G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30025577
Length (bp)1368
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025577) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025577) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025577) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30025577) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025577

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025577SMESG000026034.1 SmedASXL_011914SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30025577SMESG000026034.1 dd_Smed_v4_14785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30025577SMESG000026034.1 dd_Smed_v4_14785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025577SMESG000026034.1 dd_Smed_v4_14785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025577SMESG000026034.1 dd_Smed_v6_14785_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 56.9954 bits (136), Expect = 3.543e-8
Identity = 75/335 (22.39%), Postives = 144/335 (42.99%), Query Frame = 1
Query:  136 LSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGT-------CRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDI----DESASLPFESTMN 1104
            L + GI G+L+ ++V+ + R     T  +   ++ SD L+ +    DL   +    +    L       C+L  F     ++   +    LS+ER  ++  P+R++++ T GR K +I V+    F S+  I +L   E  NGT       CR       S  +T  ++   +  F  +              L  L+S+   ++   + G+    +S + +  K +V ++++ V   +    +L F +     S+  + G L   + +S + NL+   L Y +   N I Y ++  K++     +L  F PF +R +    DES+    ES++N
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLL------CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPV------------FCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFIL--CWLPFHVGRYLFSKSFEPGSLEIAQ-ISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLL-GFEPFSQRKLSTLKDESSRAWTESSIN 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: nmur-2 (NMUR (NeuroMedin U Receptor) homolog [Source:UniProtKB/TrEMBL;Acc:O17239])

HSP 1 Score: 49.2914 bits (116), Expect = 3.291e-6
Identity = 37/127 (29.13%), Postives = 65/127 (51.18%), Query Frame = 1
Query:  142 LAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSS 522
            L G+FG++   IVI  ++   + T Y+   L++SD + LI+    + FY  L+  Y     R +   C+ R F I F S+ + ++    S ER +++ +P+RS+I  T  R   +I +     FV +
Sbjct:   43 LLGLFGNICTCIVIAANKSMHNPTNYYLFSLAVSDIIALIL-GLPMEFYQSLDYSY---PYRFSEGICKARAFLIEFTSYASIMIICCFSFERWLAICHPLRSKIFSTLWRANVLIILAWTISFVCA 165          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ghsrb (growth hormone secretagogue receptor b [Source:ZFIN;Acc:ZDB-GENE-090327-1])

HSP 1 Score: 53.5286 bits (127), Expect = 2.479e-7
Identity = 69/298 (23.15%), Postives = 136/298 (45.64%), Query Frame = 1
Query:  130 ALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFG---CELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQ 1011
            + L L GI G+L+ I+V+ K++     T  +   +++SD L+ +    DLY  +    +          FG   C+L  F     +++  +    LS+ER  ++  P+R+++I T GR K +I +L      S+  I +L   E  NGT   +T+   + +     Y I   L   + ++  +   + ++ L  L+S+   R+   +  NP    S + +  K +V ++++ V   V    +L F +     S+  +      ++ +S++ NL+   L Y +   N I Y ++  KF+
Sbjct:   50 SFLFLVGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIFLCMPLDLYRVWRYRPWN---------FGDELCKLFQFVSESCTYSTILNITALSVERYFAICFPLRAKVIVTRGRVKGVILLLWTVALCSAGPIFILVGVEHENGTNAWETNECKATE-----YAIRSGLLTMMVWVSSVFFFLPVLCLTVLYSLIGRRLWRRK-ENPVGPISSRDKSNKQTVKMLAVVVLAFVL--CWLPFHVGRYLVSKSSEANSPVISQ-ISEYCNLVSFVLFYLSAAINPILYNIMSKKFR 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ghsra (growth hormone secretagogue receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-238])

HSP 1 Score: 52.7582 bits (125), Expect = 4.011e-7
Identity = 72/317 (22.71%), Postives = 135/317 (42.59%), Query Frame = 1
Query:   85 NLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSS-VIDMLTFERVNGT-------CRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQ 1011
            N+ P+ V    + +  L    G+ G+LM I+V+ K++     T  +   ++ SD L+ +    DLY  +    +     N  NI  C+L  F     +++  +    LS+ER  ++  P+R++++ T GR + +I VL    F S+  V  ++  E  NGT       C+   +   S  +T  ++   +  F  +      ++ +  +I  KL   KR+ IG     N + +     +  KM  +++   V  L   P  +   LI  +   G     +  + C     NL+   L Y +   N I Y ++  K++
Sbjct:   30 NIFPIPVLTGVTVTCVLFFFVGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRIWRYRPW-----NFGNIL-CKLFQFVSECCTYSTILNITALSVERYFAICFPLRAKVVVTKGRVRGVILVLWIVSFFSAGPVFVLVGVEHENGTNSWDTNECKATEYAIRSGLLTIMVWVSSIFFFLPV----FCLTVLYSLIGRKLWKRKRETIGE----NASSRDKSNRQTVKMLAVVVFAFV--LCWLPFHVGRYLISKSTEMGSPVMSIISHYC-----NLISFVLFYLSAAINPILYNIMSKKYR 325          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ghsra (growth hormone secretagogue receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-238])

HSP 1 Score: 46.9802 bits (110), Expect = 9.673e-6
Identity = 32/118 (27.12%), Postives = 60/118 (50.85%), Query Frame = 1
Query:  145 AGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVL 498
             G+ G+LM I+V+ K++     T  +   ++ SD L+ +    DLY  +    +     N  NI  C+L  F     +++  +    LS+ER  ++  P+R++++ T GR + +I VL
Sbjct:   50 VGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRIWRYRPW-----NFGNIL-CKLFQFVSECCTYSTILNITALSVERYFAICFPLRAKVVVTKGRVRGVILVL 161          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: GHSR (growth hormone secretagogue receptor [Source:NCBI gene;Acc:100497774])

HSP 1 Score: 60.8474 bits (146), Expect = 1.798e-9
Identity = 76/304 (25.00%), Postives = 141/304 (46.38%), Query Frame = 1
Query:  133 LLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFG---CELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGT-------CRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQ 1011
            LL + GI G++M ++V+ K++     T  +   ++ SD L+ +    DLY    L +Y      R   FG   C+L  F     +++  +    LS+ER  ++  P++++++ T GR K +ISVL    FVS+  I +L   E  NGT       C+   +   S  +T  ++T  +  F  +      ++ +  +I  KL   KR+ IG H        +S + +  K +V ++++ V   +    +L F +     S+  + G L +   +S + NL+   L Y +   N I Y ++  K++
Sbjct:   50 LLFIIGISGNVMTMLVVSKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLY---RLWQY------RPWNFGSSLCKLFQFVSECCTYSTILNITALSVERYFAICFPLKAKVVITKGRVKLVISVLWAVSFVSAGPIFVLVGVEHENGTNPLDTNECKATEYAIKSGLLTIMVWTSSIFFFLPV----FCLTVLYTLIGRKLWRRKRETIGPH--------TSIRDKHNKQTVKMLAVVVFAFIL--CWLPFHVARYLFSKSFEAGSL-EIALISQYCNLVSFVLFYLSAAINPILYNIMSKKYR 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ghsr (growth hormone secretagogue receptor [Source:MGI Symbol;Acc:MGI:2441906])

HSP 1 Score: 51.2174 bits (121), Expect = 1.657e-6
Identity = 39/150 (26.00%), Postives = 70/150 (46.67%), Query Frame = 1
Query:  136 LSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGTCRRKTH 582
            L + GI G+L+ ++V+ + R     T  +   ++ SD L+ +    DL   +    +    L       C+L  F     ++   +    LS+ER  ++  P+R++++ T GR K +I V+    F S+  I +L   E  NGT  R T+
Sbjct:   52 LFVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLL------CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHENGTDPRDTN 195          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95254|GHSR_PIG (Growth hormone secretagogue receptor type 1 OS=Sus scrofa OX=9823 GN=GHSR PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.693e-9
Identity = 74/328 (22.56%), Postives = 150/328 (45.73%), Query Frame = 1
Query:  136 LSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDI----DESASLPFESTMN 1104
            L + GI G+L+ ++V+ + R     T  +   ++ SD L+ +    DL+  +    +     N  N+  C+L  F     ++   +    LS+ER  ++  P+R++++ T GR K +I V+    F S+  I +L   E  NGT  R T+   + +     + +   L   + ++  +   + +  L  L+S+   ++   + G     SS + +  K +V ++++ V   +    +L F +     S+  + G +   + +S + NL+   L Y +   N I Y ++  K++     +L  F PF +R +    DES+    ES++N
Sbjct:   53 LFVVGIAGNLLTMLVVSRFREMRTTTNLYLSSMAFSDLLIFLCMPLDLFRLWQYRPW-----NLGNLL-CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHDNGTDPRDTNECRATE-----FAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWRRKRGEAAVGSSLRDQNHKQTVKMLAVVVFAFIL--CWLPFHVGRYLFSKSLEPGSVEIAQ-ISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLL-GFEPFSQRKLSTLKDESSRAWTESSIN 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4L1|GHSR_MUSPF (Growth hormone secretagogue receptor type 1 OS=Mustela putorius furo OX=9669 GN=GHSR PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.971e-8
Identity = 72/328 (21.95%), Postives = 147/328 (44.82%), Query Frame = 1
Query:  136 LSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDI----DESASLPFESTMN 1104
            L + GI G+L+ ++V+ + R     T  +   ++ SD L+ +    DL   +    +    L       C+L  F     ++   +    LS+ER  ++  P+R++++ T GR K +I V+    F S+  I +L   E  NGT  R T+   + +     + +   L   + ++  +   + +  L  L+S+   ++   + G     +S + +  K +V ++++ V   +    +L F +     S+  + G L   + +S + NL+   L Y +   N I Y ++  K++     +L  F PF +R +    DES+    E+++N
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLL------CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHENGTDPRDTNECRATE-----FAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWRRKRGEAAVGASLRDQNHKQTVKMLAVVVFAFIL--CWLPFHVGRYLFSKSFEPGSLEIAQ-ISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLL-GFEPFSQRKLSTLKDESSRAWTETSIN 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4K9|GHSR_RABIT (Growth hormone secretagogue receptor type 1 OS=Oryctolagus cuniculus OX=9986 GN=GHSR PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.613e-7
Identity = 71/328 (21.65%), Postives = 147/328 (44.82%), Query Frame = 1
Query:  136 LSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDI----DESASLPFESTMN 1104
            L + GI G+L+ ++V+ + R     T  +   ++ SD L+ +    DL   +    +    L       C+L  F     ++   +    LS+ER  ++  P+R++++ T GR K +I V+    F S+  I +L   E  NG     T P  + +   + + +   L   + ++  +   + +  L  L+S+   ++   + G+    SS + +  + +V ++++ V   +    +L F +     S+  + G L   + +S + NL+   L Y +   N I Y ++  K++     +L  F PF +R +    DES+    +S++N
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLL------CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWALAFCSAGPIFVLVGVEHENG-----TDPQDTNECRATEFAVRSGLLTIMVWVSSVFFFLPVFCLTVLYSLIGRKLWRRKRGDGAVGSSLRDQNHRQTVKMLAVVVFAFIL--CWLPFHVGRYLFSKSFEPGSLEIAQ-ISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLL-GFEPFSQRKLSTLKDESSRAWTKSSIN 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92847|GHSR_HUMAN (Growth hormone secretagogue receptor type 1 OS=Homo sapiens OX=9606 GN=GHSR PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.701e-7
Identity = 75/335 (22.39%), Postives = 144/335 (42.99%), Query Frame = 1
Query:  136 LSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGT-------CRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDI----DESASLPFESTMN 1104
            L + GI G+L+ ++V+ + R     T  +   ++ SD L+ +    DL   +    +    L       C+L  F     ++   +    LS+ER  ++  P+R++++ T GR K +I V+    F S+  I +L   E  NGT       CR       S  +T  ++   +  F  +              L  L+S+   ++   + G+    +S + +  K +V ++++ V   +    +L F +     S+  + G L   + +S + NL+   L Y +   N I Y ++  K++     +L  F PF +R +    DES+    ES++N
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLL------CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPV------------FCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFIL--CWLPFHVGRYLFSKSFEPGSLEIAQ-ISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLL-GFEPFSQRKLSTLKDESSRAWTESSIN 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183VRZ9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS3255 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 6.483e-61
Identity = 142/359 (39.55%), Postives = 208/359 (57.94%), Query Frame = 1
Query:   49 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKH-RVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYML-EEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERV------------NGT----------CRRKTHP------NSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKY-REFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTIL 1032
            +S+ CP +     +   F+ Y FSW     ++ GI  S +C +V++KH RVF   T+ WFI L+ SDF +L+I A D+Y   +   EY++        F C +R   I    W +N+LQ GLSIER  SV++P+++RIIFT   T+F IS+LI F F+S  +I +++ +              NGT          C R+         N +ID+T  +Y +DLILFR IPF+ MLISS +I  L++    KR+R+         +  +  Y RE + S++L++MNV TL+TNPLFL+FEL+DG GSEG+   K+T ++CVS      FNSLIYF NQ NWIFY+  GA+F+ + + +L
Sbjct:    2 LSEICPLNHSSRYVVDGFIWYFFSWYMITANVVGIIFSGLCFLVLLKHPRVFASTTRAWFITLTASDFFILLIAANDMYAEVIFTHEYHVILGKIFGRFTCLIRVITILCLLWTSNLLQTGLSIERLASVISPLKTRIIFTGRATRFTISLLITFSFLSGILITIVSSKPTSSNIFINLNNTENGTYSINYEAMVSCERRNSSELFGSTNENIDLTKLVYNVDLILFRVIPFITMLISSAVIASLVRRQRRKRNRLVRVSTVVQKRNRTIGYNRESRASLLLLTMNVTTLLTNPLFLLFELLDGEGSEGRAAAKITGDQCVSWTLRQFFNSLIYFGNQNNWIFYLAFGARFRVHIMNML 360          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4Z2DR66 (Rhodopsin-like orphan GPCR OS=Schistosoma japonicum OX=6182 GN=EWB00_009999 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.869e-59
Identity = 139/366 (37.98%), Postives = 204/366 (55.74%), Query Frame = 1
Query:   49 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKH-RVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFG---CELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERVN---------------------------GTCRRKTHP------NSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKY-REFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTIL 1032
            +S+ CP +    ++   F+ Y FSW     ++ GI  S +C +V++KH RVF   T+ WFI L+ +DF +L+I A D+Y   +    Y   L   NIFG   C +R   I    W +N+LQ GLSIER  SV++P+++RIIFT   T+  IS+LI F  +S  +I +++ +  +                            +C R+         N SID+T  +Y +DLILFR IPF+ MLISS +I  L++    KR+R+         +  S  Y RE + S++L++MN+ TL+TNPLFL+FEL DG GSEG+   KLT + C+S      FNSLIYF NQ NWI Y+  GA+F+ + + +L
Sbjct:    2 LSEFCPLNHTSRHVADGFIWYFFSWYMITANIIGIIFSGLCFMVLLKHPRVFASTTRAWFITLTANDFFILLIAANDMYAEVIFTHSYHVILG--NIFGRCTCLIRVITIVCLLWTSNLLQTGLSIERLASVISPLKTRIIFTGRATRITISLLITFSCLSGILITIMSSKPTSLNIFIMSNDTTFNTTNNITYSIDYEALVSCERRNSTELFGGTNESIDLTKLVYNVDLILFRVIPFITMLISSAVIASLVRHQRRKRNRLTRISSVIQKRNRSIGYNRENRASLLLLTMNIITLLTNPLFLLFELFDGEGSEGRTAAKLTGDLCISWTLRQFFNSLIYFGNQNNWILYLAFGARFRIHIINML 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A094ZIN4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma haematobium OX=6185 GN=MS3_02621 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 3.711e-58
Identity = 142/360 (39.44%), Postives = 206/360 (57.22%), Query Frame = 1
Query:   49 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKH-RVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFG---CELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVS------------SSVIDMLTFERVNG---------TCRRKT------HPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKY-REFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTIL 1032
            +S+ CP +     +   F+ Y FSW   + ++ GI  S +C +V++KH RVF   T+ WFI L+ SDF +L+I A D+Y   +    Y   L   NIFG   C +R   I    W +N+LQ GLSIER  SV++P+++RIIFT   T++ IS+LI F  +S            SS I M+T   +           +C R+       + + SID+T  +Y +DLI+FR IPF+ MLISS +I  L++    KR+R+         +  S  Y RE + S++L++MN+ TL+TNPLFL+FEL DG GSEG+   KLT + C+S      FNSLIYF NQ NWI Y+  GA+F+ + + +L
Sbjct:    2 LSEFCPFNHTSRYVADGFIWYFFSWYMIIANIIGIIFSGLCFLVLLKHPRVFASTTRAWFITLTASDFFILLIAANDMYAEVIFTHMYHIILG--NIFGRYTCLIRVITIVCLLWTSNLLQTGLSIERLASVISPLKTRIIFTGKVTRYTISLLITFSCLSGILITIVSSKPSSSNIFMITNNNITNYSIDYEALVSCERRNSTELFGNTHESIDLTKLVYNLDLIVFRVIPFITMLISSAVIASLVRYQRRKRNRLTRISSIIQKRNRSIGYNRESRASLLLLTMNIITLLTNPLFLLFELFDGEGSEGRTAAKLTGDLCISWILRQFFNSLIYFGNQNNWILYLAFGARFRIHIINML 359          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183JQ30 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS4816 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 3.711e-58
Identity = 142/360 (39.44%), Postives = 206/360 (57.22%), Query Frame = 1
Query:   49 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKH-RVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFG---CELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVS------------SSVIDMLTFERVNG---------TCRRKT------HPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKY-REFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTIL 1032
            +S+ CP +     +   F+ Y FSW   + ++ GI  S +C +V++KH RVF   T+ WFI L+ SDF +L+I A D+Y   +    Y   L   NIFG   C +R   I    W +N+LQ GLSIER  SV++P+++RIIFT   T++ IS+LI F  +S            SS I M+T   +           +C R+       + + SID+T  +Y +DLI+FR IPF+ MLISS +I  L++    KR+R+         +  S  Y RE + S++L++MN+ TL+TNPLFL+FEL DG GSEG+   KLT + C+S      FNSLIYF NQ NWI Y+  GA+F+ + + +L
Sbjct:    2 LSEFCPFNHTSRYVADGFIWYFFSWYMIIANIIGIIFSGLCFLVLLKHPRVFASTTRAWFITLTASDFFILLIAANDMYAEVIFTHMYHIILG--NIFGRYTCLIRVITIVCLLWTSNLLQTGLSIERLASVISPLKTRIIFTGKVTRYTISLLITFSCLSGILITIVSSKPSSSNIFMITNNNITNYSIDYEALVSCERRNSTELFGNTHESIDLTKLVYNLDLIVFRVIPFITMLISSAVIASLVRYQRRKRNRLTRISSIIQKRNRSIGYNRESRASLLLLTMNIITLLTNPLFLLFELFDGEGSEGRTAAKLTGDLCISWILRQFFNSLIYFGNQNNWILYLAFGARFRIHIINML 359          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A430QH60 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0001707 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 8.366e-58
Identity = 142/360 (39.44%), Postives = 206/360 (57.22%), Query Frame = 1
Query:   49 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKH-RVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFG---CELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVS------------SSVIDMLTFERVNG---------TCRRKT------HPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKY-REFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTIL 1032
            +S+ CP +     +   F+ Y FSW   + ++ GI  S +C +V++KH RVF   T+ WFI L+ SDF +L+I A D+Y   +    Y   L   NIFG   C +R   I    W +N+LQ GLSIER  SV++P+++RIIFT   T++ IS+LI F  +S            SS I M+T   +           +C R+       + + SID+T  +Y +DLI+FR IPF+ MLISS +I  L++    KR+R+         +  S  Y RE + S++L++MN+ TL+TNPLFL+FEL DG GSEG+   KLT + C+S      FNSLIYF NQ NWI Y+  GA+F+ + + +L
Sbjct:    2 LSEFCPFNHTSRYVADGFIWYFFSWYMIIANIIGIIFSGLCFLVLLKHPRVFASTTRAWFITLTASDFFILLIAANDMYAEVIFTHMYHIILG--NIFGRYTCLIRVITIVCLLWTSNLLQTGLSIERLASVISPLKTRIIFTGKVTRYTISLLITFSCLSGILITIVSSKPSSSNIFMITNNNLTNYSIDYEALVSCERRNSTELFGNTHESIDLTKLVYNLDLIVFRVIPFITMLISSAVIASLVRYQRRKRNRLTRISSIIQKRNRSIGYNRESRASLLLLTMNIITLLTNPLFLLFELFDGEGSEGRTAAKLTGDLCISWILRQFFNSLIYFGNQNNWILYLAFGARFRIHIINML 359          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ghsrb (growth hormone secretagogue receptor [Source:NCBI gene;Acc:103029199])

HSP 1 Score: 55.0694 bits (131), Expect = 5.993e-8
Identity = 40/146 (27.40%), Postives = 74/146 (50.68%), Query Frame = 1
Query:  130 ALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLT-FERVNGT 564
            +LL L GI G+L+ I+V+ K++     T  +   +++SD L+ +    DLY  +    +       +    C+L  F     +++A +    LS+ER  ++  P+R++++ T GR K +I++L      S+  I +L   E  NGT
Sbjct:   42 SLLFLVGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIFLCMPLDLYRVWRYRPW------NLGDELCKLFQFVSECCTYSAILSITALSVERYFAICFPLRAKVLVTRGRVKGVIALLWTVALCSAGPIFVLVGVEHENGT 181          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043707.1 (growth hormone secretagogue receptor type 1-like [Source:NCBI gene;Acc:103034504])

HSP 1 Score: 51.6026 bits (122), Expect = 7.211e-7
Identity = 42/157 (26.75%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  175 IVIVKHRVFIHGTKYWFIY-LSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSS-VIDMLTFERVNG---TCRRKTHPNSSIDVTHSIYTIDL 630
            I++V  R  +  T Y ++  +++SD LML +   DLY  +    + +          C+L  F     ++++ +    L  ER ++V  P+R+R++ T GR + +I  L G   +SS+ V+ ++  ERV G    CR      SS  +T  ++  +L
Sbjct:   54 ILVVWLRPQMRSTTYLYLSSMAVSDILMLALMPLDLYKLWWYRPWLLGDAV------CKLSQFVSECCTFSSILHMTALGAERYLAVCFPLRARLLVTRGRVRALIGGLWGVAVLSSAPVMALVGVERVGGGDAECRSTQFAQSSGLMTAMLWLYNL 204          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: nmur1a (neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE-081104-220])

HSP 1 Score: 50.8322 bits (120), Expect = 3.206e-7
Identity = 38/127 (29.92%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  127 FALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWN--ANVLQ-AGLSIERTISVLNPIRSRIIFTTGRTKFIISVL 498
            + L+ + G+ G+ +  IVI +HR+    T ++   L++SD L+L++    L  Y M E Y        ++FG    YF    F     A+VL    LS+ER I+V++P+++R + T    + +I+ L
Sbjct:   60 YLLIFVTGVVGNFLTCIVISRHRLMRTPTNFYLFSLAVSDLLVLVL-GMPLELYEMWENY-------PSLFGEGGCYFKTMLFETVCFASVLNVTALSVERYIAVVHPLKARWLVTRTHARRVIACL 178          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000026034.1 (SMESG000026034.1)

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 416/418 (99.52%), Postives = 417/418 (99.76%), Query Frame = 1
Query:   49 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDIDESASLPFESTMNIEKNLQRNSELNLKNKIQNSNCQRKYSCLCWXXXXXXXXXXXDDYVETLTNNQKETEVIALIHTTL 1302
            MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRM+IFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFLVMLISSIIIVILMKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFL ILSNFLPFLKRDIDESASLPFESTMNIEKNLQRNSELNLKNKIQNSNCQRKYSCLCWKINNRNIKNKIDDYVETLTNNQKETEVIALIHTTL
Sbjct:    1 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMSIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFLVMLISSIIIVILMKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLMILSNFLPFLKRDIDESASLPFESTMNIEKNLQRNSELNLKNKIQNSNCQRKYSCLCWKINNRNIKNKIDDYVETLTNNQKETEVIALIHTTL 418          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000066767.1 (SMESG000066767.1)

HSP 1 Score: 243.817 bits (621), Expect = 1.505e-76
Identity = 149/363 (41.05%), Postives = 223/363 (61.43%), Query Frame = 1
Query:   58 ECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERV---NGT-CRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDIDESASLPFESTMNIEKNLQRNSE 1134
             C +  +   L+ +F +Y  SW F +L++AG+ G+++C+ V++K+ VF   TK WF  L ++D L+L++PA DLYF+ +L E Y   + R  +FGCE+RY  I   SW AN+LQ+ LSIER+ SVL P+++R++FT  +TK +I +++ F  VS  + + LTF+R+   N T C R        +++H IY IDL +FR IPF++M  SS II+I ++    KR+      +   N K++ K +EFKM V+LISMNV TL+TNPLF +FE IDG G+E   YG  T + C+S    L+FN  IY NNQ+NWIFY+  G KF+ Y L +L     F  +   ES      + +N+   L   ++
Sbjct:    7 SCRTFSENRTLQEIFSQYILSWLFLILTIAGLCGNVLCLSVVLKYPVFSKNTKSWFCSLLIADILILLLPAMDLYFHVLLPELYPSLIARSGVFGCEIRYALIQSLSWLANLLQSSLSIERSYSVLRPMKARMLFTKTKTKSMILIIVMFSLVSGVLTNGLTFQRIPQGNSTICDRVRIER--FNISHIIYNIDLFIFRVIPFIIMFTSSWIIIIELRCCKQKRN---ESNIRIRNSKATSK-KEFKMFVLLISMNVLTLLTNPLFALFETIDGVGTENYPYGLWTGDICMSKLLRLIFNCFIYLNNQSNWIFYIATGGKFRRYSLNVLRVIFRFHSKGNHESLRYSKNNQLNLTYGLSLTNQ 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000066767.1 (SMESG000066767.1)

HSP 1 Score: 243.432 bits (620), Expect = 3.059e-76
Identity = 149/363 (41.05%), Postives = 223/363 (61.43%), Query Frame = 1
Query:   58 ECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERV---NGT-CRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDIDESASLPFESTMNIEKNLQRNSE 1134
             C +  +   L+ +F +Y  SW F +L++AG+ G+++C+ V++K+ VF   TK WF  L ++D L+L++PA DLYF+ +L E Y   + R  +FGCE+RY  I   SW AN+LQ+ LSIER+ SVL P+++R++FT  +TK +I +++ F  VS  + + LTF+R+   N T C R        +++H IY IDL +FR IPF++M  SS II+I ++    KR+      +   N K++ K +EFKM V+LISMNV TL+TNPLF +FE IDG G+E   YG  T + C+S    L+FN  IY NNQ+NWIFY+  G KF+ Y L +L     F  +   ES      + +N+   L   ++
Sbjct:   17 SCRTFSENRTLQEIFSQYILSWLFLILTIAGLCGNVLCLSVVLKYPVFSKNTKSWFCSLLIADILILLLPAMDLYFHVLLPELYPSLIARSGVFGCEIRYALIQSLSWLANLLQSSLSIERSYSVLRPMKARMLFTKTKTKSMILIIVMFSLVSGVLTNGLTFQRIPQGNSTICDRVRI--ERFNISHIIYNIDLFIFRVIPFIIMFTSSWIIIIELRCCKQKRN---ESNIRIRNSKATSK-KEFKMFVLLISMNVLTLLTNPLFALFETIDGVGTENYPYGLWTGDICMSKLLRLIFNCFIYLNNQSNWIFYIATGGKFRRYSLNVLRVIFRFHSKGNHESLRYSKNNQLNLTYGLSLTNQ 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000055874.1 (SMESG000055874.1)

HSP 1 Score: 231.876 bits (590), Expect = 4.892e-72
Identity = 132/338 (39.05%), Postives = 202/338 (59.76%), Query Frame = 1
Query:   49 MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIG---FCFVSSSVIDMLTFERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKL---HSIKRDRIGHHQMGNPNKKSSQ-KYREFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNF 1041
            M   CPS+  Y     L   Y FSW   L++L  +FG  +C+ VI+K++VF   T+ WF+ L+ SD   ++I   D Y       +++ T+  +  FGC++R+ AI   SW  N+LQ+G SIER+IS++ P+++R+  T  R+K +I +L      C  S + + M  F+     C RK +  + I +T  +Y  DLI+FR IP L+M+I S II I MK     S+K  +I        N K S    RE ++ V+L+ MN   L+TNPLFLIFELIDG GSE +++GKL+ ++C+S+    +FN L+Y NN TNWIFY++IG +F+ + + I+S++
Sbjct:    1 MLSNCPSNSSYFITFQLIKTYFFSWFLLLVNLVSLFGCCLCLGVILKYKVFTKSTRIWFLALAASDISTILIATSDNYLALTFSNFHLSTMKYLGFFGCQIRFGAIVAISWTCNILQSGFSIERSISIIKPLQARVFLTEMRSKLVIIILTSVTLICGFSVTAVSM-KFDTKTSECLRKEYLGNVISITKIVYYTDLIVFRTIPLLIMIIGSFIIAISMKFRTKRSVKYLQINRRTSAESNGKDSNISGRESQVFVLLLIMNFMALLTNPLFLIFELIDGEGSENKEFGKLSGDKCLSNILTTVFNCLMYTNNFTNWIFYIVIGTRFKRFTVAIISHW 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000009916.1 (SMESG000009916.1)

HSP 1 Score: 211.46 bits (537), Expect = 4.871e-64
Identity = 131/322 (40.68%), Postives = 193/322 (59.94%), Query Frame = 1
Query:  100 FVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRVFIHGTKYWFIYLSMSDFLMLIIPACDLYFYYML-EEYYIKTLNRMNIFGCELRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVLIGFCFVSSSVIDMLTFERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAIPFXXXXXXXXXXXXXXKLHSIKRDRIGHHQMGNPNKKSSQKYR-EFKMSVILISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNSLIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKR 1059
            F  Y  SW    ++L+ IFGS +CI VIVK+ VF   TKYWF+ L +SD +++ + A D YF  +  E+Y +  L+    FGC+ RY  +   SW  N LQ GLS+ERTI +++PI++R+ FT  R++ II  L+    +S  +I++ T E V  T +  +      D T  +Y IDLILFRA+P+ V+ I+++I++I +K     R    H     P  K+      E +M ++LI MNV TL TNPLFL+FELIDG  +E   +GKLT ++C+S      FN L+Y NN TNWIFY+ +G+KF+ +    +  + PF K+
Sbjct:   18 FQYYILSWFLITINLSAIFGSGLCICVIVKYNVFSVNTKYWFLALIISDIVIIFVAANDFYFTLIFNEQYKLFLLHFSAFFGCQFRYGLVVAVSWVCNALQTGLSLERTIHIISPIKARVFFTVKRSRIIIIFLVIISGMSGLIINICTLE-VKPTSKNVSSCVRKPDQTKFVYFIDLILFRALPYGVITITTVILIIFIKRRQNCRKFTLHRSSRTPGGKNELNLNPERRMFILLIVMNVITLTTNPLFLLFELIDGEATENMVFGKLTGDKCLSTILTSFFNELMYMNNLTNWIFYINVGSKFRSHLKMFI--YSPFTKK 336          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GHSR3.543e-822.39growth hormone secretagogue receptor [Source:HGNC ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nmur-23.291e-629.13NMUR (NeuroMedin U Receptor) homolog [Source:UniP... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ghsrb2.479e-723.15growth hormone secretagogue receptor b [Source:ZFI... [more]
ghsra4.011e-722.71growth hormone secretagogue receptor a [Source:ZFI... [more]
ghsra9.673e-627.12growth hormone secretagogue receptor a [Source:ZFI... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GHSR1.798e-925.00growth hormone secretagogue receptor [Source:NCBI ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ghsr1.657e-626.00growth hormone secretagogue receptor [Source:MGI S... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q95254|GHSR_PIG4.693e-922.56Growth hormone secretagogue receptor type 1 OS=Sus... [more]
sp|A5A4L1|GHSR_MUSPF4.971e-821.95Growth hormone secretagogue receptor type 1 OS=Mus... [more]
sp|A5A4K9|GHSR_RABIT1.613e-721.65Growth hormone secretagogue receptor type 1 OS=Ory... [more]
sp|Q92847|GHSR_HUMAN1.701e-722.39Growth hormone secretagogue receptor type 1 OS=Hom... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183VRZ96.483e-6139.55G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A4Z2DR662.869e-5937.98Rhodopsin-like orphan GPCR OS=Schistosoma japonicu... [more]
A0A094ZIN43.711e-5839.44G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183JQ303.711e-5839.44G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A430QH608.366e-5839.44G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ghsrb5.993e-827.40growth hormone secretagogue receptor [Source:NCBI ... [more]
ENSAMXT00000043707.17.211e-726.75growth hormone secretagogue receptor type 1-like [... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nmur1a3.206e-729.92neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026034.10.000e+099.52SMESG000026034.1[more]
SMESG000066767.11.505e-7641.05SMESG000066767.1[more]
SMESG000066767.13.059e-7641.05SMESG000066767.1[more]
SMESG000055874.14.892e-7239.05SMESG000055874.1[more]
SMESG000009916.14.871e-6440.68SMESG000009916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025577 ID=SMED30025577|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1368bp
TCTGAATATTTGAAAGGACTAAATCAAGTTAGTTAATTATCAGCACCAAT
GTCGAAAGAATGCCCCAGTCATATGAAATATTCTAATTTACGCCCCTTGT
TTGTTAAATATTGTTTTTCTTGGAGCTTTGCATTGCTGAGTTTGGCGGGC
ATTTTTGGAAGTCTAATGTGCATCATCGTCATTGTGAAGCATCGAGTTTT
CATTCATGGAACGAAATATTGGTTCATTTATTTGTCTATGAGTGATTTTC
TTATGCTGATTATTCCGGCCTGTGATTTATACTTTTACTATATGTTAGAG
GAGTACTATATTAAGACGTTGAATAGGATGAATATTTTCGGTTGTGAGTT
GCGCTACTTTGCCATTAATTTCTTTAGTTGGAATGCAAACGTTTTGCAGG
CTGGCTTATCAATTGAAAGAACTATCAGTGTTTTGAATCCGATTCGCTCA
AGAATTATCTTTACGACAGGTCGAACTAAATTTATTATCAGTGTCCTAAT
TGGGTTCTGTTTTGTATCTTCTTCGGTTATCGATATGCTAACATTTGAAA
GAGTGAATGGAACTTGTAGGCGGAAGACCCATCCAAATTCATCAATTGAC
GTGACACATTCTATATACACCATTGATTTGATATTGTTTCGAGCGATACC
TTTTCTAGTGATGCTAATTTCTTCCATAATTATCGTAATCCTCATGAAAT
TGCACAGCATCAAACGAGATCGAATCGGGCACCATCAAATGGGAAATCCT
AACAAAAAATCCTCCCAGAAATATCGAGAATTCAAAATGTCGGTTATCTT
GATATCAATGAATGTGGCAACCTTAGTAACGAATCCGTTGTTTTTGATTT
TCGAATTGATAGATGGAGCGGGCTCGGAGGGTCAGAAATACGGAAAGTTA
ACGAAAAATCGCTGCGTTTCAGATTTCTTCAATTTGCTCTTTAATTCACT
GATCTATTTTAACAATCAAACAAACTGGATATTTTACGTCTTAATTGGGG
CGAAATTTCAGCACTATTTTCTCACGATCCTCTCCAATTTTCTCCCGTTC
CTCAAACGAGACATTGACGAATCAGCGAGTTTACCTTTCGAGTCGACGAT
GAACATTGAAAAAAATCTTCAACGGAATTCTGAATTGAATCTTAAAAATA
AGATTCAAAATTCAAATTGTCAACGAAAATATTCGTGTTTATGTTGGAAA
ATAAACAACCGAAATATCAAAAACAAAATTGACGATTATGTTGAAACTTT
AACAAACAACCAAAAAGAAACAGAGGTTATTGCGTTGATCCATACGACTC
TTAGACAAGAGTTTGATCTCTGAATTGTGTACTATAGATAATAATTTCAT
TATTAAAAAAGATCGGAA
back to top

protein sequence of SMED30025577-orf-1

>SMED30025577-orf-1 ID=SMED30025577-orf-1|Name=SMED30025577-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=425bp
MSKECPSHMKYSNLRPLFVKYCFSWSFALLSLAGIFGSLMCIIVIVKHRV
FIHGTKYWFIYLSMSDFLMLIIPACDLYFYYMLEEYYIKTLNRMNIFGCE
LRYFAINFFSWNANVLQAGLSIERTISVLNPIRSRIIFTTGRTKFIISVL
IGFCFVSSSVIDMLTFERVNGTCRRKTHPNSSIDVTHSIYTIDLILFRAI
PFLVMLISSIIIVILMKLHSIKRDRIGHHQMGNPNKKSSQKYREFKMSVI
LISMNVATLVTNPLFLIFELIDGAGSEGQKYGKLTKNRCVSDFFNLLFNS
LIYFNNQTNWIFYVLIGAKFQHYFLTILSNFLPFLKRDIDESASLPFEST
MNIEKNLQRNSELNLKNKIQNSNCQRKYSCLCWKINNRNIKNKIDDYVET
LTNNQKETEVIALIHTTLRQEFDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0001616growth hormone secretagogue receptor activity
GO:0004871signal transducer activity
GO:0016520growth hormone-releasing hormone receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0008154actin polymerization or depolymerization
GO:0008343adult feeding behavior
GO:0009725response to hormone
GO:0009755hormone-mediated signaling pathway
GO:0030252growth hormone secretion
GO:0032094response to food
GO:0032100positive regulation of appetite
GO:0032691negative regulation of interleukin-1 beta production
GO:0032869cellular response to insulin stimulus
GO:0040018positive regulation of multicellular organism growth
GO:0042536negative regulation of tumor necrosis factor biosynthetic process
GO:0043568positive regulation of insulin-like growth factor receptor signaling pathway
GO:0045409negative regulation of interleukin-6 biosynthetic process
GO:0046697decidualization
GO:0050728negative regulation of inflammatory response
GO:0051963regulation of synapse assembly
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0043005neuron projection
GO:0045121membrane raft