Septin-7

Overview
NameSeptin-7
Smed IDSMED30025572
Length (bp)1920
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Septin-7 (SMED30025572) t-SNE clustered cells

Violin plots show distribution of expression levels for Septin-7 (SMED30025572) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Septin-7 (SMED30025572) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Septin-7 (SMED30025572) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025572

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30025572SMESG000064397.1 dd_Smed_v4_2641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025572SMESG000064397.1 dd_Smed_v4_2641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Septin-7 vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 435.261 bits (1118), Expect = 2.672e-147
Identity = 217/436 (49.77%), Postives = 301/436 (69.04%), Query Frame = 3
Query:  153 SMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            S  ++A  E SVN             Y           +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:    4 SARSAAAEERSVNSSTMGQQQKNLEGY-----------VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ 421          
BLAST of Septin-7 vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 432.95 bits (1112), Expect = 1.017e-146
Identity = 210/398 (52.76%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ 401          
BLAST of Septin-7 vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 402.905 bits (1034), Expect = 2.053e-135
Identity = 199/375 (53.07%), Postives = 273/375 (72.80%), Query Frame = 3
Query:  336 MVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            MVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:    1 MVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ 368          
BLAST of Septin-7 vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 400.208 bits (1027), Expect = 3.621e-134
Identity = 197/378 (52.12%), Postives = 272/378 (71.96%), Query Frame = 3
Query:  327 FNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
             N   +G SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   15 VNSSTMGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ 385          
BLAST of Septin-7 vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 305.834 bits (782), Expect = 8.879e-98
Identity = 156/360 (43.33%), Postives = 233/360 (64.72%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFY-NTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR---VLKMSK-IAEDSNFN--------------VSDGKDPMMQLEAEK--GEQENRIKKMEEEMKQLFEQKAE 1283
            +GF +L +QV++++ +KGF+F LMV G SGLGKST +NSL ++D Y + + LG  +RI +TV I    V ++E  V L+L +VDTPGFGDAV+N+ CW P+ EYID +F+++  +E+ +NR    D R+H C+YFI P GH L+PLDVEFMK +H++VNI+P++ K+DT+TP E    K+ +  ++    IKIY FP+     S  D D ++ D +  +E IPF+VIGSN  ++  G+++RGR YPWG VEVEN  H DFV L+ M++RTH+ DLKDVT +  YE YR   +  M++ + ++ N N              V  G DP    E EK   E++  +++M+E + ++ +Q  E
Sbjct:   26 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCD---SDEDEDFKLQD-QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDP----ETEKLIREKDEELRRMQEMLHKIQKQMKE 377          
BLAST of Septin-7 vs. Ensembl Celegans
Match: unc-59 (pep chromosome:WBcel235:I:13629227:13633494:1 gene:WBGene00006793.1 transcript:W09C5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-59)

HSP 1 Score: 303.908 bits (777), Expect = 2.096e-96
Identity = 153/372 (41.13%), Postives = 236/372 (63.44%), Query Frame = 3
Query:  270 GFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDF--YNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRL-IFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKEL 1376
            GF +  +QV++RA + GF+F LMVVG SGLGKSTFIN+L +++    N +   P+     TV +E   V L EN V L L LVDTPGFGDAV+NS CW+PI+ Y++++F E    E +++R     DK +H C+YFI+P+GH LKP+D+E MK +H +VNI+PVI K+D +T +E   FKK ++      +IK+Y FPE    Y+      + + ++K R+ +PF++IGSN+  +K+GKKIR R YPWG VEVEN +HNDF+ L+ MI+RT+L+D+ DVT    YE +R  +M  + ++        +DP   LE E+ ++E  + +    ++++F +K   R  +  E    LE+ ++  K +++ +  E+
Sbjct:   29 GFANFPNQVFRRAVKNGFDFTLMVVGRSGLGKSTFINTLFLAEINNLNEKESAPTHPHPSTVRVEEKLVKLVENSVSLNLTLVDTPGFGDAVNNSKCWEPIVNYVESKFFEQFCEETRIDRGEKIVDKCVHLCLYFIEPSGHGLKPIDIELMKHLHGRVNIVPVISKADCLTRDELLRFKKQIVKDAETAEIKLYKFPELEDPYT------DKVAIEKLRKALPFAIIGSNMLKEKDGKKIRYREYPWGTVEVENMQHNDFLTLRDMIIRTNLIDMIDVTRNVHYENFRFRQMEGLPKN-----EKNRDPFTHLEEERRQKEQDLDEKRNTLEKVFTEKTSARKKRSDERMSALEELEQQNKQKIDAKRAEI 389          
BLAST of Septin-7 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 228.794 bits (582), Expect = 7.977e-68
Identity = 139/393 (35.37%), Postives = 217/393 (55.22%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSL--LMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLI--FPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDK-NGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR--VLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEE 1424
            +GF SL  Q+ K+A   GF+FNLM VG +G GK+T I SL  +  DF       P     KTV +   T  + E  + +KL LV+T GFGD +D       I++Y++++F+ ++  E K  R++  F D RIHAC+YFI PTGH LK LD+  ++ + ++VN+IPVI KSDT   +E   FK  +L++L   KI IY FP      S ++        K+  + +PF+V+GS  F+ K NG+ +R R+YPWG VEVEN  H DFV L+  ++RT++ +++  T + LYE YR   L+  KI +        G   + +L  +  E ++   + E  +++ F++       KL  +E D+ K +E +  +     +    + +K D+E  Q  E
Sbjct:   80 VGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFE------PCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTN--------KEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQMKIGDGET-----GPKIIEKLAQKHREHQDEFSRRELTLREEFQK-------KLDVTEGDMRKVEEGLAAREREVHENYNREASKLDMEIRQLTE 446          
BLAST of Septin-7 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 228.409 bits (581), Expect = 1.531e-67
Identity = 141/393 (35.88%), Postives = 221/393 (56.23%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSL--LMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLI--FPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDK-NGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLE--AEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEE 1424
            +GF SL  Q+ K+A   GF+FNLM VG +G GK+T I SL  +  DF       P     KTV +   T  + E  + +KL LV+T GFGD +D       I++Y++++F+ ++  E K  R++  F D RIHAC+YFI PTGH LK LD+  ++ + ++VN+IPVI KSDT   +E   FK  +L++L   KI IY FP      S ++        K+  + +PF+V+GS  F+ K NG+ +R R+YPWG VEVEN  H DFV L+  ++RT++ +++  T + LYE YR  ++ ++       + DG+     +E  A++  Q++R  + E   ++L  +  EE   KL  +E D+ K +E +  +     +    + +K D+E  Q  E
Sbjct:   80 VGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFE------PCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTN--------KEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQM------KIGDGETGPKIIEKLAQRRLQKHREHQDEFSRRELTLR--EEFQKKLDVTEGDMRKVEEGLAAREREVHENYNREASKLDMEIRQLTE 450          
BLAST of Septin-7 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731136:14734237:-1 gene:WBGene00006795.1 transcript:Y50E8A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 229.565 bits (584), Expect = 2.301e-67
Identity = 139/393 (35.37%), Postives = 217/393 (55.22%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSL--LMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLI--FPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDK-NGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR--VLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEE 1424
            +GF SL  Q+ K+A   GF+FNLM VG +G GK+T I SL  +  DF       P     KTV +   T  + E  + +KL LV+T GFGD +D       I++Y++++F+ ++  E K  R++  F D RIHAC+YFI PTGH LK LD+  ++ + ++VN+IPVI KSDT   +E   FK  +L++L   KI IY FP      S ++        K+  + +PF+V+GS  F+ K NG+ +R R+YPWG VEVEN  H DFV L+  ++RT++ +++  T + LYE YR   L+  KI +        G   + +L  +  E ++   + E  +++ F++       KL  +E D+ K +E +  +     +    + +K D+E  Q  E
Sbjct:  149 VGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFE------PCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTN--------KEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQMKIGDGET-----GPKIIEKLAQKHREHQDEFSRRELTLREEFQK-------KLDVTEGDMRKVEEGLAAREREVHENYNREASKLDMEIRQLTE 515          
BLAST of Septin-7 vs. Ensembl Fly
Match: pnut (gene:FBgn0013726 transcript:FBtr0088792)

HSP 1 Score: 411.379 bits (1056), Expect = 7.317e-137
Identity = 203/398 (51.01%), Postives = 287/398 (72.11%), Query Frame = 3
Query:  243 KKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTE-YLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIA-EDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELH 1430
            K +++   +GF +L +QVY++A ++GFEF LMVVG SGLGKST INS+ +SD YN E Y GPS R KKTV +E T V+LKEN V L L +VDTPGFGDAVDNS CW PI+EY+D++++E++  E++V R    D R+H C+YFI P+GH L PLD+  M+ + +KVN++PVI K+DTMTP+E   FKK +LN++  HKIKIYDFP      +  D   E    +  R ++PF+V+G+N  I+++GKK+RGRRYPWG VEVEN  H DF+ L+ M++RTHL DLKDVT+   YE YR  K+S++   D    +S+ K+P+ Q+E EK E E ++KKME EM+Q+F+ K +E+  KL++SE++L +R E  K  LE Q +ELEE++ +F+ EK +WE+++
Sbjct:  115 KPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPA-----TLEDAAEEAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGKARLSN-KNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKALELQIRELEEKRREFEREKKEWEDVN 506          
BLAST of Septin-7 vs. Ensembl Fly
Match: pnut (gene:FBgn0013726 transcript:FBtr0088793)

HSP 1 Score: 411.379 bits (1056), Expect = 7.317e-137
Identity = 203/398 (51.01%), Postives = 287/398 (72.11%), Query Frame = 3
Query:  243 KKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTE-YLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIA-EDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELH 1430
            K +++   +GF +L +QVY++A ++GFEF LMVVG SGLGKST INS+ +SD YN E Y GPS R KKTV +E T V+LKEN V L L +VDTPGFGDAVDNS CW PI+EY+D++++E++  E++V R    D R+H C+YFI P+GH L PLD+  M+ + +KVN++PVI K+DTMTP+E   FKK +LN++  HKIKIYDFP      +  D   E    +  R ++PF+V+G+N  I+++GKK+RGRRYPWG VEVEN  H DF+ L+ M++RTHL DLKDVT+   YE YR  K+S++   D    +S+ K+P+ Q+E EK E E ++KKME EM+Q+F+ K +E+  KL++SE++L +R E  K  LE Q +ELEE++ +F+ EK +WE+++
Sbjct:  115 KPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPA-----TLEDAAEEAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGKARLSN-KNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKALELQIRELEEKRREFEREKKEWEDVN 506          
BLAST of Septin-7 vs. Ensembl Fly
Match: Sep1 (gene:FBgn0011710 transcript:FBtr0077198)

HSP 1 Score: 283.878 bits (725), Expect = 7.550e-90
Identity = 146/339 (43.07%), Postives = 225/339 (66.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPS-KRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMD-LKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEK--GEQENRIKKMEEEMKQLFE 1271
            +GF +L +QV++++ +KGFEF LMVVG SGLGKST +NSL ++D Y    +  + ++ K+TV +E +TV ++E  V L+L +VDTPGFGDA+DNS  +  I+EYID +++  + +E+ +NR    D RIH C YFI P GH LKPLDVEFMK++H KVNI+PVI K+D +T +E    K  ++ ++  H IKIY  P+       SD D +  + +K+ +E +PF+V G+N  ++  GKK+RGR YPWG VEVEN +H DF+ L+ M++ TH+ DL++VT +  YE YR  +++K  +     V   +D   Q+ +    GE++  +++ E E++++ E
Sbjct:   16 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRNIVDNRIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIKIYPLPDCD-----SDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDFIKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKAERDSSSQVVSNSVLGEKDRILQEKEAELRRMQE 348          
BLAST of Septin-7 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074371)

HSP 1 Score: 273.863 bits (699), Expect = 7.277e-86
Identity = 138/351 (39.32%), Postives = 223/351 (63.53%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFY-NTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDS----------NFNVSDGKDPMM----QLEAEKGEQENRIKKMEEEMKQLFEQ 1274
            IGF +L +QV++++ ++GFEF LMVVG SGLGKST INSL + D Y N +     +RI+KT  +E  T+ ++E  V L+L +VDTPGFGDA++    W    +YID +F ++  +E+ +NR    D R+H C+YF+ P GH+L+ +D++ ++R+H KVNI+ VIGK+D +  +E R  K+ +L  L  + I++Y FPE     S  D+D +  D ++ +  IPF+V+GSN  ++  GKK+RGR+YPWG V VE+ EH+DF+ L+  ++ TH+ DLKD T    YE +R   +S+I++ +          + + ++G D  +    +L  +K E+  R++ M  +M++  +Q
Sbjct:   14 IGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECD---SDEDDDFKQQD-RELKASIPFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAAISETDRLLLQKDEEIRRMQDMLTQMQEKLKQ 360          
BLAST of Septin-7 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074368)

HSP 1 Score: 273.478 bits (698), Expect = 4.754e-85
Identity = 138/351 (39.32%), Postives = 223/351 (63.53%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFY-NTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDS----------NFNVSDGKDPMM----QLEAEKGEQENRIKKMEEEMKQLFEQ 1274
            IGF +L +QV++++ ++GFEF LMVVG SGLGKST INSL + D Y N +     +RI+KT  +E  T+ ++E  V L+L +VDTPGFGDA++    W    +YID +F ++  +E+ +NR    D R+H C+YF+ P GH+L+ +D++ ++R+H KVNI+ VIGK+D +  +E R  K+ +L  L  + I++Y FPE     S  D+D +  D ++ +  IPF+V+GSN  ++  GKK+RGR+YPWG V VE+ EH+DF+ L+  ++ TH+ DLKD T    YE +R   +S+I++ +          + + ++G D  +    +L  +K E+  R++ M  +M++  +Q
Sbjct:   66 IGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECD---SDEDDDFKQQD-RELKASIPFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAAISETDRLLLQKDEEIRRMQDMLTQMQEKLKQ 412          
BLAST of Septin-7 vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 432.95 bits (1112), Expect = 1.304e-146
Identity = 208/398 (52.26%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ +Y GPS+RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I YID++F++ ++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+H+KVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FP+     +  D D ++  ++K +EK+P +V+GSN+ I+ NG+K+RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+  N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +LE+R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   21 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD-----TEDDEDSKL--IRKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFEDEKANWEAQQRILEQQ 411          
BLAST of Septin-7 vs. Ensembl Zebrafish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 432.95 bits (1112), Expect = 1.615e-146
Identity = 208/398 (52.26%), Postives = 294/398 (73.87%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y++EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ +   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ W+   R  E Q
Sbjct:   28 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPE-------TDDEEESKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKIQKLKDSEGELQRRHEQMKKNLEAQHKELEEKRRQFEEEKASWDAQQRILEQQ 418          
BLAST of Septin-7 vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 432.565 bits (1111), Expect = 1.707e-146
Identity = 208/398 (52.26%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ +Y GPS+RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I YID++F++ ++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+H+KVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FP+     +  D D ++  ++K +EK+P +V+GSN+ I+ NG+K+RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+  N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +LE+R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   20 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD-----TEDDEDSKL--IRKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFEDEKANWEAQQRILEQQ 410          
BLAST of Septin-7 vs. Ensembl Zebrafish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 432.18 bits (1110), Expect = 3.371e-146
Identity = 208/405 (51.36%), Postives = 295/405 (72.84%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFN--------VSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y++EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N          +G  P+ Q+E E+ +   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ W+   R  E Q
Sbjct:   29 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPE-------TDDEEESKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKPDTVEGMSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKIQKLKDSEGELQRRHEQMKKNLEAQHKELEEKRRQFEEEKASWDAQQRILEQQ 426          
BLAST of Septin-7 vs. Ensembl Zebrafish
Match: sept7b (septin 7b [Source:ZFIN;Acc:ZDB-GENE-030131-37])

HSP 1 Score: 384.8 bits (987), Expect = 1.272e-128
Identity = 197/375 (52.53%), Postives = 274/375 (73.07%), Query Frame = 3
Query:  336 MVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDS-NFNVSDG---KDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            MVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +K  ++++P +V+GSN  I+ NGKK+RGR+YPWG  EVEN +H DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +  +  + N + G   K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ E+S WE   R  E Q
Sbjct:    1 MVVGESGLGKSTLINSLFLTDLYSGEYPGPSNRIKKTVQVEQSKVLMKEGGVQLLLSIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREILEHKIKIYEFPE-------TDDEEENKIVKTIKDRLPLAVVGSNTIIEANGKKVRGRQYPWGVAEVENGDHCDFTLLRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTCNGIDNNKAKGQLTKSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEGELQRRHEQMKKNLEAQHKELEERRRQFEEERSTWETQQRILEQQ 368          
BLAST of Septin-7 vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 431.795 bits (1109), Expect = 3.834e-146
Identity = 212/405 (52.35%), Postives = 294/405 (72.59%), Query Frame = 3
Query:  246 KLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            K+ +L  +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y  +Y GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++ +P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK  WE   R  E Q
Sbjct:    6 KISLLSYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQRILEQQ 403          
BLAST of Septin-7 vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 430.254 bits (1105), Expect = 1.164e-145
Identity = 210/398 (52.76%), Postives = 290/398 (72.86%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y  +Y GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++ +P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK  WE   R  E Q
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQRILEQQ 401          
BLAST of Septin-7 vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 430.254 bits (1105), Expect = 1.399e-145
Identity = 207/405 (51.11%), Postives = 291/405 (71.85%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI-----------AEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y  +Y GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++ +P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +            + + ++  +G  P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK  WE   R  E Q
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKYDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQRILEQQ 408          
BLAST of Septin-7 vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 430.639 bits (1106), Expect = 1.543e-145
Identity = 216/422 (51.18%), Postives = 302/422 (71.56%), Query Frame = 3
Query:  195 LYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +Y++S+SS+       K L+    +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y  +Y GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++ +P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK  WE   R  E Q
Sbjct:    1 MYRSSESSQ------QKNLEGY--VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQRILEQQ 407          
BLAST of Septin-7 vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 430.639 bits (1106), Expect = 1.677e-145
Identity = 215/417 (51.56%), Postives = 297/417 (71.22%), Query Frame = 3
Query:  210 DSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            DS   +  S  K L+    +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y  +Y GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++ +P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK  WE   R  E Q
Sbjct:    6 DSITLTQRSQQKNLEGY--VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQRILEQQ 413          
BLAST of Septin-7 vs. Ensembl Mouse
Match: Sept7 (septin 7 [Source:MGI Symbol;Acc:MGI:1335094])

HSP 1 Score: 434.491 bits (1116), Expect = 4.180e-147
Identity = 217/436 (49.77%), Postives = 302/436 (69.27%), Query Frame = 3
Query:  153 SMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            S  ++A  E SVN     +       Y           +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:    4 SARSAAAEERSVNCGTMVAQPKNLEGY-----------VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQRILEQQ 421          
BLAST of Septin-7 vs. Ensembl Mouse
Match: Sept7 (septin 7 [Source:MGI Symbol;Acc:MGI:1335094])

HSP 1 Score: 433.721 bits (1114), Expect = 7.504e-147
Identity = 210/398 (52.76%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQRILEQQ 421          
BLAST of Septin-7 vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 301.212 bits (770), Expect = 4.478e-97
Identity = 141/289 (48.79%), Postives = 201/289 (69.55%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFY-NTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRV 1130
            +GF +L +QV++++ +KGF+F LMV G SGLGKST +NSL ++D Y + + LG  +RI +TV I    V ++E  V L+L +VDTPGFGDAV+N+ CW P+ EYID +F+++  +E+ +NR    D R+H C+YFI P GH L+PLDVEFMK +H++VNI+P++ K+DT+TP E    K  +  ++    IKIY FP+     S  D D ++ D +  +E IPF+VIGSN  ++  G+++RGR YPWG VEVEN  H DFV L+ M++RTH+ DLKDVT +  YE YR 
Sbjct:    7 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCD---SDEDEDFKLQD-QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRA 291          
BLAST of Septin-7 vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 303.523 bits (776), Expect = 4.508e-97
Identity = 156/360 (43.33%), Postives = 231/360 (64.17%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFY-NTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR---VLKMSK-IAEDSNFN--------------VSDGKDPMMQLEAEK--GEQENRIKKMEEEMKQLFEQKAE 1283
            +GF +L +QV++++ +KGF+F LMV G SGLGKST +NSL ++D Y + + LG  +RI +TV I    V ++E  V L+L +VDTPGFGDAV+N+ CW P+ EYID +F+++  +E+ +NR    D R+H C+YFI P GH L+PLDVEFMK +H++VNI+P++ K+DT+TP E    K  +  ++    IKIY FP+     S  D D ++ D +  +E IPF+VIGSN  ++  G+++RGR YPWG VEVEN  H DFV L+ M++RTH+ DLKDVT +  YE YR   +  M++ + ++ N N              V  G DP    E EK   E++  +++M+E + ++  Q  E
Sbjct:   26 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCD---SDEDEDFKLQD-QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDP----ETEKLIREKDEELRRMQEMLHKIQRQMKE 377          
BLAST of Septin-7 vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 304.294 bits (778), Expect = 3.391e-96
Identity = 156/360 (43.33%), Postives = 231/360 (64.17%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFY-NTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR---VLKMSK-IAEDSNFN--------------VSDGKDPMMQLEAEK--GEQENRIKKMEEEMKQLFEQKAE 1283
            +GF +L +QV++++ +KGF+F LMV G SGLGKST +NSL ++D Y + + LG  +RI +TV I    V ++E  V L+L +VDTPGFGDAV+N+ CW P+ EYID +F+++  +E+ +NR    D R+H C+YFI P GH L+PLDVEFMK +H++VNI+P++ K+DT+TP E    K  +  ++    IKIY FP+     S  D D ++ D +  +E IPF+VIGSN  ++  G+++RGR YPWG VEVEN  H DFV L+ M++RTH+ DLKDVT +  YE YR   +  M++ + ++ N N              V  G DP    E EK   E++  +++M+E + ++  Q  E
Sbjct:  106 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCD---SDEDEDFKLQD-QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDP----ETEKLIREKDEELRRMQEMLHKIQRQMKE 457          
BLAST of Septin-7 vs. UniProt/SwissProt
Match: sp|Q5R481|SEPT7_PONAB (Septin-7 OS=Pongo abelii OX=9601 GN=SEPTIN7 PE=2 SV=2)

HSP 1 Score: 436.032 bits (1120), Expect = 6.141e-147
Identity = 217/436 (49.77%), Postives = 302/436 (69.27%), Query Frame = 3
Query:  153 SMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            S  ++A  E SVN     +       Y           +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:    4 SARSAAAEERSVNSSTMVAQQKNLEGY-----------VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ 421          
BLAST of Septin-7 vs. UniProt/SwissProt
Match: sp|Q16181|SEPT7_HUMAN (Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 SV=2)

HSP 1 Score: 436.032 bits (1120), Expect = 6.141e-147
Identity = 217/436 (49.77%), Postives = 302/436 (69.27%), Query Frame = 3
Query:  153 SMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            S  ++A  E SVN     +       Y           +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:    4 SARSAAAEERSVNSSTMVAQQKNLEGY-----------VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ 421          
BLAST of Septin-7 vs. UniProt/SwissProt
Match: sp|Q6Q137|SEPT7_BOVIN (Septin-7 OS=Bos taurus OX=9913 GN=SEPTIN7 PE=2 SV=2)

HSP 1 Score: 436.032 bits (1120), Expect = 6.141e-147
Identity = 217/436 (49.77%), Postives = 302/436 (69.27%), Query Frame = 3
Query:  153 SMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            S  ++A  E SVN     +       Y           +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:    4 SARSAAAEERSVNSSTMVAQQKNLEGY-----------VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ 421          
BLAST of Septin-7 vs. UniProt/SwissProt
Match: sp|Q9WVC0|SEPT7_RAT (Septin-7 OS=Rattus norvegicus OX=10116 GN=Septin7 PE=1 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 1.755e-146
Identity = 210/398 (52.76%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   30 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQGHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQRILEQQ 420          
BLAST of Septin-7 vs. UniProt/SwissProt
Match: sp|O55131|SEPT7_MOUSE (Septin-7 OS=Mus musculus OX=10090 GN=Septin7 PE=1 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 3.435e-146
Identity = 210/398 (52.76%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I+YID++F+++++ E++VNR   PD R+  C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   30 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-------TDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQRILEQQ 420          
BLAST of Septin-7 vs. TrEMBL
Match: A0A0L8H234 (Septin-type G domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024079mg PE=3 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 1.552e-156
Identity = 221/386 (57.25%), Postives = 299/386 (77.46%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEE 1424
            +GF +L +QVY+++ ++GFEFNLMVVG SGLGKST INSL ++D Y++EY GPS RI+KTV ++ T V+LKEN V L+L +VDTPGFGDAVDNS CW P+I++ID +++E++++E++VNR I PD R+H C+YFI PTGH LKPLDVEFMKR+H+KVNIIP++ K+DT+TP+ECRDFKK +LN++  HKIKIY+FPE        D +   +  K  ++++PF+V+GSN  ID NGK++RGR+YPWG VEVEN EHNDF+ L+ M++RTH+ DLKDVT+   YE YR  K++ I  D     S GKDP+ Q++ EK E + ++KKME EM+Q+FE K +E+ TKLK+SE DL++R E MK  LE Q KEL+E+ A F+ EKS WEE
Sbjct:  190 VGFANLPNQVYRKSVKRGFEFNLMVVGESGLGKSTLINSLFLTDLYSSEYPGPSLRIQKTVKVDTTQVLLKENGVSLRLTVVDTPGFGDAVDNSNCWQPVIDFIDTKYEEYLNSESRVNRTIMPDNRVHCCLYFIAPTGHGLKPLDVEFMKRLHDKVNIIPLVAKADTLTPDECRDFKKTILNEIAQHKIKIYEFPE------CDDEEENKLQKKLLKDRVPFAVVGSNTVIDCNGKRMRGRQYPWGIVEVENLEHNDFIALRNMLIRTHMQDLKDVTNNVHYENYRYSKLAPITADGKVKASLGKDPLTQMQEEKREHDAKMKKMEAEMEQVFEMKVKEKKTKLKDSEADLQRRAEQMKKSLEQQQKELDEKWATFEKEKSTWEE 569          
BLAST of Septin-7 vs. TrEMBL
Match: K1PCA0 (Septin-7 OS=Crassostrea gigas OX=29159 GN=CGI_10003886 PE=3 SV=1)

HSP 1 Score: 471.855 bits (1213), Expect = 8.784e-156
Identity = 221/389 (56.81%), Postives = 294/389 (75.58%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDG---KDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEE 1424
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ +Y GPS RI+KTV +E T  +LKEN V L L  VDTPGFGDAVDNS CW P+I++ID+++DE+++ E++V R   PD R+HAC+YFI PTGH LKPLDVEFMKR+H+KVNIIP+I K+D++TP+ECR+FKK +LN++  HKIKIY+FPE        D++ E    KK R+++PF+V+GSN  I+  GKK+RGR+YPWG VEVEN EHNDF+ L+ MI+RTH+ DLKDVT+   YE +R  K++  + D N  +  G   KDP+ Q+  EK E +N++KKME EM+Q+FE K +E+  KLKESE DL++R EHMK  LE Q KELEE+   F+ EK QWEE
Sbjct:  185 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSADYQGPSHRIQKTVKVETTQCLLKENGVQLNLTTVDTPGFGDAVDNSNCWQPVIDFIDSKYDEYLNAESRVVRSPTPDTRVHACLYFIAPTGHGLKPLDVEFMKRLHDKVNIIPLISKADSLTPDECREFKKTILNEIAQHKIKIYEFPE-------CDDEEENKIQKKLRDRVPFAVVGSNRVIEAGGKKVRGRQYPWGLVEVENLEHNDFIALRNMIIRTHMQDLKDVTNNVHYENFRYNKLAPSSTDGN-KIKPGSLSKDPLTQMAEEKKEHDNKMKKMEAEMEQVFEMKVQEKQAKLKESEADLQRRAEHMKKSLEQQQKELEEKWKMFEKEKQQWEE 565          
BLAST of Septin-7 vs. TrEMBL
Match: A0A293LZM6 (Septin-7 (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 461.455 bits (1186), Expect = 2.911e-153
Identity = 207/392 (52.81%), Postives = 290/392 (73.98%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWE 1442
            +GF SL DQVY++A +KGFEF LMVVG SGLGKST INS+ ++D Y+ EY GPS R+KKTV +E T V+L+E  V L L +VDTPGFGDAVDN+ CW PII+Y++ ++ E++D E++V+R   PD RIH C+YFI P+GH LKPL++EFMKR+H+KVNIIPVI K+DTMTPEEC  FK+ +LN++  +KI++Y+FPE        D+D E   LK  RE++PF+V+GSN  ++ NGK++RGR+YPWG  EVEN EH DF+ L+ M++RTH+ DLKD+T+   YE +R  K++ +      +    K+P+ Q+E EK + + ++++ME+EM+Q+FE K  E+  KLKESE DL++R E MK  LE Q +ELEE++  FD EK+ +E  H+D +
Sbjct:   99 VGFASLPDQVYRKAVKKGFEFTLMVVGESGLGKSTLINSMFLTDIYSNEYPGPSHRVKKTVEVETTRVVLREGGVNLTLTIVDTPGFGDAVDNTQCWQPIIDYVEAKYAEYLDAESRVHRSAVPDNRIHCCLYFIMPSGHGLKPLNIEFMKRLHDKVNIIPVIAKADTMTPEECSLFKRTILNEIAQNKIRLYEFPE-------CDDDEENKHLKGLRERVPFAVVGSNTIVEVNGKRVRGRKYPWGVAEVENMEHCDFIALRNMLIRTHMQDLKDITNNVHYENFRCRKLAGVGGTDGGSARSNKNPLAQMEEEKKDHDAKMQRMEKEMEQVFEMKVREKMQKLKESEADLQRRHEQMKKSLEQQRQELEEKRRNFDKEKASFELTHKDLD 483          
BLAST of Septin-7 vs. TrEMBL
Match: A0A267EKJ5 (Septin-type G domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016777g1 PE=3 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 5.749e-153
Identity = 227/472 (48.09%), Postives = 324/472 (68.64%), Query Frame = 3
Query:   45 MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPES---------GAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGK----KIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWE 1421
            MS L  K D     ++     PL ++    +D+  +    S+ +    +K      SS  S   +    D    +GF +L +Q+Y+R  R+GFEFNLMVVG SGLGKST +NSL +S+ YN +++GPSKRIKKTVY+E  TV+LKEN V L+L L+DTPGFGDAVDNS CW+P+++YID RF++H++ E KVNR    D R+H  +YFI PTGH LKPLD+EFMKR+H+K N++P++ K+D MT EE RDFKK +LN+L  HKI++YDFPES         G + +ASD+  +   +K+ ++++PF+V+G+N  ++   K    K+RGR YPWG VEVEN EHNDF+ L+ +++RTH+ DL++ T+   YE YR LK+S IA++S F  +DGKDPM Q+E EK + E +++KME EM+ +FE K +E+  KLK+SE+DL++R + M+ QLE Q  EL E++ +F+ EK  WE
Sbjct:    1 MSALATKRDDF---YKDRSYDPLAKYGRDRSDLLSKLDSNSSSSSGIGSKALAGDKSSGLSSSDDKAASDA--GVGFANLPNQIYRRTVRRGFEFNLMVVGESGLGKSTLLNSLFLSELYNADHMGPSKRIKKTVYVESHTVLLKENSVHLRLTLIDTPGFGDAVDNSNCWNPVLDYIDARFEDHLNAEQKVNRGQLIDSRVHCVLYFIAPTGHGLKPLDIEFMKRLHDKANVVPILAKADCMTLEELRDFKKTILNELAQHKIRVYDFPESVLAAAAAASGDSNAASDSCDDEKSIKRLKDRLPFAVVGANCLVESASKGSSGKVRGRAYPWGSVEVENLEHNDFLALRNLMLRTHMQDLRETTNSLHYENYRYLKLSGIAQESKFRTTDGKDPMAQMETEKRDHELKMRKMESEMEGVFEMKVKEKKQKLKDSEVDLQRRADQMRKQLEQQEAELAERRRQFEAEKRAWE 467          
BLAST of Septin-7 vs. TrEMBL
Match: A0A267FR10 (Septin-type G domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003072g4 PE=3 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 6.912e-153
Identity = 227/472 (48.09%), Postives = 324/472 (68.64%), Query Frame = 3
Query:   45 MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPES---------GAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGK----KIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWE 1421
            MS L  K D     ++     PL ++    +D+  +    S+ +    +K      SS  S   +    D    +GF +L +Q+Y+R  R+GFEFNLMVVG SGLGKST +NSL +S+ YN +++GPSKRIKKTVY+E  TV+LKEN V L+L L+DTPGFGDAVDNS CW+P+++YID RF++H++ E KVNR    D R+H  +YFI PTGH LKPLD+EFMKR+H+K N++P++ K+D MT EE RDFKK +LN+L  HKI++YDFPES         G + +ASD+  +   +K+ ++++PF+V+G+N  ++   K    K+RGR YPWG VEVEN EHNDF+ L+ +++RTH+ DL++ T+   YE YR LK+S IA++S F  +DGKDPM Q+E EK + E +++KME EM+ +FE K +E+  KLK+SE+DL++R + M+ QLE Q  EL E++ +F+ EK  WE
Sbjct:    1 MSALATKRDDF---YKDRSYDPLAKYGRDRSDLLSKLDSNSSSSSGIGSKALAGDKSSGLSSSDDKAASDA--GVGFANLPNQIYRRTVRRGFEFNLMVVGESGLGKSTLLNSLFLSELYNADHMGPSKRIKKTVYVESHTVLLKENSVHLRLTLIDTPGFGDAVDNSNCWNPVLDYIDARFEDHLNAEQKVNRGQLIDSRVHCVLYFIAPTGHGLKPLDIEFMKRLHDKANVVPILAKADCMTLEELRDFKKTILNELAQHKIRVYDFPESVLAAAAAASGDSNAASDSCDDEKSIKRLKDRLPFAVVGANCLVESASKGSSGKVRGRAYPWGSVEVENLEHNDFLALRNLMLRTHMQDLRETTNSLHYENYRYLKLSGIAQESKFRTTDGKDPMAQMETEKRDHELKMRKMESEMEGVFEMKVKEKKQKLKDSEVDLQRRADQMRKQLEQQETELAERRRQFEAEKRAWE 467          
BLAST of Septin-7 vs. Ensembl Cavefish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 431.409 bits (1108), Expect = 2.346e-146
Identity = 209/398 (52.51%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFNVSD-GKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DTMTPEEC+ FKK ++ ++  HKIK Y+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N     K P+ Q+E E+ +   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLVKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTMTPEECQQFKKQIMREIQEHKIKTYEFPE-------TDDEEENKIVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGADNNKNKGQLTKSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKLQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKNNWEVQQRLVEQQ 401          
BLAST of Septin-7 vs. Ensembl Cavefish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 430.639 bits (1106), Expect = 5.642e-146
Identity = 209/405 (51.60%), Postives = 293/405 (72.35%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI---AEDSNFN--------VSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+HEKVNIIP+I K+DTMTPEEC+ FKK ++ ++  HKIK Y+FPE       +D++ E   +KK ++++P +V+GSN  I+ NGK++RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     D+N N          +G  P+ Q+E E+ +   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLVKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTMTPEECQQFKKQIMREIQEHKIKTYEFPE-------TDDEEENKIVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGADNNKNKGQLTKVDTVEGMSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKLQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKNNWEVQQRLVEQQ 408          
BLAST of Septin-7 vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 410.994 bits (1055), Expect = 8.248e-138
Identity = 205/398 (51.51%), Postives = 293/398 (73.62%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDS-NFNVSDG---KDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ +Y GPS+RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I YID++ ++ ++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+H+KVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FP+     +  D D ++  ++K +E++P +V+GSN+ ++ NG+K+RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +  +  + + S G   K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +LE+R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   47 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD-----TEEDEDSKL--IRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWEMQQRILEQQ 437          
BLAST of Septin-7 vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 406.757 bits (1044), Expect = 2.125e-136
Identity = 205/402 (51.00%), Postives = 293/402 (72.89%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVE----VENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDS-NFNVSDG---KDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ +Y GPS+RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I YID++ ++ ++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+H+KVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FP+     +  D D ++  ++K +E++P +V+GSN+ ++ NG+K+RGR+YPWG  E    VEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +  +  + + S G   K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +LE+R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   20 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD-----TEEDEDSKL--IRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWEMQQRILEQQ 414          
BLAST of Septin-7 vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 405.216 bits (1040), Expect = 1.723e-135
Identity = 205/402 (51.00%), Postives = 293/402 (72.89%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVE----VENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDS-NFNVSDG---KDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ +Y GPS+RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I YID++ ++ ++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+H+KVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FP+     +  D D ++  ++K +E++P +V+GSN+ ++ NG+K+RGR+YPWG  E    VEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +  +  + + S G   K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +LE+R E MK  LE Q KELEE++ +F+ EK+ WE   R  E Q
Sbjct:   47 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD-----TEEDEDSKL--IRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWEMQQRILEQQ 441          
BLAST of Septin-7 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 360.918 bits (925), Expect = 3.642e-119
Identity = 184/398 (46.23%), Postives = 282/398 (70.85%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSK----IAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +Q+Y++A ++GFEF LMVVG SG+GKST INS+  +D Y+ E+ GP+KRI+KTV +E + V+++E  V L L +VDTPG+GD ++NS C  P+I++ID++F+++++ E++VNR   PD R+HAC+YFI P+GH LK LD+EFMKR+H KVNIIP++ K+D   P EC  FKK ++  +  + IKIY F ++   +   DN      L K +E++P +VIGSN+ +D  G+++ GR YPWG  EV+N EH DF  L+ M++RTH+ DLKDVT+   YE +R  K++     +AE+S   ++  K P+ Q+E EK + ++++KKME EM+Q+F+ K +E+  KLK+SE +L++R E MK  LE+Q +ELEE++ +F+ E+  WE   R+ + Q
Sbjct:   34 VGFANLPNQIYRKAAKRGFEFTLMVVGESGVGKSTLINSMFKTDLYSEEFPGPTKRIQKTVKVEQSKVVIREEGVHLTLTIVDTPGYGDFINNSECVQPVIDHIDSQFEDYLNAESRVNRRPMPDSRVHACLYFIAPSGHGLKALDIEFMKRLHNKVNIIPLVAKADAFLPTECCAFKKQIMKDIHDNNIKIYQFTDT---HDEEDNKL----LNKIKERLPLAVIGSNVVVDVGGRRVWGRHYPWGVAEVDNVEHCDFTTLRRMLIRTHMQDLKDVTNNVHYENFRSCKLAALTGNVAENSKRQLT--KSPLAQMEEEKKDHKSKMKKMETEMEQVFDMKVKEKKQKLKDSEAELQRRSEQMKRSLESQLRELEERRKQFEEERLAWESQQRELDQQ 422          
BLAST of Septin-7 vs. Ensembl Sea Lamprey
Match: zgc:162239 (zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28])

HSP 1 Score: 285.034 bits (728), Expect = 1.321e-90
Identity = 137/291 (47.08%), Postives = 194/291 (66.67%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPS--KRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDL-KKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRV 1130
            +GF +L +QV++++ +KGFEF LMV G SGLGKST INSL ++D Y+   L P+  KR   T  +  T  I +E  V L+L LVDTPGF DA+DN+ CW P++EY++ +F+ +   E+ ++R    D R+H C+YFI P GH LKPLDVEFMK +H KVNI+PVI K+DT+T  E    K+ V  +L+ + IKIY FPE       SD D E     ++ +  IPF+VIG +  ++ +G+++RGR YPWG  EV+++EH D   L+ M++RTH+ DLKDVT    YE++R 
Sbjct:   25 VGFATLPNQVHRKSVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYHDRVLLPADGKRCDTTEILRRTLEI-EEKGVRLRLSLVDTPGFADAIDNTECWQPVVEYVEEQFESYFREESGLDRKNLQDTRVHCCLYFISPYGHGLKPLDVEFMKALHNKVNIVPVIAKADTLTMRERETLKRRVQEELSENDIKIYQFPECD-----SDEDDEFKRQDEELKASIPFAVIGGSAVVEASGRRVRGRLYPWGIAEVDSSEHCDLAKLRTMLIRTHMQDLKDVTRDLHYEEHRA 309          
BLAST of Septin-7 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 270.781 bits (691), Expect = 2.359e-87
Identity = 114/197 (57.87%), Postives = 161/197 (81.73%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPE 857
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y +EY GPS+R++KT+ +E + V+LKE  V L L +VDTPGFGDAVDNS+CW  II+YID++ +++++ E +VNR + PD R+H C+YFI P+GH LKPLD+EFMKR+H+KVNIIP+I K+D++T EEC+ FKK ++ ++  HKIKIY+FP+
Sbjct:   17 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYASEYPGPSQRVRKTLQVEQSKVVLKEGGVQLTLTIVDTPGFGDAVDNSSCWQSIIDYIDSKCEDYLNAEARVNRRLMPDSRVHCCLYFIFPSGHQLKPLDIEFMKRLHDKVNIIPLIAKADSLTTEECQQFKKTIMKEILEHKIKIYEFPD 213          
BLAST of Septin-7 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 253.832 bits (647), Expect = 2.312e-79
Identity = 129/301 (42.86%), Postives = 201/301 (66.78%), Query Frame = 3
Query:  249 LDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPS--KRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRL-IFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMS 1142
            LD    +G  ++ +Q+ ++A ++GFEFN+MVVG SGLGKST +N+L  S   + +   P+  ++I KTV I+  + +++E  V +KL ++DTPGFGD ++N+ CW+P+++YI++++++++  E  + R  + PD R+H CIYFI  TGH+L+ LD+EFMKR+ + VNI+PVI KSDT+T EE + FKK +  QL    I IY   E    +   + D  V +  K RE +PF+V+GS+     NG+K  GR+  WG +E+EN  H +F  L+ +++R+H  DLK+VTS   YE YRVL++S
Sbjct:   41 LDAFGYVGIDAVLEQMRRKAMKQGFEFNIMVVGQSGLGKSTLVNTLFKSPV-SRKSCTPNHEEKIPKTVEIKSVSHVIEEKGVKMKLTVIDTPGFGDQINNNNCWEPVLKYINDQYEKYLAEEVNITRKKVIPDSRVHCCIYFIPATGHSLRLLDIEFMKRLGKVVNIVPVIAKSDTLTLEERQAFKKKIREQLETQGISIYPHKE----HDEDEEDRSVNN--KIRELMPFAVVGSDKDYLVNGRKTLGRKTKWGIIEIENVAHCEFSQLRELLIRSHTQDLKEVTSCVHYEGYRVLRLS 334          
BLAST of Septin-7 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 223.016 bits (567), Expect = 3.258e-68
Identity = 112/270 (41.48%), Postives = 175/270 (64.81%), Query Frame = 3
Query:  345 GCSGLGKSTFINSLLMSDFYNTEYLGPS--KRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNR-LIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSK 1145
            G SGLGKST +N+L  S   + +   P+  +RI KTV I+  + +++E  V +KL ++DTPGFGD ++N  CW+PI++YI  ++++++  E ++ R    PD R+H CIY I P+GH+L+PLDVEFM+ + + V+++PVI K+DT+T EE   F++ +   L  H I +Y   E          + EV      REKIPF+V+GS+    +NG+++ GR+  WG VEVEN  H +F  L+ +++R+H+ DLKDVT   LYE YRV ++++
Sbjct:    1 GQSGLGKSTLVNTLFKSRV-SRKSCTPNYQERILKTVEIQSVSHVIEERGVKMKLTVIDTPGFGDQINNENCWEPILKYIGEQYEKYLREEVRITRKRHIPDTRVHCCIYCIPPSGHSLRPLDVEFMQHLSKVVSVVPVITKADTLTLEERHLFRQRIQADLVAHGIDVYPQREFDEDEQGRLENAEV------REKIPFAVVGSDREYQENGRRVLGRKTRWGLVEVENINHCEFALLRDLLIRSHMEDLKDVTHSILYETYRVRRLNE 263          
BLAST of Septin-7 vs. Ensembl Yeast
Match: CDC3 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble with other septins into rod-like complexes that can associate with other rods to form filament polymers; septin rings at the mother-bud neck act as scaffolds for recruiting factors needed for cell division and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000004306])

HSP 1 Score: 291.967 bits (746), Expect = 8.839e-92
Identity = 164/449 (36.53%), Postives = 264/449 (58.80%), Query Frame = 3
Query:  144 RKQSMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYK-----IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYL----------------------GPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDN-SACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDK-NGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDL 1403
            R ++ ++  K E  +     +S S K  V  +  ++  + +     +GF +L  Q ++R+ + GF FNL+ VG  G+GK+T + +L  +D      +                        S+  +  V I+    +++EN V L L ++DT GFGD ++N    WDPII+ ID+RFD+++D ENK+NR    DKRIHAC+YFI+PTGH LKPLD++FM+ ++EK N+IPVI KSD +T EE   FKK ++NQL    I+++  P     YS  D +   +  ++    +P++VIGSN  ++  +G ++RGR YPWG +EV+N  H+DF  LK ++++  + +LK+ TS+ LYE YR  K++K+    + +V    DP+ + + EK   E ++ K+E EMK +F+QK  E+  KL++SE +L  R + MK +L  Q K LE++K + +L
Sbjct:   54 RFEAAESDVKVEPGLGMGITSSQSEKGQVLPDQPEIKFIRRQINGYVGFANLPKQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIKEIDSRFDQYLDAENKINRHSINDKRIHACLYFIEPTGHYLKPLDLKFMQSVYEKCNLIPVIAKSDILTDEEILSFKKTIMNQLIQSNIELFKPP----IYSNDDAENSHLS-ERLFSSLPYAVIGSNDIVENYSGNQVRGRSYPWGVIEVDNDNHSDFNLLKNLLIKQFMEELKERTSKILYENYRSSKLAKLGIKQDNSVFKEFDPISKQQEEKTLHEAKLAKLEIEMKTVFQQKVSEKEKKLQKSETELFARHKEMKEKLTKQLKALEDKKKQLEL 497          
BLAST of Septin-7 vs. Ensembl Yeast
Match: CDC10 (Component of the septin ring, required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells; N-terminus interacts with phosphatidylinositol-4,5-bisphosphate; protein abundance increases under DNA damage stress [Source:SGD;Acc:S000000595])

HSP 1 Score: 223.787 bits (569), Expect = 2.756e-68
Identity = 117/302 (38.74%), Postives = 181/302 (59.93%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLG--PSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIF-PDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSN 1163
            +GF ++T+Q+  R  +KGF+FN+MVVG SGLGKST IN+L  S   ++       +  + KT  ++ +T  L E+ V L + ++DTPGFGD +DNS  W+PI++YI  +  +++  E    R  F  D R+HA +YF+QP G  L  LDVE +KR+ E  N+IPVIGKSDT+T +E  +F++ + N+   +  KIY +          + +      +  R  IPF+V+GS   I+ NG+  RGR+  W  + VE+    DFV+L+  ++RTHL DL + TS   YE +R  ++  + E++N
Sbjct:   13 VGFDTITNQIEHRLLKKGFQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISALPVTKTTEMKISTHTLVEDRVRLNINVIDTPGFGDFIDNSKAWEPIVKYIKEQHSQYLRKELTAQRERFITDTRVHAILYFLQPNGKELSRLDVEALKRLTEIANVIPVIGKSDTLTLDERTEFRELIQNEFEKYNFKIYPYDSEELTDEELELN------RSVRSIIPFAVVGSENEIEINGETFRGRKTRWSAINVEDINQCDFVYLREFLIRTHLQDLIETTSYIHYEGFRARQLIALKENAN 308          
BLAST of Septin-7 vs. Ensembl Yeast
Match: CDC12 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate with other rods to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000001149])

HSP 1 Score: 213.386 bits (542), Expect = 2.401e-63
Identity = 140/398 (35.18%), Postives = 229/398 (57.54%), Query Frame = 3
Query:  270 GFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKR---IKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESG----AAYSASDNDGEVMD-LKKCREKIPFSVIGS-NIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKD----PMMQLEAEKGEQENRIKKMEEEMKQLF--EQKAEERTTKLKESEIDLEKRKEHMKV-QLETQSKELEEQKAKFDLEKSQ 1415
            G  +L +Q YK    +G  F +M+ G SGLGK+TFIN+L  +     +  G   R   I+KTV I+ T  +L+E    L++ ++DTPGFGD V+N+  W P++++ID++ D ++  E +  R    D R+HA +YFI+PTGH LKP+D+E MKR+  + N+IPVI K+DT+T +E + FK  +   +   +I+I+  P        A S S+ D   ++  ++  E +PF+++GS   F +  G ++  R+YPWG VE+EN  H DF  L+ +++RT+LLDL   T +  YE YR L++     + + N  +G +    P +   A K     R K+ E  +K+ F  + KAEE+  +  E  I  E+ + +  + +++ + K+LEEQ     ++KS 
Sbjct:   16 GISNLPNQRYKIVNEEGGTFTVMLCGESGLGKTTFINTLFQTVLKRAD--GQQHRQEPIRKTVEIDITRALLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDDQHDSYMRQEQQPYRTKKFDLRVHAVLYFIRPTGHGLKPIDIETMKRLSTRANLIPVIAKADTLTAQELQQFKSRIRQVIEAQEIRIFTPPLDADSKEDAKSGSNPDSAAVEHARQLIEAMPFAIVGSEKKFDNGQGTQVVARKYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYRRLRL-----EGHENTGEGNEDFTLPAI-APARKLSHNPRYKEEENALKKYFTDQVKAEEQRFRQWEQNIVNERIRLNGDLEEIQGKVKKLEEQVKSLQVKKSH 405          
BLAST of Septin-7 vs. Ensembl Yeast
Match: CDC11 (Component of the septin ring that is required for cytokinesis; present at the ends of rod-like septin hetero-oligomers; C-terminal extension is important for recruitment of Bni5p to the mother-bud neck, which in turn is required for Myo1p recruitment and cytokinesis; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000003837])

HSP 1 Score: 202.601 bits (514), Expect = 3.812e-59
Identity = 111/288 (38.54%), Postives = 178/288 (61.81%), Query Frame = 3
Query:  300 KRAFRKGFEFNLMVVGCSGLGKSTFINSLL---MSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVV-LKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNR-LIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNG--KKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMS 1142
            ++  ++G  F +M+VG SG G+STFIN+L    + D   T  L      +  + +   TV L++++ V ++L ++DTPGFGD++DNS  ++ I +YI +++DE +  E++V R   F D R+H C+Y I PTGH LK +DVEF++++   VNIIPVI KSD++T +E +  KK ++  +    + IY+FP      S  D +  +      R  +PF++IGSN   +  G    IRGR+YPWG ++VE++  +DFV L+  ++ +HL DLK+ T + LYE+YR   +S
Sbjct:   14 RKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDTSTEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDELKLNKKLIMEDIDRWNLPIYNFPFDEDEISDEDYETNMY----LRTLLPFAIIGSNEVYEMGGDVGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEALS 297          
BLAST of Septin-7 vs. Ensembl Yeast
Match: SPR3 (Sporulation-specific homolog of the CDC3/10/11/12 family of genes; septin protein involved in sporulation; regulated by ABFI; the yeast CDC3/10/11/12 family is a family of bud neck microfilament genes [Source:SGD;Acc:S000003291])

HSP 1 Score: 171.785 bits (434), Expect = 4.268e-47
Identity = 104/289 (35.99%), Postives = 163/289 (56.40%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKK-CREKIPFSVIGSNIFI-DKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR 1127
            IG  +L  Q      + G +F LMV G SGLGK+TFINSL  +   + +       IK+   I     I++ +   L   ++DTPGFG+ +DN+  W  ++ YID     +I  E + +R    D R+H C+YF++P+   +  LDV  MK++ ++VN+IPVI KSD +T EE ++FK  V        I++ D P     +   D   EV++  +   +K PFS+I SN +I ++ G+K++GR+Y WG V++EN ++ DF  L+  I   +L+DL + T +  YEK R
Sbjct:   90 IGIKNLPRQRELLNAKNGIDFTLMVAGQSGLGKTTFINSLFSTSLIDDD-------IKENKPIIRYKSIVEGDGTHLNFNVIDTPGFGNNMDNAFTWRTMVNYIDEEIRSYIFQEEQPDRTKMVDNRVHCCLYFLRPSNKGIDTLDVVTMKKLAKRVNLIPVIAKSDLLTKEELKNFKTQVR-----EIIRVQDIP---VCFFFGD---EVLNATQDIFQKYPFSIIASNEYIFNEKGEKVKGRQYKWGAVDIENEKYCDFKILQKTIFDWNLIDLVEST-EDYYEKCR 359          
BLAST of Septin-7 vs. Ensembl Nematostella
Match: EDO34522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP25])

HSP 1 Score: 384.415 bits (986), Expect = 3.058e-128
Identity = 191/371 (51.48%), Postives = 267/371 (71.97%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYN-TEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIA----EDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQ 1364
            +GF +L +QV++++ +KGFEF +MVVG SGLGKST +NSL ++D Y  + Y    +++ KTV ++P TV LKE  V L+L +VDTPGFGDAVDN+ CW P+I+YID++F+EH++ E++V R  FPD R+H C+YFI PTGH+LKPLD+EFMK++H KVNI+PVI K+DT+T EEC  FKK +L ++  + I IY+FP+ G    A       +D    R+K+PF+V+GSN  ++ NGK++R R YPWG VEVEN EH DFV L+ M++RTH+ DLKDVT+   YE YR  K++ +       S  +VS  K P+ QLEAEK + E ++KKME+EM+Q+F+ K +E+  KLK+SE +L K+ E M  QLE Q
Sbjct:    5 VGFANLPNQVFRKSVKKGFEFTVMVVGESGLGKSTLLNSLFLTDLYTPSSYPSIKEKLNKTVEVKPCTVELKEGGVRLRLTVVDTPGFGDAVDNTDCWKPVIKYIDSKFEEHLNAESRVQRSPFPDNRVHCCLYFISPTGHSLKPLDIEFMKKLHNKVNIVPVISKADTLTTEECTRFKKQILQEIKENNISIYEFPDLGGEEDAE------LDAVNMRDKVPFAVVGSNTVLEVNGKRVRARVYPWGVVEVENVEHCDFVALRNMLIRTHMQDLKDVTNDAHYENYRCDKLASMTVGSPSSSPSHVSLSKSPLEQLEAEKDDHEKKLKKMEQEMEQVFDIKVKEKKKKLKDSEAELGKKHEQMTNQLEQQ 369          
BLAST of Septin-7 vs. Ensembl Nematostella
Match: EDO47409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX3])

HSP 1 Score: 317.39 bits (812), Expect = 4.430e-103
Identity = 161/348 (46.26%), Postives = 232/348 (66.67%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSK-RIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKK-CREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKY---RVLKMSKIAEDSNFNVSDG----------KDPMMQ-LEAEKGEQENRIKKMEEEMKQ 1262
            +GF +L +QV++++ +KGFEF LMVVG SGLGKST I+SL ++D Y+ + + P+K RI +TV+IE  TV ++E  V L+L +VDTPGF DAVDN+  W+PI++YID++F+ ++ +E+ +NR    D R+H C+YFI P GH L+P+DVEFMK +H KVNI+PVI KSD++T  E    K+ VL+++  H+IKIY FPE       S++D E + + K  +  +PF+VIGSN  I+  G+K+R R YPWG  EVEN +H DF+ L+ M++RTH+ DLKDVT    YE Y   R+L  +  A   N   + G          KD M+Q  EAE    +  + KM++E+ Q
Sbjct:   18 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYDDKSIPPAKGRIGQTVHIESNTVEIEEKGVRLRLTVVDTPGFADAVDNTYSWEPIVDYIDHQFESYLRDESGLNRRNIMDTRVHCCLYFINPHGHGLRPVDVEFMKALHTKVNIVPVIAKSDSLTKTEISRLKRKVLDEIADHEIKIYSFPECD-----SEDDEEFLAINKDLKASLPFAVIGSNTVIEVKGRKVRARWYPWGYAEVENPDHCDFIKLRNMLVRTHMQDLKDVTQDVHYENYRAQRLLDQTGKANTKNSKKTTGSYDQVVDISEKDKMLQEKEAELRRMQEMLAKMQQEIHQ 360          
BLAST of Septin-7 vs. Ensembl Nematostella
Match: EDO33106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST61])

HSP 1 Score: 276.559 bits (706), Expect = 1.012e-88
Identity = 132/269 (49.07%), Postives = 193/269 (71.75%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFY-NTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMD-LKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIM 1067
            +GF +L +QV++++ +KGFEF LMVVG SGLGKST I+SL ++D Y + + L   +RIKKTV IE +TV ++E  V L+L +VDTPG+GD +++   + PI++Y +N+F+ ++ +E+ +NR    D R+H C YFI PTGH LKPLD+EFMK +H  VNI+PVIGK+DT+TP E ++ K+ VL+++  + I+IY+ P+       SD D E ++  ++ +E +PF+V+GSN  ID  GKK+RGR YPWG VEVEN  H DF  L+ M+M
Sbjct:    5 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERIKKTVKIETSTVEIEERGVKLRLTVVDTPGYGDGINHKNSFKPILDYANNQFESYLKDESGLNRRHIIDSRVHCCFYFIAPTGHGLKPLDIEFMKALHHIVNIVPVIGKADTLTPTELKEMKRRVLDEIDEYGIQIYELPQ-----CDSDEDEEFIEQTRQLKEGMPFAVVGSNTLIDVCGKKVRGRLYPWGVVEVENPIHCDFSKLRAMLM 268          
BLAST of Septin-7 vs. Ensembl Nematostella
Match: EDO37950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE59])

HSP 1 Score: 241.506 bits (615), Expect = 5.822e-74
Identity = 138/377 (36.60%), Postives = 222/377 (58.89%), Query Frame = 3
Query:  225 SVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLI--FPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFP---ESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQL----EAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEK 1328
            S+ ++ ++L +   +GF SL DQ+  ++  +GF FN++ +G +G+GKST +++L  + F       P       V IE  T  L E++V+LKL +VDT G+GD ++       I+ YID +FD ++  E K+ R +  F D RIHAC+YFI PTGH+LK LD+  MK++ +KVNIIP+I K+DT+   E + FK+ ++++L  + ++IY FP   E+ A  +++ N+           +IPF+V+GS   +  N  K R R YPWG VEVEN  H DFV L+ M++RT++  L D T    YE +R  K+    E+  FN  D  +    L    E  + E  ++ +  EE+M+Q F QK +++  +LK++E ++ +
Sbjct:   11 SLGADGRQLRLAGHVGFDSLPDQLVNKSVNRGFAFNILCIGETGIGKSTLMDTLFQTTFEGQ----PHSHHLPGVQIEHHTYDLNESNVMLKLTIVDTVGYGDQINKEDSSSSIVNYIDQQFDTYLHQELKIKRTMDTFHDTRIHACLYFISPTGHSLKSLDLVCMKQLDKKVNIIPIIAKADTIAKSELKQFKQKIMDELESNGVEIYRFPVDDETVAEMNSTMNN-----------EIPFAVVGSREEVMVNKTKSRARVYPWGTVEVENENHCDFVKLREMLIRTNMQSLIDKTHTVHYELFRRNKL----EEMGFNDGDANNKSHSLQETYEERRKEYMSQFQDKEEKMRQRFVQKVKDKENELKKAEQEVRR 368          
BLAST of Septin-7 vs. Ensembl Nematostella
Match: EDO47975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG1])

HSP 1 Score: 191.43 bits (485), Expect = 3.116e-57
Identity = 87/194 (44.85%), Postives = 130/194 (67.01%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLI-FPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIY 845
            +GF ++ +Q+ +++ ++GFEFNLMVVG SGLGKST +N+L           G    I KTV ++  + +++E  V LKL + DTPGFGD ++N  CW+PI++YI++++D+ +  E  + R    PD R+H C+YFI PTGH LKP+DVEFMKR+ + VNI+PVI K+D MT EE   F++ +   +  H I I+
Sbjct:    3 VGFDTVQEQIRRKSLKRGFEFNLMVVGASGLGKSTMVNTLFKGKLSRPTSTGKPTIIPKTVDVKSVSHVIEEKGVRLKLTITDTPGFGDQINNDKCWEPIMDYINSQYDKFLTEEVTIERKPRIPDSRVHCCLYFIAPTGHRLKPIDVEFMKRLDKCVNIVPVIAKADNMTLEEREAFRRRLREDIQAHNINIH 196          
BLAST of Septin-7 vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 433.335 bits (1113), Expect = 7.086e-147
Identity = 206/401 (51.37%), Postives = 292/401 (72.82%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAED------------SNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHR 1433
            +GF SL +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD RIH C+YFI P+GH LKPLD+EFMKR+HEKVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++K+P +V+GSN  I+ N K++RGR+YPWG  EVEN++H DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +  +            +  +  +GK P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++  F+ E++ WE L R
Sbjct:   11 VGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRIHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPE-------TDDEEENRLVKKIKDKLPLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGLDNNKGKGQLSTKLDTVEGKSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRVFEEERANWEALQR 404          
BLAST of Septin-7 vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 431.024 bits (1107), Expect = 4.103e-146
Identity = 207/394 (52.54%), Postives = 291/394 (73.86%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDS-NFNVSDG----KDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHR 1433
            +GF SL +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD RIH C+YFI P+GH LKPLD+EFMKR+HEKVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++K+P +V+GSN  I+ N K++RGR+YPWG  EVEN++H DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +  +  + N   G    K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++  F+ E++ WE L R
Sbjct:   11 VGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRIHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPE-------TDDEEENRLVKKIKDKLPLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGLDNNKGKGQLSTKSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRVFEEERANWEALQR 397          
BLAST of Septin-7 vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 416.001 bits (1068), Expect = 1.385e-139
Identity = 209/442 (47.29%), Postives = 294/442 (66.52%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAED----------------------------SNFNVS------------------------DG-KDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHR 1433
            +GF SL +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I++ID++F+++++ E++VNR   PD RIH C+YFI P+GH LKPLD+EFMKR+HEKVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FPE       +D++ E   +KK ++K+P +V+GSN  I+ N K++RGR+YPWG  EVEN++H DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +  +                            S  NV+                        DG + P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +L++R E MK  LE Q KELEE++  F+ E++ WE L R
Sbjct:   11 VGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRIHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPE-------TDDEEENRLVKKIKDKLPLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGLDNNKGKGQLSTNAAAVRTKRRRMKAASGRNVAPEKQEETEVCCSRQENLSFSFEGVDGPRSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRVFEEERANWEALQR 445          
BLAST of Septin-7 vs. Ensembl Medaka
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:105358736])

HSP 1 Score: 413.69 bits (1062), Expect = 3.372e-139
Identity = 207/398 (52.01%), Postives = 290/398 (72.86%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI----AEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ +Y GPS+RIKKTV +E + V++KE  V L L +VDTPGFGDAVDNS CW P+I YID++ ++ ++ E++VNR   PD R+H C+YFI P+GH LKPLD+EFMKR+H+KVN+IP+I K+DT+TPEEC+ FKK ++ ++  HKIKIY+FP+     +  D D ++  ++K +EK+P +V+GSN+ ++ NGKK+RGR+YPWG  EVEN EH DF  L+ M++RTH+ DLKDVT+   YE YR  K++ +     + S  N    K P+ Q+E E+ E   ++KKME EM+Q+FE K +E+  KLK+SE +LE+R E MK  LE Q KELEE++  F+ EK+ WE   R  E Q
Sbjct:   21 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRSMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD-----TEEDEDNKL--IRKIKEKMPLAVVGSNVVVEVNGKKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTCNGVDTSKRNGQLTKSPLAQMEEERREHVMKMKKMEAEMEQVFELKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRVFEEEKANWEAQQRILEQQ 411          
BLAST of Septin-7 vs. Ensembl Medaka
Match: ENSORLT00000010965.2 (septin-7 [Source:NCBI gene;Acc:101158211])

HSP 1 Score: 407.527 bits (1046), Expect = 9.541e-137
Identity = 190/404 (47.03%), Postives = 285/404 (70.54%), Query Frame = 3
Query:  267 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKI----------AEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQ 1448
            +GF +L +QVY+++ ++GFEF LMVVG SGLGKST INSL ++D Y+ EY GPS RIK+TV +E + V++KE  V L L +VDTPGFGDAVDNS CW  + +YID++F++ ++ E++VNR   PD R+H C+YFI P+GH LKPLD EFMK +HEKVNIIP+I K+DT+TPEEC+ FK+ ++ ++  ++IKIY        +  ++++ E+  +KK ++++P +V+GSN  I+ +GK++RGR+YPWG  EVEN+EH DF+ L+ M++RTH+ DLKDVT+   YE +R  K++ +           + +  + SDG  P+ Q+E E+ E   RIKKME+EM+ +FE K +E+  KL++SE +L+KR + M   +  Q ++LEE++ + + E + WE   R  E Q
Sbjct:   28 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKQTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSGCWKSVTDYIDSKFEDFLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDTEFMKYLHEKVNIIPLIAKADTLTPEECQQFKRQIMKEIQENEIKIY-------EFPETEDEEEMKMVKKIKDRLPLAVVGSNTIIEVDGKRVRGRKYPWGVAEVENSEHCDFMILRNMLIRTHMQDLKDVTNNVHYENFRSGKLAAVTCNGVENKHNGQLTKTDTSDGMSPLAQMEEERQENMGRIKKMEQEMENVFEMKVKEKLQKLRDSEAELQKRHDQMNRSILAQHRDLEEKRRQLEEEIATWETQQRILEQQ 424          
BLAST of Septin-7 vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 489/490 (99.80%), Postives = 489/490 (99.80%), Query Frame = 3
Query:   45 MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQFXXXXXXXXXXXXXXXXXXTLF 1514
            MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDV LKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQFELRSSSERLESKSKSKRKTLF
Sbjct:    1 MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQFELRSSSERLESKSKSKRKTLF 490          
BLAST of Septin-7 vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 473/490 (96.53%), Postives = 474/490 (96.73%), Query Frame = 3
Query:   45 MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQFXXXXXXXXXXXXXXXXXXTLF 1514
            MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQT               +VLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDV LKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQFELRSSSERLESKSKSKRKTLF
Sbjct:    1 MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNKLYQT---------------NVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRDWESQFELRSSSERLESKSKSKRKTLF 475          
BLAST of Septin-7 vs. Planmine SMEST
Match: SMESG000016474.1 (SMESG000016474.1)

HSP 1 Score: 456.447 bits (1173), Expect = 5.502e-155
Identity = 214/405 (52.84%), Postives = 295/405 (72.84%), Query Frame = 3
Query:  237 NNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYS-----ASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRD 1436
            +N K+ ++  IGF +L DQ+Y+R+   GFEFNLMVVGCSGLGKSTF+N+L +S+ YN E L P+KR +KTV+I  TTV + EN V LKL L+DTPGFGD+VDNS CW+P+++YI++++ E++  +N+V+R    D R+HAC+YFI+PTGH LK LD+EFMKRIH KVNIIP+I K+DT+ PEEC +FKK +LNQ+  + IKIYDFPE  AA S     A   +    D+   R++ PF+V+ SNI I+K G K+RGR YPWG VEV+N EHNDF  L+ +++ +HL D+KD T Q L+E YR  +MS  A+DS F V+DGKDPM Q++ EK E E +I+KMEE+M  LF+QK  E+T KL+E +  +E+ +  M  QLE   KE+E ++  F+ ++  WEE +R+
Sbjct:   74 DNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKTVHINTTTVNITENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRE 478          
BLAST of Septin-7 vs. Planmine SMEST
Match: SMESG000076922.1 (SMESG000076922.1)

HSP 1 Score: 278.485 bits (711), Expect = 8.935e-87
Identity = 139/303 (45.87%), Postives = 195/303 (64.36%), Query Frame = 3
Query:  225 SVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSK-RIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKN-GKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR 1127
            ++ SN    +   K+GF +L +Q+ ++A +KGF F LM+VG SGLGKSTF+NSLL    Y       S+  I  T  IE   + L E  V L+L +VDTPGFGD +D   CW PI+EYID  F ++  +E  +NR    D R+H C+YFI PTGH +KP+DVE MK +H KVNI+P+I K+D++T  E + FK+ V++ L  ++I  Y  P  G   S  +++    D  + R  +PFSV+GSNI +D + G+K+RGR+Y WG  EVEN++H +F  L+  I+RTH+ DLKDVT+  LYE YR
Sbjct:   34 TIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDSSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICG---SDEEDEFRAQD-AEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 332          
BLAST of Septin-7 vs. Planmine SMEST
Match: SMESG000048968.1 (SMESG000048968.1)

HSP 1 Score: 274.248 bits (700), Expect = 1.312e-85
Identity = 147/323 (45.51%), Postives = 206/323 (63.78%), Query Frame = 3
Query:  186 VNKLYQTSD----SSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPS-KRIKKTVYIEPTTVILKENDVVLKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDN--DGEVMDLKKCREKIPFSVIGSNIFIDKN-GKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRV 1130
            +NK ++ SD    S+  SV +   K D L  +GFG + DQ++++A +KGF F++MVVG SGLGKSTF+NSLLM+D Y    + P+ + I  T  I    + L E  V L+L ++DTPGF DAV+   CW PI +YI++ FD++   E  +NR    D RIH C+YF+ P G  LKPLDVE +KR+  K+NIIPVIGK+D++T +E +  K+ +LN +  +++ +Y  PE  +   AS    D E+   K C   +PFS+IGS   ID   G KIRGR+Y WG  EVEN +H DF  L+  +++TH+ DLKD+TS  LYE YR 
Sbjct:   10 INKSFKDSDANCNSNPNSVSTPKIKHDGLQSLGFGQIPDQMHRKAVKKGFNFSIMVVGESGLGKSTFVNSLLMTDLYKDREILPAFESIAVTTKIVKRFIELDEKGVKLRLTIIDTPGFNDAVNCYNCWKPIEDYINDTFDQYFKEECGLNRKNIQDNRIHCCLYFVNPFGRGLKPLDVEVIKRLQCKINIIPVIGKADSLTADELKKLKQKILNDIERYQLDVYRLPECESDEEASIRTLDSEI---KAC---LPFSIIGSPDIIDNTRGPKIRGRQYIWGTSEVENNKHCDFSRLRLFLLKTHMQDLKDMTSDVLYENYRA 326          
The following BLAST results are available for this feature:
BLAST of Septin-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN72.672e-14749.77septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN71.017e-14652.76septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN72.053e-13553.07septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN73.621e-13452.12septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN48.879e-9843.33septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
back to top
BLAST of Septin-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-592.096e-9641.13pep chromosome:WBcel235:I:13629227:13633494:1 gene... [more]
unc-617.977e-6835.37pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-611.531e-6735.88pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-612.301e-6735.37pep chromosome:WBcel235:V:14731136:14734237:-1 gen... [more]
back to top
BLAST of Septin-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnut7.317e-13751.01gene:FBgn0013726 transcript:FBtr0088792[more]
pnut7.317e-13751.01gene:FBgn0013726 transcript:FBtr0088793[more]
Sep17.550e-9043.07gene:FBgn0011710 transcript:FBtr0077198[more]
Sep47.277e-8639.32gene:FBgn0259923 transcript:FBtr0074371[more]
Sep44.754e-8539.32gene:FBgn0259923 transcript:FBtr0074368[more]
back to top
BLAST of Septin-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept151.304e-14652.26septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
sept7a1.615e-14652.26septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept151.707e-14652.26septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
sept7a3.371e-14651.36septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept7b1.272e-12852.53septin 7b [Source:ZFIN;Acc:ZDB-GENE-030131-37][more]
back to top
BLAST of Septin-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN73.834e-14652.35septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN71.164e-14552.76septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN71.399e-14551.11septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN71.543e-14551.18septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN71.677e-14551.56septin 7 [Source:NCBI gene;Acc:100216295][more]
back to top
BLAST of Septin-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sept74.180e-14749.77septin 7 [Source:MGI Symbol;Acc:MGI:1335094][more]
Sept77.504e-14752.76septin 7 [Source:MGI Symbol;Acc:MGI:1335094][more]
Sept44.478e-9748.79septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept44.508e-9743.33septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept43.391e-9643.33septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
back to top
BLAST of Septin-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R481|SEPT7_PONAB6.141e-14749.77Septin-7 OS=Pongo abelii OX=9601 GN=SEPTIN7 PE=2 S... [more]
sp|Q16181|SEPT7_HUMAN6.141e-14749.77Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 S... [more]
sp|Q6Q137|SEPT7_BOVIN6.141e-14749.77Septin-7 OS=Bos taurus OX=9913 GN=SEPTIN7 PE=2 SV=... [more]
sp|Q9WVC0|SEPT7_RAT1.755e-14652.76Septin-7 OS=Rattus norvegicus OX=10116 GN=Septin7 ... [more]
sp|O55131|SEPT7_MOUSE3.435e-14652.76Septin-7 OS=Mus musculus OX=10090 GN=Septin7 PE=1 ... [more]
back to top
BLAST of Septin-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8H2341.552e-15657.25Septin-type G domain-containing protein OS=Octopus... [more]
K1PCA08.784e-15656.81Septin-7 OS=Crassostrea gigas OX=29159 GN=CGI_1000... [more]
A0A293LZM62.911e-15352.81Septin-7 (Fragment) OS=Ornithodoros erraticus OX=2... [more]
A0A267EKJ55.749e-15348.09Septin-type G domain-containing protein OS=Macrost... [more]
A0A267FR106.912e-15348.09Septin-type G domain-containing protein OS=Macrost... [more]
back to top
BLAST of Septin-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept7a2.346e-14652.51septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept7a5.642e-14651.60septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept158.248e-13851.51septin-7-like [Source:NCBI gene;Acc:111195760][more]
sept152.125e-13651.00septin-7-like [Source:NCBI gene;Acc:111195760][more]
sept151.723e-13551.00septin-7-like [Source:NCBI gene;Acc:111195760][more]
back to top
BLAST of Septin-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN73.642e-11946.23septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
zgc:1622391.321e-9047.08zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28][more]
SEPTIN72.359e-8757.87septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN92.312e-7942.86septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN93.258e-6841.48septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
back to top
BLAST of Septin-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC38.839e-9236.53Component of the septin ring that is required for ... [more]
CDC102.756e-6838.74Component of the septin ring, required for cytokin... [more]
CDC122.401e-6335.18Component of the septin ring that is required for ... [more]
CDC113.812e-5938.54Component of the septin ring that is required for ... [more]
SPR34.268e-4735.99Sporulation-specific homolog of the CDC3/10/11/12 ... [more]
back to top
BLAST of Septin-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345223.058e-12851.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474094.430e-10346.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331061.012e-8849.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379505.822e-7436.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479753.116e-5744.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Septin-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept7b7.086e-14751.37septin-7 [Source:NCBI gene;Acc:101155717][more]
sept7b4.103e-14652.54septin-7 [Source:NCBI gene;Acc:101155717][more]
sept7b1.385e-13947.29septin-7 [Source:NCBI gene;Acc:101155717][more]
sept153.372e-13952.01septin-7-like [Source:NCBI gene;Acc:105358736][more]
ENSORLT00000010965.29.541e-13747.03septin-7 [Source:NCBI gene;Acc:101158211][more]
back to top
BLAST of Septin-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064397.10.000e+099.80SMESG000064397.1[more]
SMESG000064397.10.000e+096.53SMESG000064397.1[more]
SMESG000016474.15.502e-15552.84SMESG000016474.1[more]
SMESG000076922.18.935e-8745.87SMESG000076922.1[more]
SMESG000048968.11.312e-8545.51SMESG000048968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025572 ID=SMED30025572|Name=Septin-7|organism=Schmidtea mediterranea sexual|type=transcript|length=1920bp
ACTTAAGGTCAAATTAAATCACAAATTTTTTCAATAATTCTGCAATGAGT
TATTTAACGAAGAAAGAAGATCCAATGAAAACCTCATTTGAATCATCAGA
TAATAAACCATTACCTCGATTCACTACTCAATACACTGACATAAGAAAAC
AATCAATGGATACTAGTGCCAAAACTGAGTCATCCGTAAATAAATTGTAT
CAAACAAGTGATTCATCGAAGTTTTCAGTTTACTCAAATAATAAAAAGCT
AGATGTTTTATATAAAATAGGATTCGGTAGTCTCACCGATCAAGTTTACA
AGCGAGCATTTAGAAAGGGGTTCGAATTCAATTTAATGGTTGTCGGTTGC
TCTGGTTTGGGAAAATCAACATTTATTAACTCTCTTCTGATGTCAGATTT
TTATAATACTGAATATCTAGGACCTTCGAAACGAATCAAAAAAACTGTAT
ACATTGAGCCAACGACTGTGATTTTAAAGGAAAATGATGTTGTATTGAAA
TTGTGTTTAGTCGATACTCCTGGTTTCGGAGATGCTGTTGATAATAGTGC
CTGCTGGGATCCGATCATAGAGTATATCGACAACCGGTTTGATGAGCACA
TTGATAATGAGAACAAAGTCAATCGTTTAATATTTCCCGACAAACGGATC
CATGCTTGCATTTATTTCATCCAACCGACCGGACACAACCTGAAACCACT
CGATGTTGAATTCATGAAACGCATCCACGAAAAGGTGAACATAATTCCTG
TGATTGGGAAATCAGATACCATGACTCCAGAAGAATGTCGAGATTTTAAA
AAGAATGTGTTAAATCAACTCACGTTTCACAAAATCAAAATCTATGATTT
CCCCGAAAGTGGTGCTGCCTATTCGGCAAGTGACAATGATGGAGAAGTGA
TGGATTTGAAAAAGTGTCGAGAAAAAATTCCATTTTCTGTAATCGGTAGC
AATATTTTCATCGATAAAAATGGGAAAAAGATTCGGGGCAGACGATATCC
TTGGGGCGACGTGGAGGTTGAAAACGCTGAACACAACGATTTTGTGTTTT
TGAAATACATGATCATGAGAACGCATCTTTTAGATTTAAAGGATGTGACC
AGTCAACAGTTGTATGAGAAGTACCGCGTTTTGAAAATGTCGAAAATTGC
CGAGGATAGTAATTTCAATGTGTCTGATGGCAAAGATCCAATGATGCAAC
TAGAAGCCGAGAAAGGTGAACAAGAAAATCGAATTAAAAAAATGGAAGAA
GAGATGAAACAATTGTTTGAACAAAAGGCTGAAGAGCGAACAACGAAATT
AAAAGAATCTGAAATAGATTTGGAAAAACGAAAAGAACATATGAAAGTTC
AATTGGAAACCCAGAGTAAAGAATTGGAAGAGCAGAAAGCGAAATTTGAT
TTGGAAAAATCACAATGGGAAGAATTGCATAGAGATTGGGAATCACAATT
TGAACTTCGCTCTTCGTCAGAACGCCTGGAGAGTAAATCAAAAAGCAAAC
GCAAAACTCTGTTTTAATCGACGTGCACAATTTCCTGATAAGGTAAATAT
GAAAATAAAATTAATTCTAAAGTTGACTCGTGAATATTTATTCAAATTAG
TATAAATTTTGTACAAATTTCTTTTTATATTTTTCTTAGTGTTCAATGAT
TCGATGCTGAGAATATTTGTATTAGTATCATTTTTTATTTATTCTCTAAT
CTGTATTCTCTATTTGCACTTGATTGAGGTTCGATTTTTTGAAAACTTTT
TGCCAATTCAATTGATTTTGTTAGTGCTTTTGATCTGTTTGATTTTAATT
ATAAACGGGTTTTTTTTCGTGATCTCATTTTATTCGTGTTCGATTGTAAT
ACATGTAACGGAACATTAATGCATGACAATTTGTAGTAAATATTTTATTT
CAATATAATTTGTTTTCTTG
back to top

protein sequence of SMED30025572-orf-1

>SMED30025572-orf-1 ID=SMED30025572-orf-1|Name=SMED30025572-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=491bp
MSYLTKKEDPMKTSFESSDNKPLPRFTTQYTDIRKQSMDTSAKTESSVNK
LYQTSDSSKFSVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVV
GCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVV
LKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDK
RIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRD
FKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVI
GSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKD
VTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKM
EEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAK
FDLEKSQWEELHRDWESQFELRSSSERLESKSKSKRKTLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030379G_SEPTIN_dom
IPR016491Septin
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0031105septin complex