSADFSGPMMIMTQKITSLAFEIRDGIFCKEEELTPSQRR----LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYIAFIEGRSYQLKQFEANGKEDPKHEQKEPCPNSAVIHKVIVSAVSLAFYMTATRILPVEYNIDEQFQETSSVLNRIIYLYLSLMAARPKYYFAWTLADAINNAAGFGFQGYDKNGEENWDLVSNLNIKQIEVGNQYLLYISL--ILCSFYSLRVCYERAT-YSATAKTFLLSAIWHGVYPGYYMTFFTGSLMTLAARRIRNNARHHFLHSSELMFVYDVITWIATQVAISYTVAPFVLLSVKPSLQFYSFWYYCLHIACILVLLAMPAR 463          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: mboat1 (membrane bound O-acyltransferase domain containing 1 [Source:Xenbase;Acc:XB-GENE-994274])

HSP 1 Score: 213.001 bits (541), Expect = 1.134e-58
Identity = 129/445 (28.99%), Postives = 219/445 (49.21%), Query Frame = 1
Query: 1966 QINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTY-WCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYI--------------TGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQR-MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRP 3249
            Q+NF+ C L+++ +    R    PS    + R     F G+   +FCFG+   ++     + Y I++   S  + H  ++   M ++ +  + R++ ++YG  + D SGP+MI TQK+T+LAF L DG    +  K+  ++ + +++KK P  +++  Y   F  VLAGP   + +Y  +I               GY     P   + +   LC++     +       FP ++V    +   +   +R+ +  I+    + KYYFAW++ +A   + G G+ G D+ G+  W  + N +   IE+ +S K+ +D WNI T  WL+ + Y+RAP + RT L F +S  WHG YPGYY  F+T       AR +R + R  F  S     LY ++T   T LA+ Y   PF LL     +  +K  YF+ H++    ++ L  +P
Sbjct:   25 QVNFVACQLVALLVAFWFRIYLNPSNAHPAVRHAFATFVGVYFAVFCFGWYSLHIFTLVLLCYCIMI-TASVSNVHRYSFIMAMGYLTLCQINRVYIFNYGILSTDFSGPLMIITQKITTLAFQLHDG--FGRSFKVLSKDQQQYSIKKKPSFLEYLSYHLNFMSVLAGPCSNFQDYIAFIEGRHIQSKLLNSKGNGYTKLPNPSPNEVVIYKLCIAAASLAVFMTFTKAFPILYVVDETFMNTVPFLKRLGYFYIATQACKPKYYFAWTLADAVNNAAGYGFNGVDEKGKFRWDLISNLNIWNIETATSFKMYIDNWNIQTAAWLKRVCYDRAPKY-RTGLTFILSGVWHGVYPGYYFTFVTAIPVMLAARAMRNNFRHYFTTSASWKFLYDIVTWTATQLAICYTVAPFVLLAAGPSVQLYKSLYFYLHIVCFLVLIILPTKP 465          
BLAST of porcupine-like protein vs. Ensembl Xenopus
Match: mboat2 (membrane bound O-acyltransferase domain containing 2 [Source:Xenbase;Acc:XB-GENE-960892])

HSP 1 Score: 206.453 bits (524), Expect = 2.665e-56
Identity = 140/470 (29.79%), Postives = 232/470 (49.36%), Query Frame = 1
Query: 1915 GSTILAPLSNVMGIPVDQ-INFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDG--HRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITG--YDDKHIPCSKK------QLSSALCLSVIHGLLTAYVAPQF--------PYIFVCSTDYQRMH-MTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESG-----SSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR 3246
              T++ P    + + +D  +NF+ C + ++      R     SK S   R ++    G+ + LFCFG+   + ++QS ++Y I++    +        + + ++ +  + R++ +DYG Y+ D SGP+MI TQK+TSLAF + DG   +  +    Q+R     AV+++P  +++  Y   F G+LAGP   Y +Y  +I G  Y  K    + K      Q       +VIH ++ + V+  F        P  +     +Q    +  RI++  +S    R KYYFAW++ +A   + G G+ G DKNGE NW  V N +   IE         ++ L+    I  + +   + YERA  +  T   F +SA WHG YPGYY+ F T SL T  AR +R + R  F+ S   + +Y V+T I T +A++Y   PF LL  +  L F+  +Y+  H+  +  +L +  R
Sbjct:    7 AETVMNPTYRPVELGMDVLVNFVACQVFALLAAIWFRIYLHSSKTSPLIRHVVATLLGLYLALFCFGWYALHFIVQSGIAYYIMIAGRLENMHKFCFVFALGYLTLCQIARVYIFDYGQYSADFSGPMMIMTQKITSLAFEIRDGIFCKEEELTPSQRR----LAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYIAFIEGRSYQLKQFEANGKEDPKHEQKEPCPNSAVIHKVIVSAVSLAFYMTATRILPVEYNIDEQFQETSSVLNRIIYLYLSLMAARPKYYFAWTLADAINNAAGFGFQGYDKNGEENWDLVSNLNIKQIEENLFSLSYYVRYLLYISLILCSFYSLRVCYERAT-YSATAKTFLLSAIWHGVYPGYYMTFFTGSLMTLAARRIRNNARHHFLHSSELMFVYDVITWIATQVAISYTVAPFVLLSVKPSLQFYSFWYYCLHIACILVLLAMPAR 471          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 356.681 bits (914), Expect = 3.409e-109
Identity = 204/512 (39.84%), Postives = 295/512 (57.62%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   51 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS 525          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 356.295 bits (913), Expect = 1.092e-108
Identity = 204/512 (39.84%), Postives = 295/512 (57.62%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS 552          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 331.257 bits (848), Expect = 5.803e-100
Identity = 192/481 (39.92%), Postives = 277/481 (57.59%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVT 1389
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHT 521          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Pdpk1 (3-phosphoinositide dependent protein kinase 1 [Source:MGI Symbol;Acc:MGI:1338068])

HSP 1 Score: 273.863 bits (699), Expect = 2.083e-80
Identity = 146/334 (43.71%), Postives = 209/334 (62.57%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + + + D
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDED 374          
BLAST of porcupine-like protein vs. Ensembl Mouse
Match: Mboat2 (membrane bound O-acyltransferase domain containing 2 [Source:MGI Symbol;Acc:MGI:1914466])

HSP 1 Score: 254.218 bits (648), Expect = 8.722e-73
Identity = 145/447 (32.44%), Postives = 229/447 (51.23%), Query Frame = 1
Query: 1933 PLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKLSGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHLVTYWCMAFMAIVHLYRMH-YDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH-RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYI------------TGYDDKH---IPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQ-RMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAM 3219
            PLSN + +P+DQ+NF+VC L ++      R     SK S   R ++    G+ +  FCFG+   + L+QS +SY I++    +        + + ++++  + R++ +DYG Y+ D SGP+MI TQK+TSLA+ + DG  R ++ +   QR     AV+++P  +++  YT  F G+LAGP   Y +Y  +I             G D++H    P     ++  L +  +  L    ++   P  +     +Q       +  +  +S    R KYYFAW++ +A   + G G+ G DKNG   W  + N     IE  +S K+ +D WNI T  WL+ + YERA  F  TI  F +SA WHG YPGYYL FLT  L T  AR VR + R  F+  P     Y ++T + T + ++Y   PF LL  +    F+  +Y+  HV ++
Sbjct:   14 PLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMQQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGL---AVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERA-TFSPTIQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVPFVLLSIKPSFTFYSSWYYCLHVCSI 456          
BLAST of porcupine-like protein vs. UniProt
Match: sp|O55173|PDPK1_RAT (3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2)

HSP 1 Score: 360.533 bits (924), Expect = 2.823e-109
Identity = 206/522 (39.46%), Postives = 296/522 (56.70%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD---------------------------EIPVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGSFKLSPGTCTQ 1512
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  D    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F SI +E +  Q PP L   +  + + + D                            +     +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S   SP    Q
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPDSKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSAVDASLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS---SPDAAVQ 559          
BLAST of porcupine-like protein vs. UniProt
Match: sp|O15530|PDPK1_HUMAN (3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 2.762e-108
Identity = 202/506 (39.92%), Postives = 293/506 (57.91%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI---------------------PVGFEEAWKFNIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + +       N+D +                       G  +    NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   81 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS 549          
BLAST of porcupine-like protein vs. UniProt
Match: sp|Q9Z2A0|PDPK1_MOUSE (3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 8.506e-108
Identity = 204/512 (39.84%), Postives = 295/512 (57.62%), Query Frame = 1
Query:   67 RTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQ------SNWDEI--PVGFEEAWKF-------------------NIKKEFQEME-----------KADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS 1482
            R  +  DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+MHI+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y FP  F   A+D V KLLVL+  +RLG      +  LKAHP F +I +E +  Q PP L   +  + +       N+D +    GF +                       NI++   +++           + +K+ LL+ Q   NP+H+FV N LI+K G + KR+GLF R+R  LLTEGPHL+YVDP     K E+  +     E KN K F++ T  RTY+L DPS  A +W + I+ +  + Y S
Sbjct:   78 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQS 552          
BLAST of porcupine-like protein vs. UniProt
Match: sp|Q9W0V1|PDPK1_DROME (3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4)

HSP 1 Score: 297.745 bits (761), Expect = 4.420e-84
Identity = 187/527 (35.48%), Postives = 285/527 (54.08%), Query Frame = 1
Query:   82 SDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRI-NHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETR-DNSYSDEPNSDSEE----HSEIEVKRTSSPDN--------------------SREILY------LMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSD-GKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD--------------------------EIPVGFEEAW--KFNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG 1479
            +DF FG+ IG GS+S V +A +I + + YA K+ +K  I ++R  + +  E+EV+ ++ N   FV L+ TFQD   LYF+++YA +G++L ++ R+  FD+ CT+ Y+AE++LA E++H  NVVHRD+KPENILL E+MH  I DFGSA ++   +   ++   + Q  S          R +N   D  + DSEE      E + +   SP +                    S E+L         D WALGCIVYQM++G  PF      ++Y IF++I +   +FP GFD  A+D V KLL ++P +RLG   + G + +++AHP F  ID++ +  Q PP + P + P V  + D                          E+ VG   A   K +  K   ++  A+K + L+ Q+K + +H F    +I+K+G + KR+GLF RKRM LLT GP L Y+DP  M  K E+  +     E KN K+F++ T  RTY+L+DP   A  W ++IE++    YG
Sbjct:  244 NDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFR---GSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYL-PGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLE-QQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPDLRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYG 765          
BLAST of porcupine-like protein vs. UniProt
Match: sp|Q6A1A2|PDPK2_HUMAN (Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 7.842e-79
Identity = 144/328 (43.90%), Postives = 208/328 (63.41%), Query Frame = 1
Query:   85 DFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIII--DKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWD 1062
            DFKFGK +G GSFSTV++A+E++T++ YA KI++K  I K+  V  V  E++V+ R++H FFV L +TFQD E+LYF +SYA+ GELL ++ ++  FD TCT+FY+AEI+ ALEYLHG  ++HRD+KPENILL+E+M+I+I DFG+A ++  +    + +SF GTAQ+VSPE+L                      +E    ++S            D WALGCI+YQ+++G  PF    + +EY IFQKI  L+Y+FP  F   A+D V KLLVL+  +RLG      +  LKAHP F S+ +E +  Q PP L   +  + + + D
Sbjct:   54 DFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMYIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELL----------------------TEKSACKSS------------DLWALGCIIYQLVAGLPPFR---AGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDED 344          
BLAST of porcupine-like protein vs. TrEMBL
Match: tr|B1NWW2|B1NWW2_SCHMD (Porcupine-like protein (Fragment) OS=Schmidtea mediterranea GN=Porcn-a PE=2 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 337/337 (100.00%), Postives = 337/337 (100.00%), Query Frame = 1
Query: 2299 QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR 3309
            QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR
Sbjct:    1 QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR 337          
BLAST of porcupine-like protein vs. TrEMBL
Match: tr|F1CDE0|F1CDE0_SCHPL (Porcupine-1 (Fragment) OS=Schmidtea polychroa PE=2 SV=1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 328/337 (97.33%), Postives = 334/337 (99.11%), Query Frame = 1
Query: 2299 QTQKLTSLAFNLLDGHRINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNIMNNVFTRKAQYR 3309
            QTQKLTSLAFNLLDGHRI+QG+KL Q+NHESHAV+KLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSL TFCAR+VRKHIRPLF+VSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVN MNNVFTRKAQYR
Sbjct:    1 QTQKLTSLAFNLLDGHRIDQGMKLDQKNHESHAVRKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKEYITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQRMHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNWSKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVFTVSAFWHGFYPGYYLMFLTFSLSTFCARSVRKHIRPLFVVSPITLQLYHVLTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFRPIINDKVNQMNNVFTRKAQYR 337          
BLAST of porcupine-like protein vs. TrEMBL
Match: tr|C1L448|C1L448_SCHJA (Putative 3-phosphoinositide dependent protein kinase-1 OS=Schistosoma japonicum GN=hPDK1 PE=2 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 8.349e-162
Identity = 242/496 (48.79%), Postives = 342/496 (68.95%), Query Frame = 1
Query:   49 TKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEF----QEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYGS-----FKLSPGTCT 1509
            T   N+   K SDFKFGKEIGHGSFSTV + +EIST+  +A K++DK  + + + V++V++EKEVL+R NH F + L+ TFQD  RL++++ YA  GELLS+LT  +   + CT+FY+AEI++AL+YLH +++VHRD+KPEN+LL++ MHIK+ DFGSA+I++ P++K  +FTGT ++VSPEML        +  S + NS S +             NS+++ YLMDFWA GCI+YQ++SG  PF      HEYE FQKI +L Y F   FD  AKD V KLLV++P ERLG+PS G   +++ H  F  I ++ +  Q+PPLL+PN+EPI    WD++PVGFE+A K+++ +E      E+ + D+ +LL  QE+ NPF+RFVR RLI+KQGIL+KRRGLF+RKRMFLLTEGPHLFYVD + M  K EV+ +    +EV+++K+F+I    +TY+LEDPS  AD+W + I ++  +Y+       F   P T T
Sbjct:    6 TNEINRHIPKPSDFKFGKEIGHGSFSTVYVVQEISTSSEFAMKVVDKQRVWRYKAVDSVLMEKEVLKRTNHVFIIRLHCTFQDSTRLFYLLEYARCGELLSYLTHFTSLSVHCTRFYAAEILMALDYLHSVSIVHRDLKPENVLLTDRMHIKLADFGSAVILNSPNIKAPNFTGTPEYVSPEML--------SRISRQGNSSSND------------GNSQDLTYLMDFWAFGCIIYQLISGFPPFRKSGPAHEYETFQKILSLSYTFASNFDPIAKDLVEKLLVISPSERLGSPSHGGSVSVRQHMFFSEIKWDTLPHQEPPLLVPNLEPIAPEGWDDLPVGFEDAEKYHLSRELSLVASEITEDDRIRLLNTQERHNPFNRFVRGRLILKQGILFKRRGLFSRKRMFLLTEGPHLFYVDMENMTLKGEVAWSSSLTLEVRSNKLFFIHVPNKTYYLEDPSGHADDWVKQIAAVKTQYFSDTPQTLFSNYPSTST 481          
BLAST of porcupine-like protein vs. TrEMBL
Match: tr|A0A183A8J4|A0A183A8J4_9TREM (Uncharacterized protein OS=Echinostoma caproni PE=4 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 9.069e-159
Identity = 243/472 (51.48%), Postives = 328/472 (69.49%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHA-ALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEF----QEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYY 1476
            + SDF+FGKEIG GSFSTV + +E++TN  +A K++DK  + + R V +V++EKEVL+R NH F + L YTFQD  RL++++ YA  G LL +LTRL+ FD+ C +FY+AEI +ALEYLH   +VHRD+KPEN+LL+ENMHIK+ DFGSAII++   +K  SFTGT ++VSPEML  S  +R +   DE N +++     + K   +P +  E  YLMD+WA GC++YQ LSGR PF    + H YE F KI NL Y F  GFD  AKD V +LLV++PL+RLG+P++G    A++ H  F+ ID++ + +Q PP+L PN+EPI  + WD  P GF+E  KF    E      ++   ++ KLL  QE+ NPFHRFVRNRLIIKQGIL+KRRGLF RKRMFLLTEGPHLFYVD D+M  K EV  +    +E K+DK+F+I+   RTY+LEDPS  A +W + I ++   Y+
Sbjct:   16 RPSDFRFGKEIGQGSFSTVYVVREVATNAEFAMKVVDKQHVRRNRAVESVIMEKEVLKRTNHIFIIRLYYTFQDESRLFYVLEYARGGALLDYLTRLTSFDIPCARFYAAEIFIALEYLHKQCIVHRDLKPENVLLTENMHIKLADFGSAIILNDSKVKAPSFTGTPEYVSPEML--SPCSRIDEDDDEDNDEAK-----QTKTEPNPYSYEETAYLMDYWAFGCVIYQFLSGRPPFRPERNGHAYETFGKILNLSYSFADGFDPVAKDLVKQLLVIDPLKRLGSPANGNGPRAIQTHEFFQGIDWDTLPNQNPPILHPNVEPIAPAGWDTAPQGFKEIEKFLTSNELGLSASQVTDNERPKLLALQERQNPFHRFVRNRLIIKQGILFKRRGLFARKRMFLLTEGPHLFYVDVDSMNLKGEVLWSSFLTLEQKSDKLFFIIVPNRTYYLEDPSGNASDWVEQISAVHSIYF 480          
BLAST of porcupine-like protein vs. TrEMBL
Match: tr|H2KP16|H2KP16_CLOSI (3-phosphoinositide dependent protein kinase-1 OS=Clonorchis sinensis GN=CLF_101215 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 2.814e-158
Identity = 237/485 (48.87%), Postives = 328/485 (67.63%), Query Frame = 1
Query:   76 KASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVFISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGELLSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENMHIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEPNSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVRHSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGKHAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWKFNIKKEFQE----MEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLFTRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKRRTYFLEDPSAKADEWRQSIESICVEYYG--SFKLSPGTCTQ 1512
            + SDF+FGKEIG GSFS V + +EI++N  +A K+++K  + + + V +V +EK VL R+NH F + L+YTFQD  RL+F++ YA  GELL+HL RL+ FDL C++FY+AEI++AL YLH  ++VHRDIKPEN+LL+E MHIK+ DFGSAII++ P +K   FTGT ++VSPEML         S++DE +  S +    E           +  YLMD+WA GC+VYQ +SGR PF      H Y+IF +I  L Y+F  GFD  A+D V KLLV+NP++RLG+P++G   A++ H  F  ID++ + +Q  P+LLPN+EPI  S+WD +P GF+E   + +  EF      + + ++ +LL  QE+ NP+HRFVRNRLI+KQG+L+KRRGLF RKRMFLLTEGPHLFYVD DAM  K EV  +    +E+K+DK+F+I    RT++LEDPS KA  W   + ++   YY   S  + P   TQ
Sbjct:  142 RPSDFRFGKEIGQGSFSNVYVVREIASNAEFAMKVVEKQHVVRNKAVESVHMEKAVLTRVNHVFIIRLHYTFQDSSRLFFVLEYARGGELLTHLNRLTSFDLPCSRFYAAEILVALNYLHTQSIVHRDIKPENVLLTETMHIKLADFGSAIILNDPKVKAPGFTGTPEYVSPEMLS------SRSFADESSPSSSQSFSFE-----------DTAYLMDYWAFGCVVYQFISGRPPFRTEKHHHAYDIFGQILGLSYKFLDGFDTVARDLVQKLLVINPMDRLGSPTNGGPVAVQEHLFFSGIDWDSLPNQPAPILLPNLEPIAPSDWDSLPAGFDEGQMYLLSCEFASAVTPIPETERSRLLSAQERQNPYHRFVRNRLILKQGVLFKRRGLFARKRMFLLTEGPHLFYVDMDAMSLKGEVPWSSFLTLELKSDKLFFIRIPNRTFYLEDPSGKAAAWVAQLSAVKQAYYAEPSCGVDPVLSTQ 609          
The following BLAST results are available for this feature:
BLAST of porcupine-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
PDPK14.932e-10939.923-phosphoinositide dependent protein kinase 1 [Sou... [more]
PDPK15.375e-10939.923-phosphoinositide dependent protein kinase 1 [Sou... [more]
PDPK17.030e-8044.213-phosphoinositide dependent protein kinase 1 [Sou... [more]
MBOAT21.125e-7133.86membrane bound O-acyltransferase domain containing... [more]
MBOAT12.394e-6532.18membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
pdk-13.890e-7531.183-phosphoinositide-dependent protein kinase 1 [So... [more]
pdk-11.636e-7431.413-phosphoinositide-dependent protein kinase 1 [So... [more]
mboa-31.552e-6632.11Membrane Bound O-Acyl transferase, MBOAT [Source:... [more]
mboa-48.135e-6128.83Membrane Bound O-Acyl transferase, MBOAT [Source:... [more]
mboa-41.909e-5627.81Membrane Bound O-Acyl transferase, MBOAT [Source:... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Pdk18.739e-8635.48Phosphoinositide-dependent kinase 1 [Source:FlyBas... [more]
Pdk18.739e-8635.48Phosphoinositide-dependent kinase 1 [Source:FlyBas... [more]
Pdk18.739e-8635.48Phosphoinositide-dependent kinase 1 [Source:FlyBas... [more]
Pdk13.515e-8535.48Phosphoinositide-dependent kinase 1 [Source:FlyBas... [more]
Pdk14.471e-8535.48Phosphoinositide-dependent kinase 1 [Source:FlyBas... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
pdpk1a9.379e-11040.403-phosphoinositide dependent protein kinase 1a [So... [more]
pdpk1a1.191e-10940.403-phosphoinositide dependent protein kinase 1a [So... [more]
pdpk1b2.184e-10639.693-phosphoinositide dependent protein kinase 1b [So... [more]
mboat2b1.355e-7432.69membrane bound O-acyltransferase domain containing... [more]
mboat2a2.401e-7332.26membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
pdpk11.144e-11040.433-phosphoinositide dependent protein kinase 1 [Sou... [more]
pdpk13.110e-8639.863-phosphoinositide dependent protein kinase 1 [Sou... [more]
mboat26.753e-6631.70membrane bound O-acyltransferase domain containing... [more]
mboat11.134e-5828.99membrane bound O-acyltransferase domain containing... [more]
mboat22.665e-5629.79membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Pdpk13.409e-10939.843-phosphoinositide dependent protein kinase 1 [Sou... [more]
Pdpk11.092e-10839.843-phosphoinositide dependent protein kinase 1 [Sou... [more]
Pdpk15.803e-10039.923-phosphoinositide dependent protein kinase 1 [Sou... [more]
Pdpk12.083e-8043.713-phosphoinositide dependent protein kinase 1 [Sou... [more]
Mboat28.722e-7332.44membrane bound O-acyltransferase domain containing... [more]
back to top
BLAST of porcupine-like protein vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55173|PDPK1_RAT2.823e-10939.463-phosphoinositide-dependent protein kinase 1 OS=R... [more]
sp|O15530|PDPK1_HUMAN2.762e-10839.923-phosphoinositide-dependent protein kinase 1 OS=H... [more]
sp|Q9Z2A0|PDPK1_MOUSE8.506e-10839.843-phosphoinositide-dependent protein kinase 1 OS=M... [more]
sp|Q9W0V1|PDPK1_DROME4.420e-8435.483-phosphoinositide-dependent protein kinase 1 OS=D... [more]
sp|Q6A1A2|PDPK2_HUMAN7.842e-7943.90Putative 3-phosphoinositide-dependent protein kina... [more]
back to top
BLAST of porcupine-like protein vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|B1NWW2|B1NWW2_SCHMD0.000e+0100.00Porcupine-like protein (Fragment) OS=Schmidtea med... [more]
tr|F1CDE0|F1CDE0_SCHPL0.000e+097.33Porcupine-1 (Fragment) OS=Schmidtea polychroa PE=2... [more]
tr|C1L448|C1L448_SCHJA8.349e-16248.79Putative 3-phosphoinositide dependent protein kina... [more]
tr|A0A183A8J4|A0A183A8J4_9TREM9.069e-15951.48Uncharacterized protein OS=Echinostoma caproni PE=... [more]
tr|H2KP16|H2KP16_CLOSI2.814e-15848.873-phosphoinositide dependent protein kinase-1 OS=C... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 20..41
NoneNo IPR availableTMHMMTMhelixcoord: 35..54
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 57..76
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
NoneNo IPR availableTMHMMTMhelixcoord: 272..291
NoneNo IPR availableTMHMMTMhelixcoord: 354..376
NoneNo IPR availableTMHMMTMhelixcoord: 178..196
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availablePFAMPF14593PH_3coord: 379..479
e-value: 2.9E-31
score: 107.5
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 84..314
e-value: 1.2E-56
score: 190.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 6..83
e-value: 5.7E-22
score: 77.1
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.56
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
NoneNo IPR availableTMHMMTMhelixcoord: 12..29
NoneNo IPR availableTMHMMTMhelixcoord: 4..23
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 4..21
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 13..31
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..10
score: 0.482
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
IPR004299Membrane bound O-acyl transferase, MBOATPFAMPF03062MBOATcoord: 123..392
e-value: 1.7E-24
score: 86.7
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 18..313
e-value: 5.2E-83
score: 291.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 229..298
e-value: 2.6E-9
score: 36.7
coord: 19..197
e-value: 4.0E-44
score: 150.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 18..313
score: 43.495
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 390..479
e-value: 1.5E-5
score: 34.5
IPR011993PH domain-likeGENE3DG3DSA:2.30.29.30coord: 364..480
e-value: 4.1E-41
score: 139.7
coord: 315..327
e-value: 4.1E-41
score: 139.7
IPR011993PH domain-likeSUPERFAMILYSSF50729PH domain-likecoord: 307..327
coord: 364..481
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 24..47
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 137..149
IPR011009Protein kinase-like domainSUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 224..335
coord: 15..189

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004299MBOAT_fam
IPR000719Prot_kinase_dom
IPR001849PH_domain
IPR011993PH_dom-like
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000005Stage 5
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000049digestive system
PLANA:0000026definitive gut
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025591 ID=SMED30025591|Name=porcupine-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3526bp
TTCCGATCTTTTCTTTTGAAATTTTTGAAATTTTAAATAAAATTAATGAC
AAAGGCAGAAAATCAGAGAACTACTAAAGCATCCGACTTCAAATTTGGAA
AAGAAATCGGCCATGGCTCGTTCTCAACTGTAATGATAGCTAAGGAAATT
TCTACCAATAAACATTATGCTGCAAAAATTATTGATAAAGTTTTTATTTC
TAAACAGCGAATGGTTAATACTGTTATGATTGAAAAAGAAGTTCTCCGAA
GAATAAATCACCAGTTTTTTGTATGTCTCAATTATACATTCCAAGATCCA
GAGAGATTGTATTTTATTATATCATATGCCGAACGAGGAGAACTTTTATC
TCATTTAACAAGACTTTCGTGTTTTGATTTAACGTGCACACAATTTTATT
CCGCGGAAATTATTCTTGCATTAGAATATTTACATGGAATTAACGTTGTT
CATCGAGATATAAAACCAGAAAATATTTTACTGAGTGAAAATATGCATAT
AAAAATTTGTGATTTTGGCAGTGCAATTATTATCGATAAACCAGATCTCA
AGCCTTCTTCTTTTACAGGTACAGCTCAATTCGTTTCTCCAGAAATGCTG
GGATTCAGTAAAGAAACACGTGACAATAGCTATTCAGATGAACCGAATTC
TGATTCAGAGGAACATAGCGAAATTGAAGTTAAACGAACTAGTTCACCTG
ATAATTCTAGGGAAATATTATATCTAATGGACTTCTGGGCATTAGGATGC
ATCGTCTATCAAATGTTGTCTGGACGAATGCCATTTCACGTCAGGCATTC
ACGGCATGAATATGAAATTTTCCAAAAGATCCGAAATTTAAAATATGAGT
TTCCGGTTGGGTTTGATGATACTGCTAAAGATTTTGTCTCTAAACTTCTT
GTATTGAATCCACTGGAAAGATTAGGCAATCCATCCGATGGAAAGCACGC
TGCTTTAAAAGCCCACCCCCTTTTCCGTTCAATTGATTTCGAAATTATCG
GATCACAAAAACCTCCGCTATTACTTCCAAATATTGAGCCCATTGTTCAA
AGTAATTGGGACGAAATTCCTGTTGGTTTTGAAGAAGCATGGAAATTCAA
TATCAAAAAAGAGTTTCAAGAAATGGAAAAAGCCGATAAACAAAAATTAT
TGCAAAACCAAGAAAAACTAAATCCGTTTCATAGATTTGTACGCAATCGA
TTGATCATAAAACAAGGCATCTTGTACAAACGGCGTGGATTATTTACTCG
TAAAAGAATGTTTCTATTAACTGAAGGACCTCATTTATTTTATGTCGACC
CCGATGCTATGCAATTTAAAAAAGAAGTCAGTCTAAACTTAATTACTGGC
ATAGAAGTAAAAAATGACAAAGTATTTTATATCGTTACTAAAAGGCGAAC
ATATTTTCTCGAAGATCCTTCAGCAAAGGCTGATGAATGGCGACAGAGTA
TTGAATCGATTTGTGTAGAATATTATGGATCATTTAAATTATCCCCTGGC
ACTTGCACTCAAACGCCTCTAGTTACATCATCTGAATCATAACTTTCGGT
TTTATTTAAATTTATTTGTCATATAGAAAAAAATGTGAATTTAACGGTTT
TTAATATAATAATTTAATATTGGTTTGAATTCTTGTTTTTCATTTTAAAA
TTTAATGGATATAATTTAAATATTTTAATAAATAAAAATATTCACATTGT
TTTAATATTCTCTTTATGTCGTAATTGATAAATGATGCATTGTAAATGTA
TTTTACAACTGATCTAAATGAAACCAATAGGAAACGAGTGGTTCGATGTC
ATGTGAATCAGCATGCAACCAATCATAGTTTTGTGATTCATTAAATATAT
TTTAAATTTTTAAAACAAATTAAATCACTTAATTAATTTTTAGACAATGT
CACAATTTTATGGCGGATCCACGATATTGGCACCTCTATCGAACGTTATG
GGTATACCAGTGGATCAAATTAATTTTATTGTGTGTAGTTTATTGTCAAT
CGGACTGGGTCAAATTATGCGACACAAATTCCCTCCTTCTAAATTGTCAG
GAAGTACAAGAGGAATCATAGAAGCATTTTTTGGAATACTAATTGTTCTT
TTCTGCTTCGGATACCAAGTCAAGTATTTGTTACTACAATCAACAGTTTC
CTATGTAATACTATTATTTTTGCCTTCACAAATATCAGCGCATTTGGTAA
CGTATTGGTGTATGGCTTTCATGGCGATAGTCCATTTATACAGGATGCAT
TACGATTACGGAGGTTATACTCTCGATATATCTGGTCCGGTTATGATTCA
AACCCAAAAATTGACCAGCCTCGCATTTAATCTTCTAGATGGACATCGAA
TAAATCAAGGAATAAAACTGCAACAGAGAAATCATGAATCTCACGCTGTG
AAAAAACTACCAGATGCAATCAAGTTTTTCGGTTACACATTCTACTTTCA
TGGTGTATTAGCGGGTCCTTTTGTATTCTACAATGAATATAAAGAATATA
TCACTGGATATGACGACAAGCATATTCCATGCTCCAAAAAGCAATTATCT
TCAGCACTTTGTTTATCAGTGATCCATGGATTATTAACAGCATATGTCGC
ACCGCAGTTTCCATATATATTTGTTTGCAGCACCGATTACCAACGGATGC
ATATGACTCGTAGAATAATGTTCACAATGATTTCATTTTTCCTCGTAAGA
CAAAAGTATTACTTTGCCTGGTCAATGGTTGAAGCTGGTGCTCTTAGTAC
CGGATTGGGATATTGTGGAAAGGATAAAAACGGAGAGAATAATTGGTCGA
AAGTGAAAAATTACGATTTCATGGCAATCGAAAGCGGCAGTAGTTTGAAA
GTGCTAGTGGACGGATGGAATATTTCCACAACAAGATGGCTCAGAGAATT
AATTTATGAACGAGCTCCTTTATTCTGTCGGACAATTCTAGTTTTCACCG
TCAGTGCATTTTGGCATGGATTCTATCCTGGATATTATTTGATGTTTTTG
ACATTTTCTCTCTTTACGTTTTGCGCTAGAACCGTTAGGAAACACATTCG
ACCATTGTTCATTGTCAGTCCAATTACACTTCAACTCTATCATGTTCTAA
CGAAAATATTCACAAATCTGGCTTTAAATTACGGACAAGGACCATTTTAT
TTGCTGGAGTTTCAATCGGGACTTTTGTTTTGGAAGCCATATTACTTTTT
CGGACACGTTCTAGCAATGTTCTGCGTATTGACCTTGCAATTTCGGCCGA
TAATCAACGACAAAGTCAACATAATGAACAATGTTTTCACCAGAAAAGCC
CAATATCGGTTTCAGAAACTAAAGATCCATTTGCAGAAAAAGTTGAGATG
AAATTTTATTGATTTTGATAATTTATATAAAATATTATAATTTTGTTTTT
CGTTTTATTTTTATATCGATGAATTTATGATAAATGCTAAATATTCGATC
CGGAATGAATTATTATTAATCTGGTTTTTATAATTGTTCATTTTTAATAG
TTTTGTTTGTTTTTCGAAAATGGCGG
back to top

protein sequence of SMED30025591-orf-1

>SMED30025591-orf-1 ID=SMED30025591-orf-1|Name=SMED30025591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=485bp
MSQFYGGSTILAPLSNVMGIPVDQINFIVCSLLSIGLGQIMRHKFPPSKL
SGSTRGIIEAFFGILIVLFCFGYQVKYLLLQSTVSYVILLFLPSQISAHL
VTYWCMAFMAIVHLYRMHYDYGGYTLDISGPVMIQTQKLTSLAFNLLDGH
RINQGIKLQQRNHESHAVKKLPDAIKFFGYTFYFHGVLAGPFVFYNEYKE
YITGYDDKHIPCSKKQLSSALCLSVIHGLLTAYVAPQFPYIFVCSTDYQR
MHMTRRIMFTMISFFLVRQKYYFAWSMVEAGALSTGLGYCGKDKNGENNW
SKVKNYDFMAIESGSSLKVLVDGWNISTTRWLRELIYERAPLFCRTILVF
TVSAFWHGFYPGYYLMFLTFSLFTFCARTVRKHIRPLFIVSPITLQLYHV
LTKIFTNLALNYGQGPFYLLEFQSGLLFWKPYYFFGHVLAMFCVLTLQFR
PIINDKVNIMNNVFTRKAQYRFQKLKIHLQKKLR*
back to top

protein sequence of SMED30025591-orf-2

>SMED30025591-orf-2 ID=SMED30025591-orf-2|Name=SMED30025591-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MTKAENQRTTKASDFKFGKEIGHGSFSTVMIAKEISTNKHYAAKIIDKVF
ISKQRMVNTVMIEKEVLRRINHQFFVCLNYTFQDPERLYFIISYAERGEL
LSHLTRLSCFDLTCTQFYSAEIILALEYLHGINVVHRDIKPENILLSENM
HIKICDFGSAIIIDKPDLKPSSFTGTAQFVSPEMLGFSKETRDNSYSDEP
NSDSEEHSEIEVKRTSSPDNSREILYLMDFWALGCIVYQMLSGRMPFHVR
HSRHEYEIFQKIRNLKYEFPVGFDDTAKDFVSKLLVLNPLERLGNPSDGK
HAALKAHPLFRSIDFEIIGSQKPPLLLPNIEPIVQSNWDEIPVGFEEAWK
FNIKKEFQEMEKADKQKLLQNQEKLNPFHRFVRNRLIIKQGILYKRRGLF
TRKRMFLLTEGPHLFYVDPDAMQFKKEVSLNLITGIEVKNDKVFYIVTKR
RTYFLEDPSAKADEWRQSIESICVEYYGSFKLSPGTCTQTPLVTSSES*
back to top
Aliases
The feature 'porcupine-like protein' has the following synonyms
Synonym
porcn-A
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025591
GenBankABW97518.1