Cell polarity protein

Overview
NameCell polarity protein
Smed IDSMED30025553
Length (bp)7999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell polarity protein (SMED30025553) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell polarity protein (SMED30025553) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell polarity protein (SMED30025553) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell polarity protein (SMED30025553) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025553

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025553SMESG000027800.1 dd_Smed_v4_4789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025553SMESG000027800.1 dd_Smed_v4_4789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025553SMESG000027800.1 dd_Smed_v4_4789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30025553SMESG000027800.1 dd_Smed_v4_4789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025553SMESG000027800.1 dd_Smed_v4_4789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30025553SMESG000027800.1 dd_Smed_v6_4789_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30025553SMESG000027800.1 dd_Smed_v6_4789_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30025553SMESG000027800.1 dd_Smed_v4_4789_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30025553SMESG000027800.1 dd_Smed_v4_4789_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025553SMESG000027800.1 dd_Smed_v6_4789_0_1dd_Smed_v6PMID:28461239
Adler et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30025553SMESG000027800.1 dd_Smed_v6_4789_0_1dd_Smed_v6PMID:28461239
Adler et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30025553SMESG000027800.1 dd_Smed_v6_4789_0_1dd_Smed_v6PMID:28461239
Adler et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
body wall musculatureSMED30025553SMESG000027800.1 dd_Smed_v6_4789_0_1dd_Smed_v6PMID:28461239
Adler et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx musculatureSMED30025553SMESG000027800.1 dd_Smed_v6_4789_0_1dd_Smed_v6PMID:28461239
Adler et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell polarity protein vs. Ensembl Human
Match: NOTCH1 (notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881])

HSP 1 Score: 136.732 bits (343), Expect = 4.924e-31
Identity = 124/366 (33.88%), Postives = 163/366 (44.54%), Query Frame = 2
Query: 3428 CRNPL--KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSD--SFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCT-----ATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  PL   C    C+N G C  L + +  C C  G++G+ C++ +  C  + C NGG+C  ++    C C  + F G  C Q    C      C++ G C  E G   C CR T H G  CE+P   CS S C N G C     +P  D T       GF GQ CE  I  C  N CKNGG CV   +   C+C PE+TG  C E     +   N C N GTC+ ++    C C   + G+ C E    C S  C++G  C  R    YC+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   98 CLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQAD-PCASNPCANGGQCLPFEASYICHCPPS-FHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRAT-HTGPNCERPYVPCSPSPCQNGGTC-----RPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPH-GRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQ-GYTGPRCEIDV 453          

HSP 2 Score: 127.872 bits (320), Expect = 2.449e-28
Identity = 112/357 (31.37%), Postives = 157/357 (43.98%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G C Q    +   C C  G+ G+ CE     C    CR+G  C       +C C   G+ G NCE     C  + C N G C+       CDC     +G  CE+ I  C+   C N   C    +   C C A GF G  CE     CT + C NGG CV   +  TC C P FTG  C     +C S  C + GTC       +C+C + + G  C+ +   C S  C  GG C   +    C+C  + + G  C++P   C +            C +GG C      ++C CQ G+ GS C++   EC P+ C+N   C+    G++C C   GY G++CSE++
Sbjct:  833 CAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQ-AGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPA-GFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECP-SGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCV-AGYHGVNCSEEI 1184          

HSP 3 Score: 106.301 bits (264), Expect = 8.098e-22
Identity = 111/346 (32.08%), Postives = 145/346 (41.91%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            N  +C    C + G C    I++  C C  GFTG  C+     C    C+NG +C        C C+  G+ G +CE     C    C   G C        C CR   + G  CE  I  CS   C + G C   +   +C C   G  G  CE  +  C S+ C + G C+ +     C C P +TG  CN    +C+ N C N GTC        C C + +    C  E   C S+ C +G      NGY  CDC +  + GT C+I    C    C NGG C+     Y C C+EGF G  CQ    EC  N C N G C     G+ C+C    Y G +C
Sbjct:  490 NTDECASSPCLHNGRCLD-KINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCT-EGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCR-PGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCL-KGTTGPNCEINLDDCASSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGY-KCDC-DPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCL-LPYTGATC 826          

HSP 4 Score: 103.219 bits (256), Expect = 6.339e-21
Identity = 117/386 (30.31%), Postives = 152/386 (39.38%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGI--------CSIENGLPVCDCR--------NTQHKGKVCEKPI------CSESF-----------CNN----RGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +P  C  G C++        +    C C  G+TG  CE     C    CR+GG C   D    C C   G  G NCE +   C+ S C +           C+ E G     C         N  H G  CE  I      C E +           CN+     G C        CDC   G+ G  C+     C SN C NGG C    S   C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE+    C    C  GG C+    Y    C   T ++G  C +    C L  C +G +CQ  +G Y C CQ G+ G  C+ +  +C PN C N G C+   N   CDC   G+ G  C E +
Sbjct:  571 DPDPCHYGSCKD-------GVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCL-KGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDP-GWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFRGTFCEEDI 946          

HSP 5 Score: 100.138 bits (248), Expect = 5.869e-20
Identity = 106/356 (29.78%), Postives = 153/356 (42.98%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE------------QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCS--------SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV--CQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDC 4408
            +C+   C + G C Q       C C +G+TG  C+ +   C    C+NGG+C+    Q +C+C  +G+ G  C+            Q       CQ+ G+C        C C+   + G  CE  +  CS S C N   C  +     C C A G+ G  C  EI  C S+ C+NGG C+   +   C C     G  C  N   C+        S  CFN+GTC        C+C   F G+RCE +   C S+ C   G   C  R    +C+C+   + G RC ++   C  + C NGG C V +     + C+C  GF+G+ C+ + + C    C N G C       TC C
Sbjct: 1024 ECDSQPCLHGGTC-QDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECP-SGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQ-AGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVA-GYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECR-AGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLC 1374          

HSP 6 Score: 92.8189 bits (229), Expect = 9.522e-18
Identity = 111/406 (27.34%), Postives = 160/406 (39.41%), Query Frame = 2
Query: 3428 CRNP-LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-------------------------GT--------------GFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE-KPICSESFCNNRGRCYVH--NEQPICDCTATGFIGQKCEREI--CT--SNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            C  P + C    CQN G C         C C  GFTG+ CE+    CP + C+NGG C        C C                          GT              G+ G +C ++   C+ + C +   C        C+C + +  G +C     C  + CN    C  +  N + IC C  +G+ G  C +++  C+  +N C++ G C+       CQC   +TG +C  +  +C SN C ND TC       QC C   +EG  CE+    C S  C + G C  +     C+C  T + G  C      C    C NG  C      Y C C EG+ G+ C+ +  EC P+ C   G C      FTC C   GY G  C   +    ++  ++G
Sbjct:  215 CERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGR-TGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTC-PSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECP-TGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLC-RPGYTGHHCETNINECSSQPCRHG 615          

HSP 7 Score: 90.8929 bits (224), Expect = 3.774e-17
Identity = 99/316 (31.33%), Postives = 134/316 (42.41%), Query Frame = 2
Query: 3566 PRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ-SFCSDSFCQNNGICSIENGLPV----CDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHN-EQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P + C NGG+C   +    C C G  F G  C+  + C  + C+N G C + +   V    C C      G +C  P+   C  + C N G C +    +  C C   G+ G+ C++ + C SN C NGG C+P ++   C C P F G  C    NE       C + GTC+      +C C     G  CE     C    C  GG C+      + C C    + G  C  NI   CP   C NGG C      Y C C   + G  C E   EC   PN C+N G C   + G+ C C + G+ G  CSE +
Sbjct:   27 PGETCLNGGKCEAANGTEACVCGGA-FVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCA-LGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRC-PPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACL-PGFTGQNCEENI-DDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVN-GWTGEDCSENI 336          
BLAST of Cell polarity protein vs. Ensembl Human
Match: SNED1 (sushi, nidogen and EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:24696])

HSP 1 Score: 132.88 bits (333), Expect = 5.050e-30
Identity = 108/318 (33.96%), Postives = 137/318 (43.08%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER------EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDF---CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE--CPPNFCKNDGICSVINNGFTCDCTH 4414
            C+C  GFTG +C      C    C+NGG C       +C C   GF G  CE  QS C    CQ+ G C +ENG  VC C+   + G  CE  +  CS   C N G C        C C A  F G +CE       + C S  C NGG CV  D    C+C   F G  C ER      C N G C  +N    C C   F G  CE E    P +    C  GG C    G   C C +T++  +  ++P  C  + C NGG+C   +  Y CEC  GF G  C++ +   C    C+N G C      + C C +
Sbjct:  297 CSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCP-AGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQ-AGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLC-AEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECPEGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQCPLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVC-HTDHNASH-SLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPY 608          

HSP 2 Score: 126.716 bits (317), Expect = 3.760e-28
Identity = 121/421 (28.74%), Postives = 166/421 (39.43%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKC-EKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS-----DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER---EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK---CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKR-CPSDFCYYGGVCQIRNGYPYCDCQ-----------------------NTNYEGTRC--------------NIPKR---------------------CPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            P  C    C N G C   A     C C EGF G  C E++   C    CRNGGRC   +    C C   GF G  CE    +     ++ C + G C    G  +C C +T H         C    C N G C  H++   C+C   GF G+ CE+    +C+S  C+NGG C     +  C C   FTG  C   K   C+S  C N GTC+    + +C C   F G+ CEI    C    C  GG C+ R+   +C CQ                          + GTR               + P R                     C  + C +GG+CQ R   Y C C  G++G+ C+ ER EC  + C+N G C  +   + C C   G+ G+ C  +V    +   ++G
Sbjct:  430 PDACLSAPCHNGGTCVD-ADQGYVCECPEGFMGLDCRERVPDDCE---CRNGGRCLGANTT-LCQCP-LGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVC-HTDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCEC-PRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQDRVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCP-AGFVGVHCETEVDACDSSPCQHG 841          

HSP 3 Score: 125.946 bits (315), Expect = 7.711e-28
Identity = 107/316 (33.86%), Postives = 136/316 (43.04%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCE----KIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS-----ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK---CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK--RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPP 4348
            C    C N G C  L +    C C+E F G +CE     +   C    C NGG C   D+   C+C   GF G +C +    D  C+N G C   N   +C C      G +CE  I +      + C + G C  H    +C C  T           C S+ C NGG C   D   TC+C   F G  C + +   CSS  C N GTC  +     CSC   F G+ CEI K   C S  C+ GG C    G   CDC    + G  C I P  C    C NGG C+ R+  ++C CQ G+ G RCQ   +C P
Sbjct:  391 CSPDPCLNGGSCVDL-VGNYTCLCAEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECP-EGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQC-PLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCH-TDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCP-PGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGP 700          

HSP 4 Score: 124.405 bits (311), Expect = 1.953e-27
Identity = 116/405 (28.64%), Postives = 157/405 (38.77%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPI---CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN-----------------------------------------ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKR--CPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI--PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIY 4495
            +C    CQN G C    I+   C C  GF G  CE  +  C    C++GG+C + +    C C   G+ G  CE     CS   C N G C    G   C C     KG  CE    P+   C  + C+N G C   ++  +C+C   GF+G  C   +     C+NGG C+  ++   CQC   F G  C                                             C S+ CFN G+C   ++   C C + F G+ CE  +   C S  C  GG C+   G  +C C    + G  C I  P  C    C NGG C    G+Y C+C  GF G  C+     C  + C N G C   +  F C C   GY G  C  +V     E  K+  + +
Sbjct:  314 ECASQPCQNGGTCTH-GINSFRCQCPAGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQ-AGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAE-PFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCEC-PEGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQCPLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCP-YRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHC-QAGYMGRRCQAEVDCGPPEEVKHATLRF 711          

HSP 5 Score: 110.538 bits (275), Expect = 3.599e-23
Identity = 149/575 (25.91%), Postives = 218/575 (37.91%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIE-FTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE---QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI----------CTSNF------------CKNG-GLCVP---RDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK-RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV---TGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQ-TFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKY--------QTQSNVNDGQYYVVSIKKEGERGI--FKLLGPQTETFLISF------DGVTSGVQNEISYKEIIIG-ASNEERDIFKGAIGGFNWNGKYIFE--QIKTGQGERKGTIEIILVPT-IINRP 4984
            P  C+   C N G C     D   C C  GF G+ CEK     C    CRNGG C     +  C C    F G +CE      C+   C N G C    G   CDC      G+ CE     C  S C N G C   +    C C A G++G++C+ E+           T  F            C  G  L  P   R  QP    +      + +E  C S  C + G+C        C C+  +EG  CE+E+  C +  C  GG C+   G   C C    + G  C      C    C +GG C+   G Y C C E F G  C+   + C  + C   G C   N   +C C   GY G  C++++   T LK E  +   V    +PP G  + Q+  G+  T++ +   Y  R TD  +      + +L     G  Y        +  +N ND     V + +   R +  F++      T  + +          SGV+  I + E +   A++ +R + +          +Y  +   +   +GE   T  +   PT +  RP
Sbjct:  542 PSPCDSDPCFNGGSC-DAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCP-YRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDC-PPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQA-GYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDE--CRSQPCLHGGSCQDRVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCP-AGFVGVHCETEVDACDSSPCQHGGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCK-VGYTGEDCAKELFPPTALKMERVEESGVSISWNPPNGPAARQMLDGYAVTYVSSDGSY--RRTD--FVDRTRSSHQLQALAAGRAYNISVFSVKRNSNNKNDISRPAVLLARTRPRPVEGFEVTNVTASTISVQWALHRIRHATVSGVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTLSGLRGEEHPTESLATAPTHVWTRP 1104          

HSP 6 Score: 67.0106 bits (162), Expect = 6.672e-10
Identity = 47/143 (32.87%), Postives = 65/143 (45.45%), Query Frame = 2
Query: 4019 CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKR-CPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C +D  C   N    CSC   F G+RC ++   C S  C  GG C        C C    + G  C   +  C  + C +GG CQV NG   C CQ G+ G+ C+ +  +C P+ C N G C  +   +TC C    + G+ C
Sbjct:  284 CIDD--CVTGNPSYTCSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCP-AGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQAGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAEP-FKGLRC 422          
BLAST of Cell polarity protein vs. Ensembl Human
Match: SNED1 (sushi, nidogen and EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:24696])

HSP 1 Score: 132.109 bits (331), Expect = 8.819e-30
Identity = 108/318 (33.96%), Postives = 137/318 (43.08%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER------EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDF---CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE--CPPNFCKNDGICSVINNGFTCDCTH 4414
            C+C  GFTG +C      C    C+NGG C       +C C   GF G  CE  QS C    CQ+ G C +ENG  VC C+   + G  CE  +  CS   C N G C        C C A  F G +CE       + C S  C NGG CV  D    C+C   F G  C ER      C N G C  +N    C C   F G  CE E    P +    C  GG C    G   C C +T++  +  ++P  C  + C NGG+C   +  Y CEC  GF G  C++ +   C    C+N G C      + C C +
Sbjct:  297 CSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCP-AGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQ-AGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLC-AEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECPEGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQCPLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVC-HTDHNASH-SLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPY 608          

HSP 2 Score: 126.331 bits (316), Expect = 5.808e-28
Identity = 121/421 (28.74%), Postives = 166/421 (39.43%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKC-EKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS-----DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER---EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK---CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKR-CPSDFCYYGGVCQIRNGYPYCDCQ-----------------------NTNYEGTRC--------------NIPKR---------------------CPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            P  C    C N G C   A     C C EGF G  C E++   C    CRNGGRC   +    C C   GF G  CE    +     ++ C + G C    G  +C C +T H         C    C N G C  H++   C+C   GF G+ CE+    +C+S  C+NGG C     +  C C   FTG  C   K   C+S  C N GTC+    + +C C   F G+ CEI    C    C  GG C+ R+   +C CQ                          + GTR               + P R                     C  + C +GG+CQ R   Y C C  G++G+ C+ ER EC  + C+N G C  +   + C C   G+ G+ C  +V    +   ++G
Sbjct:  430 PDACLSAPCHNGGTCVD-ADQGYVCECPEGFMGLDCRERVPDDCE---CRNGGRCLGANTT-LCQCP-LGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVC-HTDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCEC-PRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQDRVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCP-AGFVGVHCETEVDACDSSPCQHG 841          

HSP 3 Score: 125.176 bits (313), Expect = 1.284e-27
Identity = 107/316 (33.86%), Postives = 136/316 (43.04%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCE----KIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS-----ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK---CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK--RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPP 4348
            C    C N G C  L +    C C+E F G +CE     +   C    C NGG C   D+   C+C   GF G +C +    D  C+N G C   N   +C C      G +CE  I +      + C + G C  H    +C C  T           C S+ C NGG C   D   TC+C   F G  C + +   CSS  C N GTC  +     CSC   F G+ CEI K   C S  C+ GG C    G   CDC    + G  C I P  C    C NGG C+ R+  ++C CQ G+ G RCQ   +C P
Sbjct:  391 CSPDPCLNGGSCVDL-VGNYTCLCAEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECP-EGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQC-PLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCH-TDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCP-PGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGP 700          

HSP 4 Score: 124.02 bits (310), Expect = 2.839e-27
Identity = 116/405 (28.64%), Postives = 157/405 (38.77%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPI---CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN-----------------------------------------ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKR--CPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI--PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIY 4495
            +C    CQN G C    I+   C C  GF G  CE  +  C    C++GG+C + +    C C   G+ G  CE     CS   C N G C    G   C C     KG  CE    P+   C  + C+N G C   ++  +C+C   GF+G  C   +     C+NGG C+  ++   CQC   F G  C                                             C S+ CFN G+C   ++   C C + F G+ CE  +   C S  C  GG C+   G  +C C    + G  C I  P  C    C NGG C    G+Y C+C  GF G  C+     C  + C N G C   +  F C C   GY G  C  +V     E  K+  + +
Sbjct:  314 ECASQPCQNGGTCTH-GINSFRCQCPAGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQ-AGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAE-PFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCEC-PEGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQCPLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCP-YRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHC-QAGYMGRRCQAEVDCGPPEEVKHATLRF 711          

HSP 5 Score: 110.538 bits (275), Expect = 3.828e-23
Identity = 149/575 (25.91%), Postives = 218/575 (37.91%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIE-FTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE---QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI----------CTSNF------------CKNG-GLCVP---RDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK-RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV---TGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQ-TFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKY--------QTQSNVNDGQYYVVSIKKEGERGI--FKLLGPQTETFLISF------DGVTSGVQNEISYKEIIIG-ASNEERDIFKGAIGGFNWNGKYIFE--QIKTGQGERKGTIEIILVPT-IINRP 4984
            P  C+   C N G C     D   C C  GF G+ CEK     C    CRNGG C     +  C C    F G +CE      C+   C N G C    G   CDC      G+ CE     C  S C N G C   +    C C A G++G++C+ E+           T  F            C  G  L  P   R  QP    +      + +E  C S  C + G+C        C C+  +EG  CE+E+  C +  C  GG C+   G   C C    + G  C      C    C +GG C+   G Y C C E F G  C+   + C  + C   G C   N   +C C   GY G  C++++   T LK E  +   V    +PP G  + Q+  G+  T++ +   Y  R TD  +      + +L     G  Y        +  +N ND     V + +   R +  F++      T  + +          SGV+  I + E +   A++ +R + +          +Y  +   +   +GE   T  +   PT +  RP
Sbjct:  542 PSPCDSDPCFNGGSC-DAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCP-YRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDC-PPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQA-GYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDE--CRSQPCLHGGSCQDRVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCP-AGFVGVHCETEVDACDSSPCQHGGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCK-VGYTGEDCAKELFPPTALKMERVEESGVSISWNPPNGPAARQMLDGYAVTYVSSDGSY--RRTD--FVDRTRSSHQLQALAAGRAYNISVFSVKRNSNNKNDISRPAVLLARTRPRPVEGFEVTNVTASTISVQWALHRIRHATVSGVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTLSGLRGEEHPTESLATAPTHVWTRP 1104          

HSP 6 Score: 66.6254 bits (161), Expect = 8.234e-10
Identity = 47/143 (32.87%), Postives = 65/143 (45.45%), Query Frame = 2
Query: 4019 CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKR-CPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C +D  C   N    CSC   F G+RC ++   C S  C  GG C        C C    + G  C   +  C  + C +GG CQV NG   C CQ G+ G+ C+ +  +C P+ C N G C  +   +TC C    + G+ C
Sbjct:  284 CIDD--CVTGNPSYTCSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCP-AGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQAGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAEP-FKGLRC 422          
BLAST of Cell polarity protein vs. Ensembl Human
Match: SNED1 (sushi, nidogen and EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:24696])

HSP 1 Score: 131.724 bits (330), Expect = 1.258e-29
Identity = 108/318 (33.96%), Postives = 137/318 (43.08%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER------EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDF---CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE--CPPNFCKNDGICSVINNGFTCDCTH 4414
            C+C  GFTG +C      C    C+NGG C       +C C   GF G  CE  QS C    CQ+ G C +ENG  VC C+   + G  CE  +  CS   C N G C        C C A  F G +CE       + C S  C NGG CV  D    C+C   F G  C ER      C N G C  +N    C C   F G  CE E    P +    C  GG C    G   C C +T++  +  ++P  C  + C NGG+C   +  Y CEC  GF G  C++ +   C    C+N G C      + C C +
Sbjct:  297 CSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCP-AGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQ-AGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLC-AEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECPEGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQCPLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVC-HTDHNASH-SLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPY 608          

HSP 2 Score: 125.561 bits (314), Expect = 9.116e-28
Identity = 121/421 (28.74%), Postives = 166/421 (39.43%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKC-EKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS-----DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER---EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK---CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKR-CPSDFCYYGGVCQIRNGYPYCDCQ-----------------------NTNYEGTRC--------------NIPKR---------------------CPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            P  C    C N G C   A     C C EGF G  C E++   C    CRNGGRC   +    C C   GF G  CE    +     ++ C + G C    G  +C C +T H         C    C N G C  H++   C+C   GF G+ CE+    +C+S  C+NGG C     +  C C   FTG  C   K   C+S  C N GTC+    + +C C   F G+ CEI    C    C  GG C+ R+   +C CQ                          + GTR               + P R                     C  + C +GG+CQ R   Y C C  G++G+ C+ ER EC  + C+N G C  +   + C C   G+ G+ C  +V    +   ++G
Sbjct:  430 PDACLSAPCHNGGTCVD-ADQGYVCECPEGFMGLDCRERVPDDCE---CRNGGRCLGANTT-LCQCP-LGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVC-HTDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCEC-PRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQDRVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCP-AGFVGVHCETEVDACDSSPCQHG 841          

HSP 3 Score: 124.79 bits (312), Expect = 1.777e-27
Identity = 107/316 (33.86%), Postives = 136/316 (43.04%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCE----KIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS-----ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK---CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK--RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPP 4348
            C    C N G C  L +    C C+E F G +CE     +   C    C NGG C   D+   C+C   GF G +C +    D  C+N G C   N   +C C      G +CE  I +      + C + G C  H    +C C  T           C S+ C NGG C   D   TC+C   F G  C + +   CSS  C N GTC  +     CSC   F G+ CEI K   C S  C+ GG C    G   CDC    + G  C I P  C    C NGG C+ R+  ++C CQ G+ G RCQ   +C P
Sbjct:  391 CSPDPCLNGGSCVDL-VGNYTCLCAEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECP-EGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQC-PLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCH-TDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCP-PGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGP 700          

HSP 4 Score: 123.25 bits (308), Expect = 4.349e-27
Identity = 116/405 (28.64%), Postives = 157/405 (38.77%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPI---CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN-----------------------------------------ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKR--CPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI--PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIY 4495
            +C    CQN G C    I+   C C  GF G  CE  +  C    C++GG+C + +    C C   G+ G  CE     CS   C N G C    G   C C     KG  CE    P+   C  + C+N G C   ++  +C+C   GF+G  C   +     C+NGG C+  ++   CQC   F G  C                                             C S+ CFN G+C   ++   C C + F G+ CE  +   C S  C  GG C+   G  +C C    + G  C I  P  C    C NGG C    G+Y C+C  GF G  C+     C  + C N G C   +  F C C   GY G  C  +V     E  K+  + +
Sbjct:  314 ECASQPCQNGGTCTH-GINSFRCQCPAGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQ-AGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAE-PFKGLRCETGDHPVPDACLSAPCHNGGTCVDADQGYVCEC-PEGFMGLDCRERVPDDCECRNGGRCLGANTT-LCQCPLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHSLPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCP-YRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHC-QAGYMGRRCQAEVDCGPPEEVKHATLRF 711          

HSP 5 Score: 109.768 bits (273), Expect = 5.554e-23
Identity = 149/575 (25.91%), Postives = 218/575 (37.91%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIE-FTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE---QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI----------CTSNF------------CKNG-GLCVP---RDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK-RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV---TGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQ-TFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKY--------QTQSNVNDGQYYVVSIKKEGERGI--FKLLGPQTETFLISF------DGVTSGVQNEISYKEIIIG-ASNEERDIFKGAIGGFNWNGKYIFE--QIKTGQGERKGTIEIILVPT-IINRP 4984
            P  C+   C N G C     D   C C  GF G+ CEK     C    CRNGG C     +  C C    F G +CE      C+   C N G C    G   CDC      G+ CE     C  S C N G C   +    C C A G++G++C+ E+           T  F            C  G  L  P   R  QP    +      + +E  C S  C + G+C        C C+  +EG  CE+E+  C +  C  GG C+   G   C C    + G  C      C    C +GG C+   G Y C C E F G  C+   + C  + C   G C   N   +C C   GY G  C++++   T LK E  +   V    +PP G  + Q+  G+  T++ +   Y  R TD  +      + +L     G  Y        +  +N ND     V + +   R +  F++      T  + +          SGV+  I + E +   A++ +R + +          +Y  +   +   +GE   T  +   PT +  RP
Sbjct:  542 PSPCDSDPCFNGGSC-DAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCP-YRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDC-PPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQA-GYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDE--CRSQPCLHGGSCQDRVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCP-AGFVGVHCETEVDACDSSPCQHGGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCK-VGYTGEDCAKELFPPTALKMERVEESGVSISWNPPNGPAARQMLDGYAVTYVSSDGSY--RRTD--FVDRTRSSHQLQALAAGRAYNISVFSVKRNSNNKNDISRPAVLLARTRPRPVEGFEVTNVTASTISVQWALHRIRHATVSGVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTLSGLRGEEHPTESLATAPTHVWTRP 1104          

HSP 6 Score: 66.2402 bits (160), Expect = 1.048e-9
Identity = 47/143 (32.87%), Postives = 65/143 (45.45%), Query Frame = 2
Query: 4019 CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKR-CPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C +D  C   N    CSC   F G+RC ++   C S  C  GG C        C C    + G  C   +  C  + C +GG CQV NG   C CQ G+ G+ C+ +  +C P+ C N G C  +   +TC C    + G+ C
Sbjct:  284 CIDD--CVTGNPSYTCSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCP-AGFGGPTCETAQSPCDTKECQHGGQCQVENGSAVCVCQAGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAEP-FKGLRC 422          
BLAST of Cell polarity protein vs. Ensembl Human
Match: NOTCH3 (notch receptor 3 [Source:HGNC Symbol;Acc:HGNC:7883])

HSP 1 Score: 123.25 bits (308), Expect = 6.576e-27
Identity = 110/357 (30.81%), Postives = 145/357 (40.62%), Query Frame = 2
Query: 3428 CRNP-LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDC--SGTG-FRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLC--VPRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C NP + C    C+N G C Q       C C  GF G+ CE     CP   C NGG C        C C    TG F   + ++     + C N G C    G   C C N    G+ C + I  C+ + C +   C+       C C   G  G  C   + C SN C    +C   P + +  C C P FTG  C++   +CS  +N C + G C  +     C C + + G RCE +   C S  C     C  R G   C C    + GT C +    C    C NGG C+ R   + C C  GF GS CQ +  EC    C+N   C    +G+ C C   G+ G  C   V
Sbjct:  194 CENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGW-TGESCSQNIDDCATAVCFHGATCHDRVASFYCAC-PMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICM-AGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAE-GFEGTLCDRNV 546          

HSP 2 Score: 121.709 bits (304), Expect = 1.928e-26
Identity = 111/360 (30.83%), Postives = 150/360 (41.67%), Query Frame = 2
Query: 3428 CRNPL-KCEMGY-CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMY-DKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI----CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN-ERKCSSNFCFNDGTCYIS--NERPQCSCTKNFEGQRCEI---EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            CR+ + +C +G  C++ G C         C C  G+TG  CE     C    CRNGG C    D    C C   GF G NCE +   C    C N G C        C C   +  G+ C + +       + C+N G C+       C C   G+ G+ C + I  C +  C +G  C  R +   C C    TG  C+ +  C SN C  D  C  +  N R  C+C   F G  C+    E    ++ C + G C    G   C C    Y G RC      C    C N   C  R GQ+ C C  GF G+ C+ +  EC  + C N G+C    NGF+C C  +G+ G +C   V
Sbjct:  155 CRSDVDECRVGEPCRHGGTCLNTP-GSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACL-PGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQC-PPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCV-NGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC-GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCP-SGFSGSTCQLDV 508          

HSP 3 Score: 117.472 bits (293), Expect = 2.986e-25
Identity = 110/388 (28.35%), Postives = 145/388 (37.37%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCE-------------------------KIEFTCPRDF---------------CRNGGRCYM-YDKQPKCDCSGTGFRGNNCEQSFCS---DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C N G C QL   +  C C  G+ GE+C+                         +    CPR F               C +G RC +  D +  C C   G++G +C            C++ G C    G   C C    + G +CE P   C+ S C N G C    +         GF GQ CE  +  C  + C NGG CV   +   CQC PE+TG  C E     +   N C N GTC+ +     C C   + G+ C      C +  C++G  C  R    YC C      G  C++   C    C     C     NG+  C C  GF G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   49 CANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCP-PGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQC-PAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACP-MGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGR-GYTGPRCETDV 432          

HSP 4 Score: 112.079 bits (279), Expect = 1.300e-23
Identity = 111/398 (27.89%), Postives = 160/398 (40.20%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLG--CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQ-PKCDCSGTGFRGNNCEQSF---CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI---------------------------------------CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK--CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPL------------EFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            CE   C+  G C   + D +G  C C  G  G +CE +   C  + C +GGRC     Q P C C   G++G  C+Q        + C  +GIC+   G   C C    + G  C++ I  C  + C N G C        C C   GF G +C R++                                       C+ + C NGG CV   +  +C C P +TG  C      C S  C + G C  ++   +C+C ++F G +C+ +   C    C  GG C ++ G  YC C    + G  C+I +  P             + C  GG C   +  +YC C EG  GS C QE   C    C++ G C     G+ C+C   GY G +C + V
Sbjct:  738 CESQPCRAGGTC---SSDGMGFHCTCPPGVQGRQCELLS-PCTPNPCEHGGRCESAPGQLPVCSCP-QGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG-YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLP-GFAGPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRC-VQTG-AYCLCP-PGWSGRLCDI-RSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECL-PGYNGDNCEDDV 1123          

HSP 5 Score: 108.997 bits (271), Expect = 1.215e-22
Identity = 110/385 (28.57%), Postives = 152/385 (39.48%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVC-QIRNGY----------PYC----------DCQN---------------TNYEGTRCN---IPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGIC-SVINNGFTCDCTHTGYFGISCSEKV 4450
            +C  G C+N+  C    I +  C C  GFTG  CE     C    C NGG C        C C  +GF G+ C+     C+ + C+N   C  +     C C     +G +C++ +  CS   C++ GRC        C C A G+ G +CE ++  C S  C++GG C+    +  C+C    TG  C  N   C+SN C   G C     R  C C   F G  C +E   C S  C  GG C    NG+          P C           C +                 + G RC+       C  + C  GG C      ++C C  G QG +C+    C PN C++ G C S       C C   G+ G  C + V
Sbjct:  434 ECLSGPCRNQATCLD-RIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCP-SGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEG-FEGTLCDRNVDDCSPDPCHH-GRCVDGIASFSCAC-APGYTGTRCESQVDECRSQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPC-TFGVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQ-GWQGPRCQQDV 811          

HSP 6 Score: 101.293 bits (251), Expect = 2.543e-20
Identity = 108/390 (27.69%), Postives = 149/390 (38.21%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCR-NTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDC------------------------------------TATGFIGQKCE----REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE-RKCSSNFCFNDGTCYIS-NERPQCSCTKNFEGQRCE--IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +P  C  G C +        I    C C+ G+TG +CE     C    CR+GG+C     +  C C  +G  G NCE +   C+ + C   G+C   +G+   DC       G +C   I  C+ S C   G C        C C                                       G+ G +C     R+ C S  C+ GG C        C C P   G QC     C+ N C + G C  +  + P CSC + ++G RC+  +++      C   G+C    G   C C    Y G  C+     C    C NGG+CQ   G + C C  GF G RC ++  EC  N C   G C+     FTC C   GY G  C + +
Sbjct:  550 SPDPCHHGRCVD-------GIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVDKYLCRCP-SGTTGVNCEVNIDDCASNPC-TFGVC--RDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHG-GYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPC-GPGTCTDHVASFTCTCP-PGYGGFHCEQDL 925          

HSP 7 Score: 98.5969 bits (244), Expect = 1.771e-19
Identity = 100/359 (27.86%), Postives = 143/359 (39.83%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTG----FRGNNCEQSFCS-----DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKC-------SSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYG---GVCQIRNGYPYCDCQNTNYEGTRCN-IPKRCPLEFCSNGGNCQVRNG-----QYYCECQEGFQGSRCQE-RKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C + G+C   A     C C E FTG +C+ +   C R  C+NGGRC        C    +G     R   C ++        +  CQ  G C  E+    C C   +  G  CE+ +  C    C + G C  +    +C+C   G+ G  CE ++  C S  C++GG C+   ++  C C P   G  C  NE  C       S   C ++GTC       +C+C   + G RCE +   C S  C+        Q   G   C C +  + G RC  +   C  + C +GG C+   G      + C C + F G RC+   + C    C     C     G  C C   G  G SC
Sbjct:  971 CLHGGVC-SAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGR-TGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLP-GYNGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLC-HAGFSGPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACP-PGLSGPSC 1324          

HSP 8 Score: 72.7886 bits (177), Expect = 1.276e-11
Identity = 89/317 (28.08%), Postives = 120/317 (37.85%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---------KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVP--RDSQPT------CQCTPEFTGFQCNE--RKCSSNFCFNDGTCYIS-----NERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC-NIP--------KRCPLEFCSNGGNCQVRNGQ--YYCECQEGFQGSRCQERKECP 4345
            C C EG TG  CE+    C    C++GG C  Y     C+C   G+ G+NCE     C+   CQ+ G C       +C C      G +CE          P+ S   C + G C        C C   G+ G +CE +I   N C++G       RD          C C   F+G +C      C S  C + G C  S          C C + F G RCE + + C    C  G  CQ     P C C      G  C + P          C    C +GG+C+       + C C +G+ G RC+     P
Sbjct: 1070 CVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECL-PGYNGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGT-LGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPP-GYTGLRCEADI---NECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACP-PGLSGPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAP 1379          

HSP 9 Score: 56.225 bits (134), Expect = 1.308e-6
Identity = 88/355 (24.79%), Postives = 123/355 (34.65%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER--EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----------NERKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEI---------EKRCPSDFC-------------------YYGGVCQIRNGYPYCDCQNTN----YEGTRCNIPKRCPLEF-----CSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGI 4372
            C + G C  L +    C C  G+TG +CE        + CR+G  C+    +      G GFR   C   F S   CQ          L  C+ +  QH G+      C  S     G  +       C C A  F G +CER    C    C  G  C      P C C P  +G  C          +   C++  C + G+C  +   P  +C+C + + G RCE          E RCP   C                   + GG C +  G P+  C+       +  +RC+     P        C  GG  +  N  Y   C + F   RC +   C    C  DG+
Sbjct: 1176 CLHNGTCVDL-VGGFRCTCPPGYTGLRCE-----ADINECRSGA-CHAAHTRDCLQDPGGGFRCL-CHAGF-SGPRCQTV--------LSPCESQPCQHGGQ------CRPSPGPGGGLTFT------CHC-AQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGLSGPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQ--GCNTEECGWDGL 1498          
BLAST of Cell polarity protein vs. Ensembl Celegans
Match: crb-1 (Drosophila CRumBs homolog [Source:UniProtKB/TrEMBL;Acc:Q19350])

HSP 1 Score: 140.969 bits (354), Expect = 7.440e-33
Identity = 148/500 (29.60%), Postives = 220/500 (44.00%), Query Frame = 2
Query: 3071 LDDNNWHRVVIMLNKKLRRII--VHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTN----VFTQLRVSLPYLAEKVATPNTWSLV--GCLGEFLISEDK--FLSNKLSGAINTYPLNSLDC--------GGCRNPL-KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYM-YDKQPKCDCSGTGFRGNNC---EQSFCSDSFCQNNGICSIE-NGLPVCDCRNTQHKGKVCEKPICSESFCN----NRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERP-QCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKN 4465
            + D NWH++++  +K L   +  +  ++ Y  +  + A +   +    E  F  +  DLF        +  +V +P  +E      TW+L     +G   +S D+    S  L+GA      N   C          C + +  C+   C   G C    ID+  C C+ GF GE CE  +  C    C NGG+C     ++  C C G  + G++C   + + C DS CQN G C  + +    C+C +  + G++CE+   +E  CN    NRG C +    P C C   G+ G+ CE+ +  C+SN C + G C P  +   C C   + G  C  +   C    C NDG C  ++E    C C K F G RCEIE  C    C +G   Q+      C C N  YEG  C+     C    C NG NC+ +   Y C C  GF+G+ C+    EC   FCKN   C    N + C C  TG+ G +C+  +    N
Sbjct: 1080 IADGNWHQIILNPHKVLIDSVKFISDNQLYPAESKSGASLFVGEQEPQEVTFACL--DLFKMGEYPTLSFTKVKIPTNSE------TWNLTDKASVGTGCMSTDQCGLYSTCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLD-GIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQC-GNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDG-YSGELCEQRDVNE--CNHYDCNRGHCVMTVSGPACQC-EMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSC-NIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECAN 1564          

HSP 2 Score: 134.42 bits (337), Expect = 8.991e-31
Identity = 206/835 (24.67%), Postives = 294/835 (35.21%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE---QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE-KPICSESFCNNRGR-CYVHN---EQPICDCTATGFIGQKC---EREICTSNFCKNGGLCVPRDSQP--TCQCTPEFTGFQCNER-KCSSNF--CFNDGTCYISNERPQCSCTKNFEGQRCEIEKR------CPSDFCYYGGVCQI-RNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECP----------PNF-----------------CKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTI----------------------------------------YTFRTT-------------DGRYWSLKMDNGKLVIDINGN--KYQTQSNVNDGQYYVVSIKKE------------GERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKY-IFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFL-------LQAYTSNNPVIRFELNDEQF------YEINMIDGKLI---FLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISN----DGSLIHKKIILGADKS-YKTYFQ 5521
            N   C    CQN G C       + C C  GF G+ CE  E  C  +FC+NG  C       +C C   GF G  CE   +  C+  +C NNG C        C C +    G  CE K   +E  C N    C + N       C+C  +GF+G  C   +   C    C NGG CV  D Q   TC C P FTG  C E   C  N   C N G C  +     C C + F G  CEI         C    C  GG C++   G P+C C+   ++G  C     C +  C NGG CQ  +GQY+C C  GF G  C+   E P          P+F                 C N   C  + +G  C C   GYFG  C +K       ++K   V  P        +D V +  Q   + G                                          ++FRTT               +  S+++ +G LV ++ GN  ++     V+D Q+Y V +K E            G   + K +  Q E FL  F G  SG  +                  F G +     +G   IF   K     RKG                 C + +C N G CI       CKC+   +    C      ++ +  +  G+L    I    T + E   L          ++     + F + ++        Y +  I G LI   +   G+     S   R+D+   + V+   +K   +  I+ +   S  + + +S     D  +I    ++  D   YK Y Q
Sbjct:  125 NEPSCATHTCQNNGTCVA-ENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCL-KGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKC-SPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCEC-PSGFMGADCKELQARPCDREPCLNGGHCV-DDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEE-GFDGPFCEPKSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDE-PSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCLDVESGPVCIC-DDGYFGQKCDQK-------HDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEMVTSATFSAKSLYIHQSSKFSLGTSSFENIAYELEFSFRTTVENTHLASSENILGEKILSIQLLSGYLVFNMTGNSLEHLLPMRVSDAQWYTVFVKGEDNKIQIEVSTENGFSLVQKSVNGQLEVFLTRF-GKISGTHH------------------FIGCMADVRVDGDLIIFADNKRAIDIRKGCTR-----------SEQCTRAYCQNEGICIDHWESSSCKCK-PPYLKPNC------VYFLPKTTFGHLDQPSIVHLSTSESENHLLRNHIELSFLMHSGKPDAVLFYIGEKHAADVLTNYLVVKIAGGLITVRYRTGGRREIEFSSKNRVDDNQEHHVQIFLDKTTRQIIIDDLIECSEPIISRMSQEFYVDDIVIGASNVVATDSEFYKGYLQ 907          

HSP 3 Score: 108.227 bits (269), Expect = 6.906e-23
Identity = 112/385 (29.09%), Postives = 160/385 (41.56%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCERE-ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNC---QVRN--GQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNG-----------------FTCDCTHTGYFGISCSEKV--TGLKNEYEKYGYVIYPV 4501
            C+   CQN G C Q       CNC +G++GE CE+ +      +  N G C M    P C C   G+ G  CE+    CS + C + G CS      VC+C N   +G  C+  +  C +  CNN G C  ++E    C+C    F+G +CE E  C    C +G          TC C   + G  C+++   C +  C N   C       +C+C   FEG  CEI    C  +FC  G  C+ +     C C  T +EG  C       +  C+N  NC   +  N  G Y C C+ GF G RC  R  C      N+       +G                 + C C   GY G +CS+++  + + N    +G +I  V
Sbjct: 1294 CKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGPACQCE-MGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNW-RGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKF-FMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTT----DINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDR-GYTGPTCSQRIKESAMSNISYLFGPIIAVV 1670          

HSP 4 Score: 99.7525 bits (247), Expect = 2.608e-20
Identity = 108/349 (30.95%), Postives = 155/349 (44.41%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFT-CPRDFCRNGGRCYM-YDKQPKCDCSGTGFRGNNCEQ---SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQP-TCQCTPEFTGFQCN-ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQ-EGFQGSRC-QERKECP-PNFCKNDGICSVINNGFTCDCTHTGYFGISCS 4441
            +CE   C N G C +   +K+ C C   + G+ C   + T C    C+N G+C    D   +C+C   G+ G  CEQ   + C+   C N G C +    P C C    + G+ CEK +  CS + C++RG C       +C+C    + G  C+ ++  C    C N G+C   D    +C+C   F G +C  E  C    C +     +S E   CSC   +EG  C+ +   C +  C  G  C+ +     C C    +EG  C I    C LEFC NG  C+ +   Y C C   GF+G  C  +  EC  PN C N G C+     + C C   G+ G  CS
Sbjct: 1253 ECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCM-DGYSGELCEQRDVNECNHYDC-NRGHCVMTVSGPACQCE-MGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCD-NNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCA-VGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCIN-GECTNTLGNYKCAC-RNGFIGPRCS 1594          

HSP 5 Score: 89.3521 bits (220), Expect = 3.749e-17
Identity = 103/350 (29.43%), Postives = 146/350 (41.71%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKL-GCNCSEGFTGEKCEK-IEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC---NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYY-GGVCQIRNGYP---YCDCQNTNYEGTRCN--IPKRCPLEFCSNGGNCQVRNGQ--YYCECQEGFQGSRCQERKECPPNF--CKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C    C N G C      ++  C C +GF+G  C+      C    C  G        +  C CS  G+ G+ C+     D   Q    CS + G     C        +C+  +P C+   C N G C   N    C C   GF+G  CE   + C  NFC+NG  C        C+C   F+G  C   ++++C+S++C N+G C  +     C C+  F+G  CE++       C     VC + NG      C+C  + + G  C     + C  E C NGG+C V +GQ  + C C   F G  C E  +C  N   CKN G C       TC C   G+ G +C
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQDNCSLHCLHGNCVKGTF-----GEETCQCS-EGWMGSLCDNLVTDDDTAQK---CSPQCGDDE-RCTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCAC-PPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECP-SGFMGADCKELQARPCDREPCLNGGHC-VDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPE-GFNGSNC 357          

HSP 6 Score: 77.0258 bits (188), Expect = 2.266e-13
Identity = 74/264 (28.03%), Postives = 107/264 (40.53%), Query Frame = 2
Query: 3785 CSESFCNNRGRCYVHNEQPI--CDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC-----------------------------------NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI-EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI--PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDG-ICSVIN---NGFTCDCTHTGYFGISCSE 4444
            CS + C N G C V++E  +  C+C   GF G  C+     S  C +G        + TCQC+  + G  C                                   NE  C+++ C N+GTC   N   +C+C   F G  CE  E  C  +FC  G  C+   G   C C    + G  C I   K+C  ++C N G C        C+C  GF G+ C+ + E     C+N   +CS++N       C+C  +G+ G  C E
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCEC-PKGFSGLLCQDNC--SLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLK-GFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECP-SGFMGADCKE 280          

HSP 7 Score: 56.9954 bits (136), Expect = 2.895e-7
Identity = 52/171 (30.41%), Postives = 63/171 (36.84%), Query Frame = 2
Query: 3998 RKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCE--IEKRCPSDFCYYGG----VCQIRNGY--PYCD-----------CQNTNYEGTRC------------NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDC 4408
            R CS N C N GTC +++E    QC C K F G  C+      C    C  G      CQ   G+    CD           C     +  RC            N P  C    C N G C   NG   C C  GF G  C+ +  EC  NFC+N   C  +   + C C
Sbjct:   20 RACSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQDNCSLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPS-CATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKC 189          
BLAST of Cell polarity protein vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 108.997 bits (271), Expect = 5.211e-23
Identity = 104/364 (28.57%), Postives = 150/364 (41.21%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC--EQSFCSDSFCQNNGICSIENGLP--VCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER--EIC-TSNFCKNGGLCV-PRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI-EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTG-LKNEYEKYG 4483
            P+ C    C+N   C  + + +  C+C  G+ G++CE +E  C    C NGG+C       KC C    F G  C  E   C+   C N G+C    G+    C CR                                      TGF G +CE   +IC T+N C+NG  C+  +  +  CQC P + G  C++    C+ + C  + TC       +C C   F G+RC I E  C S  C + G+C  +     C CQ   + G  C  NI   C    C N   C      Y CEC +G++G  CQ     C    C N+  C+ +   + CDCT  G+ G+ C   +    +N+ +K G
Sbjct: 2014 PIDCSAKMCENNAEC-SVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKM-FNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCR--------------------------------------TGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVH-GLCIDKLYSRQCLCQ-PGWTGENCDQNI-DECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCT-LGFDGVHCEMNIDECAENQCDKLG 2333          

HSP 2 Score: 99.3673 bits (246), Expect = 4.357e-20
Identity = 105/355 (29.58%), Postives = 150/355 (42.25%), Query Frame = 2
Query: 3431 RNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY--MYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDS--QPTCQCTPEFTGFQCN--ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK-RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGF-TCDCTHTGYFGISCSEKV 4450
            +N   C    C     C  L I+   C C  GF+G++C   E  C    C +G  C   +Y +Q  C     G+ G NC+Q+   C+ S CQN+  C  E    +C+C +  ++G  C+  +  C++  C+N   C        CDCT  GF G  CE  I  C  N C   G    RD+     C C P +TG +C+  + +C+ + C ND  C       +C C   + G +CE +   C +  C   G C       +C C      G  C + P RC  + C NGG C        C C   F G  C E K      C+N G C+    G   C+C+  G+ G  C   +
Sbjct: 2168 KNIDDCADSPCALNATCVDL-INDYKCECPTGFSGKRCHIKENLCASSPCVHG-LCIDKLYSRQCLCQ---PGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADG-YEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCT-LGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCP-PGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGC-EFKNTGCKTCENGGKCAEAAGGLQKCECS-PGFTGERCETNI 2512          

HSP 3 Score: 70.4774 bits (171), Expect = 2.274e-11
Identity = 81/310 (26.13%), Postives = 107/310 (34.52%), Query Frame = 2
Query: 3431 RNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE------------------------------------------QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKP--ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCY-ISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCN 4216
            +N  +C    CQN   C    I+   C C++G+ G  C+ +   C +  C N   C        CDC+  GF G +CE                                          Q  C+DS C N+  C    G   C C+ +   G  CE+    C+   C N G C        C C   G  G+ CE     C    C NGG C    S   C C   FTG  C  +      C N G C   +    +C C+  F G+RCE     C +  C  G  C  +     C C   N  G  C+
Sbjct: 2243 QNIDECAASPCQNDAKCID-EINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCT-LGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCK-SGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPP-GVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGCKTCENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCP-FNLTGVHCD 2547          

HSP 4 Score: 62.3882 bits (150), Expect = 7.476e-9
Identity = 58/190 (30.53%), Postives = 77/190 (40.53%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQS--FCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCY-VHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE 3997
            +C    C N   C  +      C C  G+TG KCE+   +C    CRN G C        C C   G  G NCE +   C    C N G C        C C  +   GK CE        C N G+C         C+C+  GF G++CE  I  C++  C +G  CV + +   C C    TG  C++
Sbjct: 2363 QCADSPCLNDAQCVDMG-GAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCP-PGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPAS-FTGKGCEFKNTGCKTCENGGKCAEAAGGLQKCECSP-GFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDK 2548          

HSP 5 Score: 59.6918 bits (143), Expect = 3.868e-8
Identity = 54/171 (31.58%), Postives = 71/171 (41.52%), Query Frame = 2
Query: 3959 QCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNG--QYYCECQEGFQGSRCQERKE--CPPNFCKNDGICSVINNG-FTCDCTHTGYFGISCSEKV 4450
            Q T E     C    CS+  C N+  C +   R QC C   + G RCE +E  C +  CY GG C+       C C    + G RC      C    C NGG C    G     C C+ GF G +C+E  +     N C+N   C     G F C C   G+ G +C + +
Sbjct: 2002 QTTGESLESSCFPIDCSAKMCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKM-FNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCV-PGWEGPNCDKNI 2170          
BLAST of Cell polarity protein vs. Ensembl Celegans
Match: glp-1 (pep chromosome:WBcel235:III:9092241:9099698:1 gene:WBGene00001609.1 transcript:F02A9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:glp-1)

HSP 1 Score: 102.449 bits (254), Expect = 3.584e-21
Identity = 108/355 (30.42%), Postives = 147/355 (41.41%), Query Frame = 2
Query: 3515 CSEGFTGEKCEKIEFT----CPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS--ESFCNNRGRCYVHNEQP-----ICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTC-YISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGV-CQIRNGYPYCDCQN-----------------TNYEGTRCNIPKR---------CPLEFCSNGGNC-QVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEK 4447
            C EG+ G  C+   F+    C  D C N G CY +    +C C+  G+ G+ CE+    C+ + C     C        CDC      G+ CE+  C+   + CN+ GRC  + ++      +CD    G    K + E      C N   C       TC C P + G  C E    C    C NDG C + SN+ P C C + F GQRCEIE  CPS F   GG+ C +    P+C   N                  +Y G RC I ++         C    C N   C  ++N  Y C C  GF G  C++   C P  C N G C  +N    C+C + G+ G  C  K
Sbjct:  101 CEEGYGGPDCKTPLFSGVNPCDSDPC-NNGLCYPFYGGFQCICN-NGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCP-IGKSGRYCERTECALMGNICNH-GRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIE--CPSGF---GGIHCDLPLQRPHCSRSNGTCYNDGRCINGFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLLCTPTTCANGGTCEGVNGVIRCNCPN-GFSGDYCEIK 445          

HSP 2 Score: 93.9745 bits (232), Expect = 1.546e-18
Identity = 116/388 (29.90%), Postives = 161/388 (41.49%), Query Frame = 2
Query: 3428 CRNPLKCEMGYCQ----NRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS--DSFCQNNGIC-----SIENGLPVCDCRNTQHKGKVCEK---PICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQ-PTCQCTPEFTGFQCNERKCSSNF--------------------CFNDGTCYISNERPQCSCTKNFEGQRCEIEKR---------CPSDFCYYGGVC-QIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ--ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSE 4444
            C+ PL   +  C     N GLCY        C C+ G+ G  CE+    C ++ C  G  C        CDC   G  G  CE++ C+   + C N+G C       +N   VCD   + ++G+ C K       E  C N   C+  +    C C   G+ G+ CE  I  C    C+N G C    +Q P C C   FTG +C E +C S F                    C+NDG C        C C  ++ G RCEI ++         C  + C     C  ++N    C C    + G  C     C    C+NGG C+  NG   C C  GF G  C+  +R+ C  + CKN G+C   N G+ C+C + GY G +C E
Sbjct:  110 CKTPLFSGVNPCDSDPCNNGLCYPF-YGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCP-IGKSGRYCERTECALMGNIC-NHGRCIPNRDEDKNFRCVCD---SGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKP-GYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRC-EIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCI----NGFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCP-LGFYGLNCEQHLLCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCK--NTGY-CECQY-GYTGPTCEE 480          
BLAST of Cell polarity protein vs. Ensembl Celegans
Match: lin-12 (pep chromosome:WBcel235:III:9060096:9071760:-1 gene:WBGene00003001.1 transcript:R107.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-12)

HSP 1 Score: 98.9821 bits (245), Expect = 4.160e-20
Identity = 107/358 (29.89%), Postives = 149/358 (41.62%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY---MYDKQPKCDCSGTGFRGNNCEQSF---CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRC-YVHNEQPICDCTATGFIGQKCERE-----------------ICTSN--FCKNGGLCVPRDSQPTCQCTPEFTGFQC-----------NERKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERK--ECPPNFCKNDGIC-SVINNGFTCDCTHTGYFGISCSEKV 4450
            C+C    TG  CEK++ +   D C N G C    + +K  +C C   G+ G  CEQ      S++ C NNG C    G   CDC      GK C++P+  C +  C N G C +  +  P+C C   GFIG++CE+E                 IC+     C NGG C+       C C P+FTG QC           +E  C S+ C N+ TC   +      C C + FEG  CE  K    D C                                     CSNGG C      + C+C  GF G+ C++ K   C  + C+N G+C +    G  C+C++ G+ G  C EK+
Sbjct:  311 CDCPPERTGPYCEKMDCSAIPDIC-NHGTCIDSPLSEKAFECQCE-PGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARG-FGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCK-NGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCL----SGFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHK----DLCLENP---------------------------------CSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSY-GFSGARCEEKI 622          

HSP 2 Score: 77.0258 bits (188), Expect = 2.017e-13
Identity = 105/368 (28.53%), Postives = 150/368 (40.76%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK--------CDCSG---------TGFRGNNCE-QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSE--SFCNNRGRCYVHNEQPICDCTATGFIGQKC-----------EREIC-----------TSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNC---QVRNGQYYCECQEGFQGSRC-QERKEC-PPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C C EGF GE CE+    C    C    +C ++DK  +        CD +G         +G+ G++C+ Q +C  S C N G C        C C +   KG+ CE  +  C E  + C NR  C       IC C   GF+   C           ++ +C            S +C+NGG C    S+  CQC P + G  C     E  C+SN C + G C   +   QC C   + G  C E +  C ++ C  G  C       +CDC      G  C       +    N G C    +    + C+C+ G++G  C Q++ EC   N C N+G C  +   F CDC   G+ G  C E +
Sbjct:   49 CRCDEGFGGEYCEQ---QCDVSKCGADEKC-VFDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKTQGWCYPSVCMNGGQCIGAGNRAKCACPDG-FKGERCELDVNECEENKNACGNRSTCMNTLGTYICVC-PQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKASSK--CQCPPGYHGSTCELLEKEDSCASNPC-SHGVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCP-PERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCAR-GFGGKWCDEPL 405          

HSP 3 Score: 63.1586 bits (152), Expect = 3.463e-9
Identity = 78/271 (28.78%), Postives = 102/271 (37.64%), Query Frame = 2
Query: 3461 CQNRGLCYQL-AIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQS---FCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQ--IRNGYPYCDCQNTN--YEGTRCNIPK--RCPLEF 4243
            C N   C  + A     C C +GF G+ CE+ +  C  + C NGG C+ + +   CDC   GF GN CEQ     C  S CQN G+C            N + KG+ CE                           + GF G +CE +I  + F +   L                    C +RKCS     NDG C        C     F+G  C   KR P   C YG +C     NG     C N    Y+G  C +P   RCP++ 
Sbjct:  512 CMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRESFSCDCP-PGFYGNGCEQEKMFRCLKSTCQNGGVCI-----------NEEEKGRKCE--------------------------CSYGFSGARCEEKINLTGFTEKDSL----------------LRSVCEKRKCSER--ANDGNCDADCNYAACK----FDGGDCS-GKREPFSKCRYGNMCADFFANGVCNQACNNEECLYDGMDC-LPAVVRCPVKI 720          
BLAST of Cell polarity protein vs. Ensembl Celegans
Match: F55H12.3 (pep chromosome:WBcel235:I:8876319:8893051:1 gene:WBGene00010134.1 transcript:F55H12.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F55H12.3)

HSP 1 Score: 90.5077 bits (223), Expect = 2.113e-17
Identity = 98/320 (30.63%), Postives = 137/320 (42.81%), Query Frame = 2
Query: 3458 YCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYD---------KQPKCDCSGTGFRGNNCEQSF---CSDSF-CQNNGICSIEN-GLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER--EICTSN--FCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNF--CFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDF-CYYGGVCQIRNGYPYCDCQNT----NYEGTRCNI--PKRCPLEFCSNGGNCQVRNGQYYCECQ-EGFQGSRCQ 4327
            YCQN   C+    +   C C+ GF+G+ C  +   C  + C NGG C +++         +   C C  TG+ G NCE      C+D   CQN G C + +    VC C + Q  G  CEK  CSE   ++ G     N    C+C   GF   +C+   ++C +N   C+N G C    +  +C C   F+G  C  NE  C +N   C N GTC  + +   C C  ++ G  C+ +    SD  C+ GG C   N    C    T     Y G  C I  P      +C N G C        C+C    F G RC+
Sbjct: 1673 YCQNSVKCFDTFTNYSRCQCAPGFSGDYCSDLIDDCFFEPCFNGGTCSIFNYNTTTKVSIESYNCTCQ-TGYFGTNCESRIHPSCTDLITCQNGGTCQLTSFDTAVCQCTD-QFYGIYCEKS-CSEQCVHSSGCKQSSNGTVFCEC-YDGFTSTRCDEVCDVCKANILLCQNSGTC--NSTTQSCDCIDYFSGTYCERNENLCETNLVVCKNGGTC--NPKTGLCVCLPDYTGDYCDNQIHSCSDINCFNGGTCIDYNATCACLPGTTGDRCQYLGQPCTIYLPNGTATPYCLNEGKCLDLPNGAACDCSGTNFIGRRCE 1984          

HSP 2 Score: 87.8113 bits (216), Expect = 1.396e-16
Identity = 101/342 (29.53%), Postives = 146/342 (42.69%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEF----TCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNN----------GICSIENGLPVCDCRNTQHKGKV----CEKPICS-ESFCNNRGRCYVHNE--QPICDCTATGFIGQKCEREICTSN--FCKNGGLCVPRDSQPT-CQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISN---------ERPQCSCTKNFEGQRCE--IEKRCPSDF-CYYGGVCQIRN-GYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPN--FCKNDGICSVINNGFTCDC 4408
            C C++ + G +C+  +F    T     C+NGGRC    +  +C  S TG        +FC  +  ++N          G+C  EN    C+C +   K  +        +CS  + C   G C  +      ICDCT++G++G  CE +    N  +C+N   C    +  + CQC P F+G  C++    C    CFN GTC I N         E   C+C   + G  CE  I   C     C  GG CQ+ +     C C +  Y G  C   K C  +   + G  Q  NG  +CEC +GF  +RC E    C  N   C+N G C+      +CDC
Sbjct: 1525 CICAQDWYGRQCDVSKFCFNGTNDNYICQNGGRCNKDLRLCECLSSFTG--------AFCETAIDESNCALDEKDCVFGLCRRENAQVYCNCYDGYMKDSLGNCTLAWDMCSLNNPCQQNGYCNFNQNIGDEICDCTSSGWLGDHCEIQPKLDNCLYCQNSVKCFDTFTNYSRCQCAPGFSGDYCSDLIDDCFFEPCFNGGTCSIFNYNTTTKVSIESYNCTCQTGYFGTNCESRIHPSCTDLITCQNGGTCQLTSFDTAVCQCTDQFY-GIYCE--KSCSEQCVHSSGCKQSSNGTVFCECYDGFTSTRCDEVCDVCKANILLCQNSGTCNSTTQ--SCDC 1853          

HSP 3 Score: 70.4774 bits (171), Expect = 2.556e-11
Identity = 79/292 (27.05%), Postives = 107/292 (36.64%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRN---TQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER--EICTSNF--CKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE---------IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNG 4255
            +P   ++  CQN G C   + D   C C++ F G  CEK                          CS      + C+QS                NG   C+C +   +    +VC+    +   C N G C    +   CDC    F G  CER   +C +N   CKNGG C P+     C C P++TG  C+ +   CS   CFN GTC   N    C+C     G RC+         +     + +C   G C        CDC  TN+ G RC            NG
Sbjct: 1753 HPSCTDLITCQNGGTCQLTSFDTAVCQCTDQFYGIYCEK-------------------------SCSEQCVHSSGCKQS---------------SNGTVFCECYDGFTSTRCDEVCDVCKANILLCQNSGTCNSTTQS--CDCIDY-FSGTYCERNENLCETNLVVCKNGGTCNPKTG--LCVCLPDYTGDYCDNQIHSCSDINCFNGGTCIDYNAT--CACLPGTTGDRCQYLGQPCTIYLPNGTATPYCLNEGKCLDLPNGAACDCSGTNFIGRRCETSSSFNFNLVFNG 1997          
BLAST of Cell polarity protein vs. Ensembl Fly
Match: crb (gene:FBgn0259685 transcript:FBtr0111008)

HSP 1 Score: 124.02 bits (310), Expect = 1.604e-27
Identity = 155/526 (29.47%), Postives = 207/526 (39.35%), Query Frame = 2
Query: 2897 IYIEFKTRYGGIIWHGYDM-------YNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLD--DNNWHRVVIML-NKKLRRIIVHVDKGYQPKV---------INLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGE----------FLISEDKFLSNKLSGAINTYPLNSLDCG-GCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPICSESFCNNRGRC-----YVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCE---IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRC-PLEFCSNGGNCQVRNG---QYYCECQEGFQGSRC 4324
            I I F+TR GG + +  ++        N GR  +T      KL  +H            + ++F+ +  D  W R+ +   N KL        KG++  V         I+ A  +S+  +  + Y GGMPE        Q R S       ++        GC+GE          F ++E    +N        + LN+     GC   + C    C+N G C Q   D+  C C  GF G+ C      C    C N G C        C C   GF G +CEQ+   C+D  C N G C+      VCDC    + G  C+   +  C    C N   C             C C   GF G  C+   C    C NGGLC+   + P C+C+  +TG  C +   +C SN C N G C     R +C C    FEG RCE    E     D+C   G C  + G   C CQ   Y G  CN    C   + CSNGG C    G    YYCEC EGF G  C
Sbjct: 1624 IDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITW-----KLSALH----------FGESARFEKENTDGEWSRIYLRAHNSKLEGGW----KGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPES------RQARGS------TLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGC---ILCFQSDCKNDGFC-QSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQ-PGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPE-DYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVP-GFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2110          

HSP 2 Score: 111.309 bits (277), Expect = 1.160e-23
Identity = 180/779 (23.11%), Postives = 291/779 (37.36%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISN-----------------ERP---------QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGIC-----SVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQ---VTVGFQTFMKTGTIYTFRTTDGR----YWSLKMDNGKLVIDING-NKYQ---TQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGAS-----------NEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTS--CPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRI-HGIFPMENSYGGYLVMNIIPPK----QTHKDETQFLLQA-------YTSNNPVIRFELNDEQFYEINMIDGKLIFLE---NGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGA 5527
            +P  C  G C+N    Y+       C C+ GFTG  C+     C    C NG  C+      +C C   G+ G NCE     C  + C N   C        C+C      G++C+  I  C    C N G+C        CDC+ TG+ G+ CE  I  C SN C NG  C+ R     C C   + G  C +   +C SN C  +G C   +                  +P         +C C     G+ CEI    C S+ C   G C    G   C+C+   +EGT C I    C        G C  +   Y C+C   + G  C    K C  N C N G C     + + + + C C   G+ G  C EK T L         ++      V T  ++   + + F+T +  G +  F TT  +     + L++ NG+L +  +  NK++     S +ND  ++ V +       +   L    E  +       +   ++ S+    +G +             +   F G +     NGK+IF        E+   I    +  + +  P +  C    C +NGEC  + +   C C    FFG  C+  +    F  EN+    +++          ++  D + F+          Y   +P      N    Y    + G  + ++   +G        GQ++DN   +L++ +R +  ++  +NG +      +  +S  G L  + + LG     +    GA
Sbjct:  696 HPKICGNGICKNEKGSYK-------CYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQ-PGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCI-PGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECE-PGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTC-ENGFQGDKC-EKTTTLS--------MVATSLISVTTEREEGYDINLQFRTTLPNG-VLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSKLNDSNWHKVFVAINTSHLV---LSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPD------EQDANISYTKLENVQSGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRP-FFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQKLDNGYNHLIEVVRNQTLVQVKLNGTEY----FRKTLSTTGLLDAQVLYLGGPAPTRESLLGA 1439          

HSP 3 Score: 86.2705 bits (212), Expect = 4.163e-16
Identity = 101/372 (27.15%), Postives = 142/372 (38.17%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFT-CPRDFCRNGGRCY---MYDKQPKCDCSGTGFRGNNCE-----QSFCSDSFCQNNGICSI--ENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE-RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI----EKRCPSDFCYYGGVCQIRNGYPYCDCQNTN------YEGTRCNIP-------------KRCPLEF----------------------------CSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGIC 4375
            C   G C   + +   C C+  ++G+ C+K   + C ++ C NGG C      D Q  CD       G +CE        C  + C NNG C +   +G   C+C    + G  CE     C+   C N G C        CDC+ TG+ G  C+  +  C  N C NGG C       TCQC   + G  C+    C +  C N GTC       QC C   + G+ C+I     ++CP D    GG C  + G    D +          + T C                KRC L+                             C NGG C + NG  +C C  G+ G RC++ + C P  C+   +C
Sbjct:  274 CMGHGTCSS-SPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKG-YAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSM-NGT-HCYCAVGYSGDRCEKAENCSPLNCQEPMVC 638          

HSP 4 Score: 85.1149 bits (209), Expect = 1.113e-15
Identity = 73/223 (32.74%), Postives = 92/223 (41.26%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE---ICTSNFCKNGGLCVPRD-SQPTCQCTPEFTGFQCNERK-----CSSNFCFNDGTCYI--SNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDC 4408
             C    C   G C    E   C CTA  + G+ C+++    C  N C+NGG C+        C C P  +G  C         C +N C N+G C +   +    C C K + G RCE++   C S  C   G C  R NG+  CDC  T Y G  C      C    C NGG C    G Y C+C +G+ G  C     C    C N G C     GF C C
Sbjct:  268 FCLNDPCMGHGTCSSSPEGYECRCTAR-YSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGF-SCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLC 488          

HSP 5 Score: 79.7221 bits (195), Expect = 4.374e-14
Identity = 71/233 (30.47%), Postives = 89/233 (38.20%), Query Frame = 2
Query: 3893 ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGG---------VCQIRNGY--PYCD-----------------CQN---------------TNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C  + CKN G C     +  C C P F G  C     +C +  C N+GTC        C C   FEGQ CE     C    C+ GG         VC     Y  P CD                 CQN                 +EG  C+IP  C +  C NGG C        C+C  G+ G  C Q+  EC  N C+N G C  +   + CDC  TG+ GI C   +
Sbjct: 1802 LCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIP-FCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDI 2033          

HSP 6 Score: 78.9518 bits (193), Expect = 8.422e-14
Identity = 61/163 (37.42%), Postives = 79/163 (48.47%), Query Frame = 2
Query: 4013 NFCFND-----GTCYISNERPQCSCTKNFEGQRCEIE--KRCPSDFCYYGGVC--QIRNGYP-YCDCQNTNYEGTRC----NIPKRCPLEFCSNGGNCQV--RNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            NFC ND     GTC  S E  +C CT  + G+ C+ +    C  + C  GG C    R  Y  +CD    N+ G  C    NI   C    C N G C V   +G   CEC +G+ G+RC+ +  EC    C+N+G C    NGF+CDC+ TGY G  C   V
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNV 426          

HSP 7 Score: 60.4622 bits (145), Expect = 3.294e-8
Identity = 53/159 (33.33%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVH-NEQP--ICDCTATGFIGQKCEREI 3895
            CE+  C N GLC       + C CS G+TG  CE+    C  + C+NGG+C     + +CDC GTGF G  CE           +C   G C  + G   C C+   + G  C    P  +   C+N GRC      +P   C+C   GF G+ C   I
Sbjct: 1959 CEITPCDNGGLCLTTGAVPM-CKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCEC-PEGFAGKNCTAPI 2114          
BLAST of Cell polarity protein vs. Ensembl Fly
Match: crb (gene:FBgn0259685 transcript:FBtr0334925)

HSP 1 Score: 124.02 bits (310), Expect = 1.720e-27
Identity = 155/526 (29.47%), Postives = 207/526 (39.35%), Query Frame = 2
Query: 2897 IYIEFKTRYGGIIWHGYDM-------YNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLD--DNNWHRVVIML-NKKLRRIIVHVDKGYQPKV---------INLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGE----------FLISEDKFLSNKLSGAINTYPLNSLDCG-GCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPICSESFCNNRGRC-----YVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCE---IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRC-PLEFCSNGGNCQVRNG---QYYCECQEGFQGSRC 4324
            I I F+TR GG + +  ++        N GR  +T      KL  +H            + ++F+ +  D  W R+ +   N KL        KG++  V         I+ A  +S+  +  + Y GGMPE        Q R S       ++        GC+GE          F ++E    +N        + LN+     GC   + C    C+N G C Q   D+  C C  GF G+ C      C    C N G C        C C   GF G +CEQ+   C+D  C N G C+      VCDC    + G  C+   +  C    C N   C             C C   GF G  C+   C    C NGGLC+   + P C+C+  +TG  C +   +C SN C N G C     R +C C    FEG RCE    E     D+C   G C  + G   C CQ   Y G  CN    C   + CSNGG C    G    YYCEC EGF G  C
Sbjct: 1638 IDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITW-----KLSALH----------FGESARFEKENTDGEWSRIYLRAHNSKLEGGW----KGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPES------RQARGS------TLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGC---ILCFQSDCKNDGFC-QSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQ-PGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPE-DYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVP-GFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2124          

HSP 2 Score: 104.375 bits (259), Expect = 1.364e-21
Identity = 172/759 (22.66%), Postives = 271/759 (35.70%), Query Frame = 2
Query: 3494 IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRD-----------------SQP---------TCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPY-----CDCQNTNYEGTRCNIP-KRCPLEFCSNGGNC-----QVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGR----YWSLKMDNGKLVIDING-NKYQ---TQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGAS-----------NEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTS--CPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRI-HGIFPMENSYGGYLVMNIIPPK----QTHKDETQFLLQA-------YTSNNPVIRFELNDEQFYEINMIDGKLIFLE---NGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGA 5527
            I+   C C  G+ GE CE     C  + C NG  C        C+C   G  G  C+     C    C N G C  + G   CDC  T ++G+ CE  I  C  + C N  +C    +   CDC   G+ G+ CE++I  C SN C+  G C+ R                  SQP          C C P   G  C  N  +C SN C   G C        C C   FEG  CEI      D C     CQ    Y       CDC + NY G  C++  K C    C NGG C           Y C C+ GFQG +C++                            T    +  +  ++      E Y                 + + F+T +  G +  F TT  +     + L++ NG+L +  +  NK++     S +ND  ++ V +       +   L    E  +       +   ++ S+    +G +             +   F G +     NGK+IF        E+   I    +  + +  P +  C    C +NGEC  + +   C C    FFG  C+  +    F  EN+    +++          ++  D + F+          Y   +P      N    Y    + G  + ++   +G        GQ++DN   +L++ +R +  ++  +NG +      +  +S  G L  + + LG     +    GA
Sbjct:  761 INAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCI-PGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDC-HNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINI----DECDRYNPCQRGTCYDQIDDYDCDC-DANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTCENGFQGDKCEK----------------------------TTTLSMVATSLISVTTEREEGY----------------DINLQFRTTLPNG-VLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSKLNDSNWHKVFVAINTSHLV---LSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPD------EQDANISYTKLENVQSGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRP-FFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQKLDNGYNHLIEVVRNQTLVQVKLNGTEY----FRKTLSTTGLLDAQVLYLGGPAPTRESLLGA 1453          

HSP 3 Score: 86.2705 bits (212), Expect = 4.768e-16
Identity = 101/372 (27.15%), Postives = 142/372 (38.17%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFT-CPRDFCRNGGRCY---MYDKQPKCDCSGTGFRGNNCE-----QSFCSDSFCQNNGICSI--ENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE-RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI----EKRCPSDFCYYGGVCQIRNGYPYCDCQNTN------YEGTRCNIP-------------KRCPLEF----------------------------CSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGIC 4375
            C   G C   + +   C C+  ++G+ C+K   + C ++ C NGG C      D Q  CD       G +CE        C  + C NNG C +   +G   C+C    + G  CE     C+   C N G C        CDC+ TG+ G  C+  +  C  N C NGG C       TCQC   + G  C+    C +  C N GTC       QC C   + G+ C+I     ++CP D    GG C  + G    D +          + T C                KRC L+                             C NGG C + NG  +C C  G+ G RC++ + C P  C+   +C
Sbjct:  274 CMGHGTCSS-SPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKG-YAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDMEPLTPLELDILDATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSM-NGT-HCYCAVGYSGDRCEKAENCSPLNCQEPMVC 638          

HSP 4 Score: 84.7297 bits (208), Expect = 1.222e-15
Identity = 73/223 (32.74%), Postives = 92/223 (41.26%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE---ICTSNFCKNGGLCVPRD-SQPTCQCTPEFTGFQCNERK-----CSSNFCFNDGTCYI--SNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDC 4408
             C    C   G C    E   C CTA  + G+ C+++    C  N C+NGG C+        C C P  +G  C         C +N C N+G C +   +    C C K + G RCE++   C S  C   G C  R NG+  CDC  T Y G  C      C    C NGG C    G Y C+C +G+ G  C     C    C N G C     GF C C
Sbjct:  268 FCLNDPCMGHGTCSSSPEGYECRCTAR-YSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGF-SCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLC 488          

HSP 5 Score: 79.7221 bits (195), Expect = 4.762e-14
Identity = 71/233 (30.47%), Postives = 89/233 (38.20%), Query Frame = 2
Query: 3893 ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGG---------VCQIRNGY--PYCD-----------------CQN---------------TNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C  + CKN G C     +  C C P F G  C     +C +  C N+GTC        C C   FEGQ CE     C    C+ GG         VC     Y  P CD                 CQN                 +EG  C+IP  C +  C NGG C        C+C  G+ G  C Q+  EC  N C+N G C  +   + CDC  TG+ GI C   +
Sbjct: 1816 LCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIP-FCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDI 2047          

HSP 6 Score: 78.5666 bits (192), Expect = 9.248e-14
Identity = 61/163 (37.42%), Postives = 79/163 (48.47%), Query Frame = 2
Query: 4013 NFCFND-----GTCYISNERPQCSCTKNFEGQRCEIE--KRCPSDFCYYGGVC--QIRNGYP-YCDCQNTNYEGTRC----NIPKRCPLEFCSNGGNCQV--RNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            NFC ND     GTC  S E  +C CT  + G+ C+ +    C  + C  GG C    R  Y  +CD    N+ G  C    NI   C    C N G C V   +G   CEC +G+ G+RC+ +  EC    C+N+G C    NGF+CDC+ TGY G  C   V
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNV 426          

HSP 7 Score: 60.077 bits (144), Expect = 3.677e-8
Identity = 53/159 (33.33%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVH-NEQP--ICDCTATGFIGQKCEREI 3895
            CE+  C N GLC       + C CS G+TG  CE+    C  + C+NGG+C     + +CDC GTGF G  CE           +C   G C  + G   C C+   + G  C    P  +   C+N GRC      +P   C+C   GF G+ C   I
Sbjct: 1973 CEITPCDNGGLCLTTGAVPM-CKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCEC-PEGFAGKNCTAPI 2128          
BLAST of Cell polarity protein vs. Ensembl Fly
Match: crb (gene:FBgn0259685 transcript:FBtr0304726)

HSP 1 Score: 123.635 bits (309), Expect = 2.466e-27
Identity = 155/526 (29.47%), Postives = 207/526 (39.35%), Query Frame = 2
Query: 2897 IYIEFKTRYGGIIWHGYDM-------YNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLD--DNNWHRVVIML-NKKLRRIIVHVDKGYQPKV---------INLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGE----------FLISEDKFLSNKLSGAINTYPLNSLDCG-GCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPICSESFCNNRGRC-----YVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCE---IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRC-PLEFCSNGGNCQVRNG---QYYCECQEGFQGSRC 4324
            I I F+TR GG + +  ++        N GR  +T      KL  +H            + ++F+ +  D  W R+ +   N KL        KG++  V         I+ A  +S+  +  + Y GGMPE        Q R S       ++        GC+GE          F ++E    +N        + LN+     GC   + C    C+N G C Q   D+  C C  GF G+ C      C    C N G C        C C   GF G +CEQ+   C+D  C N G C+      VCDC    + G  C+   +  C    C N   C             C C   GF G  C+   C    C NGGLC+   + P C+C+  +TG  C +   +C SN C N G C     R +C C    FEG RCE    E     D+C   G C  + G   C CQ   Y G  CN    C   + CSNGG C    G    YYCEC EGF G  C
Sbjct: 1688 IDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITW-----KLSALH----------FGESARFEKENTDGEWSRIYLRAHNSKLEGGW----KGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPES------RQARGS------TLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGC---ILCFQSDCKNDGFC-QSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQ-PGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPE-DYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVP-GFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2174          

HSP 2 Score: 110.153 bits (274), Expect = 2.556e-23
Identity = 180/779 (23.11%), Postives = 291/779 (37.36%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISN-----------------ERP---------QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGIC-----SVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQ---VTVGFQTFMKTGTIYTFRTTDGR----YWSLKMDNGKLVIDING-NKYQ---TQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGAS-----------NEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTS--CPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRI-HGIFPMENSYGGYLVMNIIPPK----QTHKDETQFLLQA-------YTSNNPVIRFELNDEQFYEINMIDGKLIFLE---NGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGA 5527
            +P  C  G C+N    Y+       C C+ GFTG  C+     C    C NG  C+      +C C   G+ G NCE     C  + C N   C        C+C      G++C+  I  C    C N G+C        CDC+ TG+ G+ CE  I  C SN C NG  C+ R     C C   + G  C +   +C SN C  +G C   +                  +P         +C C     G+ CEI    C S+ C   G C    G   C+C+   +EGT C I    C        G C  +   Y C+C   + G  C    K C  N C N G C     + + + + C C   G+ G  C EK T L         ++      V T  ++   + + F+T +  G +  F TT  +     + L++ NG+L +  +  NK++     S +ND  ++ V +       +   L    E  +       +   ++ S+    +G +             +   F G +     NGK+IF        E+   I    +  + +  P +  C    C +NGEC  + +   C C    FFG  C+  +    F  EN+    +++          ++  D + F+          Y   +P      N    Y    + G  + ++   +G        GQ++DN   +L++ +R +  ++  +NG +      +  +S  G L  + + LG     +    GA
Sbjct:  760 HPKICGNGICKNEKGSYK-------CYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQ-PGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCI-PGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECE-PGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTC-ENGFQGDKC-EKTTTLS--------MVATSLISVTTEREEGYDINLQFRTTLPNG-VLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSKLNDSNWHKVFVAINTSHLV---LSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPD------EQDANISYTKLENVQSGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRP-FFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQKLDNGYNHLIEVVRNQTLVQVKLNGTEY----FRKTLSTTGLLDAQVLYLGGPAPTRESLLGA 1503          

HSP 3 Score: 84.3445 bits (207), Expect = 1.579e-15
Identity = 73/223 (32.74%), Postives = 92/223 (41.26%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE---ICTSNFCKNGGLCVPRD-SQPTCQCTPEFTGFQCNERK-----CSSNFCFNDGTCYI--SNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDC 4408
             C    C   G C    E   C CTA  + G+ C+++    C  N C+NGG C+        C C P  +G  C         C +N C N+G C +   +    C C K + G RCE++   C S  C   G C  R NG+  CDC  T Y G  C      C    C NGG C    G Y C+C +G+ G  C     C    C N G C     GF C C
Sbjct:  268 FCLNDPCMGHGTCSSSPEGYECRCTAR-YSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGF-SCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLC 488          

HSP 4 Score: 79.7221 bits (195), Expect = 3.942e-14
Identity = 77/255 (30.20%), Postives = 107/255 (41.96%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFT-CPRDFCRNGGRCY---MYDKQPKCDCSGTGFRGNNCE-----QSFCSDSFCQNNGICSI--ENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE-RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI----EKRCPSDFCYYGGVCQIRNG 4165
            C   G C   + +   C C+  ++G+ C+K   + C ++ C NGG C      D Q  CD       G +CE        C  + C NNG C +   +G   C+C    + G  CE     C+   C N G C        CDC+ TG+ G  C+  +  C  N C NGG C       TCQC   + G  C+    C +  C N GTC       QC C   + G+ C+I     ++CP D    GG C  + G
Sbjct:  274 CMGHGTCSS-SPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKG-YAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPG 523          

HSP 5 Score: 78.9518 bits (193), Expect = 7.096e-14
Identity = 71/233 (30.47%), Postives = 89/233 (38.20%), Query Frame = 2
Query: 3893 ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGG---------VCQIRNGY--PYCD-----------------CQN---------------TNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C  + CKN G C     +  C C P F G  C     +C +  C N+GTC        C C   FEGQ CE     C    C+ GG         VC     Y  P CD                 CQN                 +EG  C+IP  C +  C NGG C        C+C  G+ G  C Q+  EC  N C+N G C  +   + CDC  TG+ GI C   +
Sbjct: 1866 LCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIP-FCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDI 2097          

HSP 6 Score: 78.5666 bits (192), Expect = 1.089e-13
Identity = 61/163 (37.42%), Postives = 79/163 (48.47%), Query Frame = 2
Query: 4013 NFCFND-----GTCYISNERPQCSCTKNFEGQRCEIE--KRCPSDFCYYGGVC--QIRNGYP-YCDCQNTNYEGTRC----NIPKRCPLEFCSNGGNCQV--RNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            NFC ND     GTC  S E  +C CT  + G+ C+ +    C  + C  GG C    R  Y  +CD    N+ G  C    NI   C    C N G C V   +G   CEC +G+ G+RC+ +  EC    C+N+G C    NGF+CDC+ TGY G  C   V
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNV 426          

HSP 7 Score: 70.4774 bits (171), Expect = 3.002e-11
Identity = 64/212 (30.19%), Postives = 89/212 (41.98%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCE---KIEFTCPRDFCRNGGRCYMY--DKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI-CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTC 4039
            N   C    C+N G C + +     C C    +G+ CE    I   C  + C N G C +        C+C   G+ G  CE     C+   CQNNG C        CDC  T + G  C+  +  C ++ C N GRC+       C C   G+ G+ C+R + C +  C NGG C+ +     C C PE+TG  C      +  C  D  C
Sbjct:  304 NGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECP-KGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCL-DGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSEC 513          

HSP 8 Score: 68.5514 bits (166), Expect = 1.094e-10
Identity = 70/242 (28.93%), Postives = 103/242 (42.56%), Query Frame = 2
Query: 3668 SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEK---PICSESFCNNRGRCYVHNE---QPICDCTATGFIGQKCEREI-----CTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKEC 4342
            +FC +  C  +G CS       C C   ++ GK C+K     C+++ C N G C  ++    Q  CD       GQ CE E+     C +N C N G CV        TC+C   + G +C  +  +C+S  C N+G+C        C C+   + G  C+     C  + C  GG C    G+  C C +  + G  C+ P  C  + C NGG C  +   + C C   + G  CQ    C
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRC-TARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLD-GWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSC 503          

HSP 9 Score: 60.077 bits (144), Expect = 4.010e-8
Identity = 53/159 (33.33%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVH-NEQP--ICDCTATGFIGQKCEREI 3895
            CE+  C N GLC       + C CS G+TG  CE+    C  + C+NGG+C     + +CDC GTGF G  CE           +C   G C  + G   C C+   + G  C    P  +   C+N GRC      +P   C+C   GF G+ C   I
Sbjct: 2023 CEITPCDNGGLCLTTGAVPM-CKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCEC-PEGFAGKNCTAPI 2178          
BLAST of Cell polarity protein vs. Ensembl Fly
Match: crb (gene:FBgn0259685 transcript:FBtr0084603)

HSP 1 Score: 123.25 bits (308), Expect = 2.531e-27
Identity = 155/526 (29.47%), Postives = 207/526 (39.35%), Query Frame = 2
Query: 2897 IYIEFKTRYGGIIWHGYDM-------YNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLD--DNNWHRVVIML-NKKLRRIIVHVDKGYQPKV---------INLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGE----------FLISEDKFLSNKLSGAINTYPLNSLDCG-GCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPICSESFCNNRGRC-----YVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCE---IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRC-PLEFCSNGGNCQVRNG---QYYCECQEGFQGSRC 4324
            I I F+TR GG + +  ++        N GR  +T      KL  +H            + ++F+ +  D  W R+ +   N KL        KG++  V         I+ A  +S+  +  + Y GGMPE        Q R S       ++        GC+GE          F ++E    +N        + LN+     GC   + C    C+N G C Q   D+  C C  GF G+ C      C    C N G C        C C   GF G +CEQ+   C+D  C N G C+      VCDC    + G  C+   +  C    C N   C             C C   GF G  C+   C    C NGGLC+   + P C+C+  +TG  C +   +C SN C N G C     R +C C    FEG RCE    E     D+C   G C  + G   C CQ   Y G  CN    C   + CSNGG C    G    YYCEC EGF G  C
Sbjct: 1581 IDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITW-----KLSALH----------FGESARFEKENTDGEWSRIYLRAHNSKLEGGW----KGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPES------RQARGS------TLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGC---ILCFQSDCKNDGFC-QSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQ-PGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPE-DYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVP-GFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCECPEGFAGKNC 2067          

HSP 2 Score: 110.153 bits (274), Expect = 2.520e-23
Identity = 180/779 (23.11%), Postives = 291/779 (37.36%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISN-----------------ERP---------QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGIC-----SVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQ---VTVGFQTFMKTGTIYTFRTTDGR----YWSLKMDNGKLVIDING-NKYQ---TQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGAS-----------NEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTS--CPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRI-HGIFPMENSYGGYLVMNIIPPK----QTHKDETQFLLQA-------YTSNNPVIRFELNDEQFYEINMIDGKLIFLE---NGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGA 5527
            +P  C  G C+N    Y+       C C+ GFTG  C+     C    C NG  C+      +C C   G+ G NCE     C  + C N   C        C+C      G++C+  I  C    C N G+C        CDC+ TG+ G+ CE  I  C SN C NG  C+ R     C C   + G  C +   +C SN C  +G C   +                  +P         +C C     G+ CEI    C S+ C   G C    G   C+C+   +EGT C I    C        G C  +   Y C+C   + G  C    K C  N C N G C     + + + + C C   G+ G  C EK T L         ++      V T  ++   + + F+T +  G +  F TT  +     + L++ NG+L +  +  NK++     S +ND  ++ V +       +   L    E  +       +   ++ S+    +G +             +   F G +     NGK+IF        E+   I    +  + +  P +  C    C +NGEC  + +   C C    FFG  C+  +    F  EN+    +++          ++  D + F+          Y   +P      N    Y    + G  + ++   +G        GQ++DN   +L++ +R +  ++  +NG +      +  +S  G L  + + LG     +    GA
Sbjct:  653 HPKICGNGICKNEKGSYK-------CYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQ-PGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCI-PGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCNDGIGTYTCECE-PGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINEVTHLYNCTC-ENGFQGDKC-EKTTTLS--------MVATSLISVTTEREEGYDINLQFRTTLPNG-VLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSKLNDSNWHKVFVAINTSHLV---LSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPD------EQDANISYTKLENVQSGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRP-FFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQKLDNGYNHLIEVVRNQTLVQVKLNGTEY----FRKTLSTTGLLDAQVLYLGGPAPTRESLLGA 1396          

HSP 3 Score: 100.138 bits (248), Expect = 3.037e-20
Identity = 99/329 (30.09%), Postives = 140/329 (42.55%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFT-CPRDFCRNGGRCY---MYDKQPKCDCSGTGFRGNNCE-----QSFCSDSFCQNNGICSI--ENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE-RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI----EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTR--CNIPKRCPLE--FCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGIC 4375
            C   G C   + +   C C+  ++G+ C+K   + C ++ C NGG C      D Q  CD       G +CE        C  + C NNG C +   +G   C+C    + G  CE     C+   C N G C        CDC+ TG+ G  C+  +  C  N C NGG C       TCQC   + G  C+    C +  C N GTC       QC C   + G+ C+I     ++CP D    GG C  + G    +CQ +  +G       P  C      C NGG C + NG  +C C  G+ G RC++ + C P  C+   +C
Sbjct:  274 CMGHGTCSS-SPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKG-YAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSM-NGT-HCYCAVGYSGDRCEKAENCSPLNCQEPMVC 595          

HSP 4 Score: 94.7449 bits (234), Expect = 1.402e-18
Identity = 108/394 (27.41%), Postives = 148/394 (37.56%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCE---KIEFTCPRDFCRNGGRCYMY--DKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI-CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE--------------IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC---------------------------NIPKRCPLEFCSNGGNC-QVRNGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            N   C    C+N G C + +     C C    +G+ CE    I   C  + C N G C +        C+C   G+ G  CE     C+   CQNNG C        CDC  T + G  C+  +  C ++ C N GRC+       C C   G+ G+ C+R + C +  C NGG C+ +     C C PE+TG  C      +  C  D  C       +C C     G  C+              I     +  C  GG C +   + YC      Y G RC                            +  +C  + C NGG C  + NG Y C+C  G+ G  C  +  EC   P  C N GIC      + C CT  G+ G+ C   V
Sbjct:  304 NGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECP-KGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQC-LDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGG----KCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGTHCYC---AVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGN-GICKNEKGSYKCYCT-PGFTGVHCDSDV 686          

HSP 5 Score: 87.4261 bits (215), Expect = 1.851e-16
Identity = 111/410 (27.07%), Postives = 149/410 (36.34%), Query Frame = 2
Query: 3428 CRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCE---KIEFTCPRDF------------------------------------------CRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF-CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCY-VHNEQPICDCTATGFIGQKCEREI--CT--SNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE---------------------------------------KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGIC 4375
            C  P+ C+   C N G C    I    C C   +TGE C+        CP D                                           C NGG C M      C     G+ G+ CE++  CS   CQ   +C ++N    C C     + KVC +  C+   C N G C  + N    C CT  G+ G+ C  ++  CT     C N G+C        C CTP FTG  C+    +C S  C N  TC+      +C C   +EG+ CE++                                         C  D C  GG C  + G   CDC  T YEG  C +    C    C+NG  C  R   Y+C+C  G++G  C Q+  EC  N C+ +G C
Sbjct:  460 CDRPMTCQTQQCLNGGTCLDKPI-GFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSGYNCQTSTGDGASALALTPINCNATNGKCLNGGTCSMNGTHCYC---AVGYSGDRCEKAENCSPLNCQEPMVC-VQN---QCLCP----ENKVCNQ--CATQPCQNGGECVDLPNGDYECKCT-RGWTGRTCGNDVDECTLHPKICGN-GICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCIPGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNC 853          

HSP 6 Score: 84.3445 bits (207), Expect = 1.673e-15
Identity = 73/223 (32.74%), Postives = 92/223 (41.26%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE---ICTSNFCKNGGLCVPRD-SQPTCQCTPEFTGFQCNERK-----CSSNFCFNDGTCYI--SNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDC 4408
             C    C   G C    E   C CTA  + G+ C+++    C  N C+NGG C+        C C P  +G  C         C +N C N+G C +   +    C C K + G RCE++   C S  C   G C  R NG+  CDC  T Y G  C      C    C NGG C    G Y C+C +G+ G  C     C    C N G C     GF C C
Sbjct:  268 FCLNDPCMGHGTCSSSPEGYECRCTAR-YSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGF-SCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLC 488          

HSP 7 Score: 78.9518 bits (193), Expect = 6.688e-14
Identity = 71/233 (30.47%), Postives = 89/233 (38.20%), Query Frame = 2
Query: 3893 ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGG---------VCQIRNGY--PYCD-----------------CQN---------------TNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C  + CKN G C     +  C C P F G  C     +C +  C N+GTC        C C   FEGQ CE     C    C+ GG         VC     Y  P CD                 CQN                 +EG  C+IP  C +  C NGG C        C+C  G+ G  C Q+  EC  N C+N G C  +   + CDC  TG+ GI C   +
Sbjct: 1759 LCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTCTCVPGFEGPLCDIP-FCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDI 1990          

HSP 8 Score: 78.1814 bits (191), Expect = 1.174e-13
Identity = 61/163 (37.42%), Postives = 79/163 (48.47%), Query Frame = 2
Query: 4013 NFCFND-----GTCYISNERPQCSCTKNFEGQRCEIE--KRCPSDFCYYGGVC--QIRNGYP-YCDCQNTNYEGTRC----NIPKRCPLEFCSNGGNCQV--RNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            NFC ND     GTC  S E  +C CT  + G+ C+ +    C  + C  GG C    R  Y  +CD    N+ G  C    NI   C    C N G C V   +G   CEC +G+ G+RC+ +  EC    C+N+G C    NGF+CDC+ TGY G  C   V
Sbjct:  267 NFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQKDNGSPCAKNPCENGGSCLENSRGDYQCFCD---PNHSGQHCETEVNIHPLCQTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAFCQTNV 426          

HSP 9 Score: 60.077 bits (144), Expect = 4.227e-8
Identity = 53/159 (33.33%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVH-NEQP--ICDCTATGFIGQKCEREI 3895
            CE+  C N GLC       + C CS G+TG  CE+    C  + C+NGG+C     + +CDC GTGF G  CE           +C   G C  + G   C C+   + G  C    P  +   C+N GRC      +P   C+C   GF G+ C   I
Sbjct: 1916 CEITPCDNGGLCLTTGAVPM-CKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYCGGLGRCFNKPGSFQCICQKP-YCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCEC-PEGFAGKNCTAPI 2071          
BLAST of Cell polarity protein vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334611)

HSP 1 Score: 120.553 bits (301), Expect = 1.563e-26
Identity = 135/605 (22.31%), Postives = 243/605 (40.17%), Query Frame = 2
Query:  818 YDTKSSQQKRT---INFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKV--LKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFV----GPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRD-RNHKFTAKFENVEVDI---GDQSGHQREFGSYTYIGGID---NPSRLPWYVWS---REGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQT-FRSNSDLYFSVKLVGGYVVVETNINDKD-NIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNV 2569
            YD +  ++++      F G  +L Y+       P  + +  + F F     +GLL+Y+  G +   + L+D  +              I  ++  +       + +H++ +HR   + S  ++    +  V  +  + + I G+  ++ ++  +YVGG  N R     R+ T F G ++ V  S +     +LI++ +  S +  V    E         D              P TFT  +  +   PW+  +  SI  +FRTKEP G+++       P   +   + +E  + ++Y+   +     + + + +   V  G++H + ++R+ R+ K +   + V  D    GD  G   E   + Y+GG+    N    P  +W+   R+GFVGC+  + V   K ID            A V     +    H  A+ C G  C +            CDCSA    Y  P    E   +          +G+    +   +     +  KT T+++ I FKT +P   +  T   SNS     + LV G V     ++D++ N+   Q+       LNDN WH I   RRA ++ + VD  
Sbjct:  341 YDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIVSAQDAISFYFRTRQPNGLLFYTGHGTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRF-----DDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTML-SSSRVYVGGAVNPRALLGARVHTNFVGCLRKVEFSADTLN-LNLIDLAKSGSKLIQVAGNLEYQCPSGDPQD--------------PVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRR--RVDDGDWHDLILRRNGRDAKVS--VDGVWNDFRTPGD--GTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDL-VLSGKAID--------IAAFARVQDSASVKPSCHVQANVCNGNPCLNGGTCLEGWNRPICDCSAT--LYGGPTCGRELATLAF--------NGSQHMTIWLGN----GQGTKTQTEELVIRFKTSRPAGLLLLTSAESNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSV------LNDNNWHTIRFSRRASNLRLQVDGA 889          

HSP 2 Score: 78.9518 bits (193), Expect = 6.894e-14
Identity = 140/661 (21.18%), Postives = 247/661 (37.37%), Query Frame = 2
Query:  848 TINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEE--IYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAI---IVGRVPLIPANGHIYVGG--HENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPF---TFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGN-FHTIFIKR--DRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGI--DNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHT-----------DDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKD----NIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEK----FVGSIRNFYWNQFDFL 2728
            T+ FNG  ++     N     ++ EEL ++FK S      LL  +E             RL  A +  +     +++  E+  +    +L+ N +H +   R +      SNL L ++        +   I+GR   +     +++GG  H    I     +   F G ++ +  +G+ +              + IVK+ G   ++   S  +  T  ++ S    P+   TF      V  +        SI+ +F+T EP G+L+F G      D+V +E  + +++  F  D  D    M  K       N +H + I+R   + H  T   ++ E+     +    E     YIGG+  D  S+LP  + SR GF GC+  + + +             S  ++G +             + C    C +R         + C+C   S T                        G + Y      E   +K M  +T           D+IA+ F T +PDA + +   + +  Y  +++V G + +  NI   D     IGTK         +NDN +H +  +R+  +  + +D+ N Q +   P   +   F NT   + VG      G+ +    F G I     N+   L
Sbjct:  784 TLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAESN--------SPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRA------SNLRLQVDGAPPVRGMLSETILGRHSTMEIRS-VHLGGLFHAEEEIQMTSTMPN-FVGQMQGLVFNGQRY--------------LDIVKSLGP-ELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNG--GRRNDFVAVELVNGHIHYTF--DLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTVD-DSFEIISLTGNNMHLELAGILYIGGVFKDMYSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVVPSSLVVSGCE-----------GPTKCSQNACANRGNCVQQWNAYACECDMTSYT------------------------GPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVESATTQDYMELEIVEGNIFMVYNIGSVDLPLGEIGTK---------VNDNAYHVVRFQRKGGNATLQLDDYNVQAL--TPQSHHSTVF-NTMSNVQVGGKFSRNGRNRIERPFAGVIAGLSVNKLRIL 1361          
BLAST of Cell polarity protein vs. Ensembl Zebrafish
Match: crb1 (crumbs cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-050208-382])

HSP 1 Score: 140.969 bits (354), Expect = 1.240e-32
Identity = 181/693 (26.12%), Postives = 271/693 (39.11%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLG--CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQC--TPEFTGFQCN--ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVC---------------------QIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCEC----QEG--FQGSRCQERKE-CPPNFCKNDGIC----SVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGT-TSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGE-RGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNG---KYIFEQIKTGQGERKGTIEIILVPTIIN-----RPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRC-EKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIF----LENGKFPRLISDGQR 5341
            C  G+C +   C  +     G  C C EG+TG  CEK    C  + CRN   C      P C C   GF+G  CE     C    C+N   C  + G  +C CR   + G  CE  I  C    C +   C+ H     C C A GF G+ CE  I  C    C+NG LCV   +   C C  T  FTG  C      C S  C N   C    E   C+C   FEG+ CE++   C S+ C   G+C                     ++ +G+  C C    + G  C      C    C NG  C+   G Y C C    Q+G  + G  C E    C  + C+N   C    S   +G++C C   GY G  C    T     +E     ++  +P +G  T   +T+ F+T ++   ++  R + G   SL++    L++D+   K   Q N       +  +  +GE   +  +LG    T L+       G QN  +  ++ IGA   E  +    +GG +  G    +I          +    E  L  + +N          C  G C N+GEC+ +     CKC    + GQ C E+ I   F  ++S   Y V  I     +        L+    +  ++    +   + ++ +  GKL      L+     R+++DG+R
Sbjct:  121 CAQGHCGDSAHCLAVRDQSPGYACICQEGYTGRSCEKEVDHCSPNPCRNRAICRSRRNGPTCFCV-PGFQGQLCEIEVNECVSRPCRNGATCVDKIGHYICLCR-PGYMGSSCELEIDECQSQPCLHGASCHDHINGFTCTCLA-GFQGESCEINIDECRDQPCQNGALCVDEINSYRCDCSQTANFTGVDCEIPPPPCWSQPCLNSALCENQQENYTCNCWPGFEGRNCEVDVSECESNPCVNEGICMELSWKTLYGTEPLFTARYNPRLASGF-ICKCP-PGFSGALCEQNTTACTTSPCHNGATCEDFLGSYKCICPSESQDGVLYGGRNCSEPLTGCEGHECQNGASCIPFLSEGVHGYSCIC-QPGYTGSYCQ---TLTVFSFETSRAFLHLQTPLLGAETYFNITLSFRTVLENTVLFQ-RGSGGVTLSLEIQETHLILDL---KTDPQPNATSWTLMLPQVVSDGEWHTVEAVLG--EGTLLLQLLEPCQGGQNCGTTAQVKIGALELESALLSTFVGGLDEGGSSRSFIGCMRDLLVDSQLMIPEDWLSSSAVNVVQGCSHHDRCLSGPCENHGECVNLWQGYQCKCLRP-YVGQNCDEEYITARFAQQDST-SYAVFTINDEPDSETLHLSMFLRTRKDSGLLVLLANSTSDYLQMWLEKGKLTVQVNNLKTVTGERVLNDGER 796          

HSP 2 Score: 103.219 bits (256), Expect = 4.267e-21
Identity = 104/380 (27.37%), Postives = 142/380 (37.37%), Query Frame = 2
Query: 3548 KIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTG--FRGNNCEQS--FCSDSFCQNNG------------ICSIENGLPVCDCRNTQ-------------------------------HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDC-QNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVIN--------------------NGFTCDCTHTGYFGISCSEKVTG 4456
            K    C  + C++   C        C C  T   F    C+ S  FC  S CQ N             +C  ++GL   DC ++                                + G+ CEK +  CS + C NR  C      P C C   GF GQ CE E+  C S  C+NG  CV +     C C P + G  C     +C S  C +  +C+       C+C   F+G+ CEI    C    C  G +C        CDC Q  N+ G  C I P  C  + C N   C+ +   Y C C  GF+G  C+ +  EC  N C N+GIC  ++                    +GF C C   G+ G  C +  T 
Sbjct:   34 KTSTLCLDNPCQHQSECREALSDFLCQCQTTVPVFPSTRCDSSSTFCQLSICQGNVTCQPTGAHPGELVCQCDSGLLGQDCLSSAQLCAQGHCGDSAHCLAVRDQSPGYACICQEGYTGRSCEKEVDHCSPNPCRNRAICRSRRNGPTCFCVP-GFQGQLCEIEVNECVSRPCRNGATCVDKIGHYICLCRPGYMGSSCELEIDECQSQPCLHGASCHDHINGFTCTCLAGFQGESCEINIDECRDQPCQNGALCVDEINSYRCDCSQTANFTGVDCEIPPPPCWSQPCLNSALCENQQENYTCNCWPGFEGRNCEVDVSECESNPCVNEGICMELSWKTLYGTEPLFTARYNPRLASGFICKCP-PGFSGALCEQNTTA 411          

HSP 3 Score: 71.633 bits (174), Expect = 1.568e-11
Identity = 108/424 (25.47%), Postives = 168/424 (39.62%), Query Frame = 2
Query: 2897 IYIEFKTR-YGGIIWHGYDMYNSGRNYMTLMLIDNKLIL--VHHINEVKSVNIIEDGSQFQLDDNNWHRVVIML----NKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFY--FGGMPEDLFTNVFTQLR------VSLPYLAE-KVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE 4108
            I    +TR    I+ H      SG  ++T+ L D  L+L  +       S++ +   S   + D  WH + +++    +     I+V +D+  +P   + ++  ++D  +   Y   GG+  D  +N+   L       + LPY  + +V  P T             E+ F  NK+S      P+ +    GC   + CE   C + G+C     +   C C  G+ G+ CE    TC  + CR+G  C + D    C C   G+ G NCE     C+   C N   C     +  C C + +  G     P+C+           V N  P    +  G   Q        +  C NGG C   D+   C C P F+G  C     +C SN C N G C     R QC C   F G+ CE++
Sbjct:  979 IVFNIRTRKRNAIVLHA----ESGSEFVTVSLQDGFLVLELLSGPTTSSSLSPVTLHSPRVVADGEWHVIELLMATPGSNSSHWIMVPLDEKDEPTKSD-SMTGNLDFLRESVYIMLGGLGPDSGSNLIGCLSNVEIGGIVLPYYGQTEVRFPRT------------QEEMF--NKIS----EEPVQT----GCFGEVVCEPNPCLHGGICDD-HFNLFHCFCLPGWGGDHCELNTNTCASNPCRHG-YCSVQDLTYNCTCE-DGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTD-KFTG-----PLCNIQIEEVPWYVVVRNIPPKLPVSICGDEQQ--------NYTCFNGGNC--SDTNMPCDCHPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMTFAGETCEVD 1356          

HSP 4 Score: 68.1662 bits (165), Expect = 1.510e-10
Identity = 69/230 (30.00%), Postives = 94/230 (40.87%), Query Frame = 2
Query: 3830 NEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI--------------PKRCPLEFCS---------NGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +E+P+     TG  G+     +C  N C +GG+C    +   C C P + G  C  N   C+SN C   G C + +    C+C   + G  CE++   C    C  G  C        C C +  + G  CNI              P + P+  C          NGGNC   N    C+C  GF G  C+ E  EC  N CKN G C  + N F C C  T + G +C
Sbjct: 1137 SEEPV----QTGCFGEV----VCEPNPCLHGGICDDHFNLFHCFCLPGWGGDHCELNTNTCASNPC-RHGYCSVQDLTYNCTCEDGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTD-KFTGPLCNIQIEEVPWYVVVRNIPPKLPVSICGDEQQNYTCFNGGNCSDTN--MPCDCHPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMT-FAGETC 1353          
BLAST of Cell polarity protein vs. Ensembl Zebrafish
Match: crb1 (crumbs cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-050208-382])

HSP 1 Score: 140.969 bits (354), Expect = 1.240e-32
Identity = 181/693 (26.12%), Postives = 271/693 (39.11%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLG--CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQC--TPEFTGFQCN--ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVC---------------------QIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCEC----QEG--FQGSRCQERKE-CPPNFCKNDGIC----SVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGT-TSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGE-RGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNG---KYIFEQIKTGQGERKGTIEIILVPTIIN-----RPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRC-EKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIF----LENGKFPRLISDGQR 5341
            C  G+C +   C  +     G  C C EG+TG  CEK    C  + CRN   C      P C C   GF+G  CE     C    C+N   C  + G  +C CR   + G  CE  I  C    C +   C+ H     C C A GF G+ CE  I  C    C+NG LCV   +   C C  T  FTG  C      C S  C N   C    E   C+C   FEG+ CE++   C S+ C   G+C                     ++ +G+  C C    + G  C      C    C NG  C+   G Y C C    Q+G  + G  C E    C  + C+N   C    S   +G++C C   GY G  C    T     +E     ++  +P +G  T   +T+ F+T ++   ++  R + G   SL++    L++D+   K   Q N       +  +  +GE   +  +LG    T L+       G QN  +  ++ IGA   E  +    +GG +  G    +I          +    E  L  + +N          C  G C N+GEC+ +     CKC    + GQ C E+ I   F  ++S   Y V  I     +        L+    +  ++    +   + ++ +  GKL      L+     R+++DG+R
Sbjct:  121 CAQGHCGDSAHCLAVRDQSPGYACICQEGYTGRSCEKEVDHCSPNPCRNRAICRSRRNGPTCFCV-PGFQGQLCEIEVNECVSRPCRNGATCVDKIGHYICLCR-PGYMGSSCELEIDECQSQPCLHGASCHDHINGFTCTCLA-GFQGESCEINIDECRDQPCQNGALCVDEINSYRCDCSQTANFTGVDCEIPPPPCWSQPCLNSALCENQQENYTCNCWPGFEGRNCEVDVSECESNPCVNEGICMELSWKTLYGTEPLFTARYNPRLASGF-ICKCP-PGFSGALCEQNTTACTTSPCHNGATCEDFLGSYKCICPSESQDGVLYGGRNCSEPLTGCEGHECQNGASCIPFLSEGVHGYSCIC-QPGYTGSYCQ---TLTVFSFETSRAFLHLQTPLLGAETYFNITLSFRTVLENTVLFQ-RGSGGVTLSLEIQETHLILDL---KTDPQPNATSWTLMLPQVVSDGEWHTVEAVLG--EGTLLLQLLEPCQGGQNCGTTAQVKIGALELESALLSTFVGGLDEGGSSRSFIGCMRDLLVDSQLMIPEDWLSSSAVNVVQGCSHHDRCLSGPCENHGECVNLWQGYQCKCLRP-YVGQNCDEEYITARFAQQDST-SYAVFTINDEPDSETLHLSMFLRTRKDSGLLVLLANSTSDYLQMWLEKGKLTVQVNNLKTVTGERVLNDGER 796          

HSP 2 Score: 103.219 bits (256), Expect = 4.267e-21
Identity = 104/380 (27.37%), Postives = 142/380 (37.37%), Query Frame = 2
Query: 3548 KIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTG--FRGNNCEQS--FCSDSFCQNNG------------ICSIENGLPVCDCRNTQ-------------------------------HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDC-QNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVIN--------------------NGFTCDCTHTGYFGISCSEKVTG 4456
            K    C  + C++   C        C C  T   F    C+ S  FC  S CQ N             +C  ++GL   DC ++                                + G+ CEK +  CS + C NR  C      P C C   GF GQ CE E+  C S  C+NG  CV +     C C P + G  C     +C S  C +  +C+       C+C   F+G+ CEI    C    C  G +C        CDC Q  N+ G  C I P  C  + C N   C+ +   Y C C  GF+G  C+ +  EC  N C N+GIC  ++                    +GF C C   G+ G  C +  T 
Sbjct:   34 KTSTLCLDNPCQHQSECREALSDFLCQCQTTVPVFPSTRCDSSSTFCQLSICQGNVTCQPTGAHPGELVCQCDSGLLGQDCLSSAQLCAQGHCGDSAHCLAVRDQSPGYACICQEGYTGRSCEKEVDHCSPNPCRNRAICRSRRNGPTCFCVP-GFQGQLCEIEVNECVSRPCRNGATCVDKIGHYICLCRPGYMGSSCELEIDECQSQPCLHGASCHDHINGFTCTCLAGFQGESCEINIDECRDQPCQNGALCVDEINSYRCDCSQTANFTGVDCEIPPPPCWSQPCLNSALCENQQENYTCNCWPGFEGRNCEVDVSECESNPCVNEGICMELSWKTLYGTEPLFTARYNPRLASGFICKCP-PGFSGALCEQNTTA 411          

HSP 3 Score: 71.633 bits (174), Expect = 1.568e-11
Identity = 108/424 (25.47%), Postives = 168/424 (39.62%), Query Frame = 2
Query: 2897 IYIEFKTR-YGGIIWHGYDMYNSGRNYMTLMLIDNKLIL--VHHINEVKSVNIIEDGSQFQLDDNNWHRVVIML----NKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFY--FGGMPEDLFTNVFTQLR------VSLPYLAE-KVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE 4108
            I    +TR    I+ H      SG  ++T+ L D  L+L  +       S++ +   S   + D  WH + +++    +     I+V +D+  +P   + ++  ++D  +   Y   GG+  D  +N+   L       + LPY  + +V  P T             E+ F  NK+S      P+ +    GC   + CE   C + G+C     +   C C  G+ G+ CE    TC  + CR+G  C + D    C C   G+ G NCE     C+   C N   C     +  C C + +  G     P+C+           V N  P    +  G   Q        +  C NGG C   D+   C C P F+G  C     +C SN C N G C     R QC C   F G+ CE++
Sbjct:  979 IVFNIRTRKRNAIVLHA----ESGSEFVTVSLQDGFLVLELLSGPTTSSSLSPVTLHSPRVVADGEWHVIELLMATPGSNSSHWIMVPLDEKDEPTKSD-SMTGNLDFLRESVYIMLGGLGPDSGSNLIGCLSNVEIGGIVLPYYGQTEVRFPRT------------QEEMF--NKIS----EEPVQT----GCFGEVVCEPNPCLHGGICDD-HFNLFHCFCLPGWGGDHCELNTNTCASNPCRHG-YCSVQDLTYNCTCE-DGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTD-KFTG-----PLCNIQIEEVPWYVVVRNIPPKLPVSICGDEQQ--------NYTCFNGGNC--SDTNMPCDCHPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMTFAGETCEVD 1356          

HSP 4 Score: 68.1662 bits (165), Expect = 1.510e-10
Identity = 69/230 (30.00%), Postives = 94/230 (40.87%), Query Frame = 2
Query: 3830 NEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI--------------PKRCPLEFCS---------NGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +E+P+     TG  G+     +C  N C +GG+C    +   C C P + G  C  N   C+SN C   G C + +    C+C   + G  CE++   C    C  G  C        C C +  + G  CNI              P + P+  C          NGGNC   N    C+C  GF G  C+ E  EC  N CKN G C  + N F C C  T + G +C
Sbjct: 1137 SEEPV----QTGCFGEV----VCEPNPCLHGGICDDHFNLFHCFCLPGWGGDHCELNTNTCASNPC-RHGYCSVQDLTYNCTCEDGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTD-KFTGPLCNIQIEEVPWYVVVRNIPPKLPVSICGDEQQNYTCFNGGNCSDTN--MPCDCHPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMT-FAGETC 1353          
BLAST of Cell polarity protein vs. Ensembl Zebrafish
Match: crb1 (crumbs cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-050208-382])

HSP 1 Score: 140.584 bits (353), Expect = 1.541e-32
Identity = 181/693 (26.12%), Postives = 271/693 (39.11%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLG--CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQC--TPEFTGFQCN--ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVC---------------------QIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCEC----QEG--FQGSRCQER-KECPPNFCKNDGIC----SVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGT-TSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGE-RGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNG---KYIFEQIKTGQGERKGTIEIILVPTIIN-----RPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRC-EKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIF----LENGKFPRLISDGQR 5341
            C  G+C +   C  +     G  C C EG+TG  CEK    C  + CRN   C      P C C   GF+G  CE     C    C+N   C  + G  +C CR   + G  CE  I  C    C +   C+ H     C C A GF G+ CE  I  C    C+NG LCV   +   C C  T  FTG  C      C S  C N   C    E   C+C   FEG+ CE++   C S+ C   G+C                     ++ +G+  C C    + G  C      C    C NG  C+   G Y C C    Q+G  + G  C E    C  + C+N   C    S   +G++C C   GY G  C    T     +E     ++  +P +G  T   +T+ F+T ++   ++  R + G   SL++    L++D+   K   Q N       +  +  +GE   +  +LG    T L+       G QN  +  ++ IGA   E  +    +GG +  G    +I          +    E  L  + +N          C  G C N+GEC+ +     CKC    + GQ C E+ I   F  ++S   Y V  I     +        L+    +  ++    +   + ++ +  GKL      L+     R+++DG+R
Sbjct:  118 CAQGHCGDSAHCLAVRDQSPGYACICQEGYTGRSCEKEVDHCSPNPCRNRAICRSRRNGPTCFCV-PGFQGQLCEIEVNECVSRPCRNGATCVDKIGHYICLCR-PGYMGSSCELEIDECQSQPCLHGASCHDHINGFTCTCLA-GFQGESCEINIDECRDQPCQNGALCVDEINSYRCDCSQTANFTGVDCEIPPPPCWSQPCLNSALCENQQENYTCNCWPGFEGRNCEVDVSECESNPCVNEGICMELSWKTLYGTEPLFTARYNPRLASGF-ICKCP-PGFSGALCEQNTTACTTSPCHNGATCEDFLGSYKCICPSESQDGVLYGGRNCSEPLTGCEGHECQNGASCIPFLSEGVHGYSCIC-QPGYTGSYCQ---TLTVFSFETSRAFLHLQTPLLGAETYFNITLSFRTVLENTVLFQ-RGSGGVTLSLEIQETHLILDL---KTDPQPNATSWTLMLPQVVSDGEWHTVEAVLG--EGTLLLQLLEPCQGGQNCGTTAQVKIGALELESALLSTFVGGLDEGGSSRSFIGCMRDLLVDSQLMIPEDWLSSSAVNVVQGCSHHDRCLSGPCENHGECVNLWQGYQCKCLRP-YVGQNCDEEYITARFAQQDST-SYAVFTINDEPDSETLHLSMFLRTRKDSGLLVLLANSTSDYLQMWLEKGKLTVQVNNLKTVTGERVLNDGER 793          

HSP 2 Score: 102.449 bits (254), Expect = 5.993e-21
Identity = 104/380 (27.37%), Postives = 142/380 (37.37%), Query Frame = 2
Query: 3548 KIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTG--FRGNNCEQS--FCSDSFCQNNG------------ICSIENGLPVCDCRNTQ-------------------------------HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDC-QNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVIN--------------------NGFTCDCTHTGYFGISCSEKVTG 4456
            K    C  + C++   C        C C  T   F    C+ S  FC  S CQ N             +C  ++GL   DC ++                                + G+ CEK +  CS + C NR  C      P C C   GF GQ CE E+  C S  C+NG  CV +     C C P + G  C     +C S  C +  +C+       C+C   F+G+ CEI    C    C  G +C        CDC Q  N+ G  C I P  C  + C N   C+ +   Y C C  GF+G  C+ +  EC  N C N+GIC  ++                    +GF C C   G+ G  C +  T 
Sbjct:   31 KTSTLCLDNPCQHQSECREALSDFLCQCQTTVPVFPSTRCDSSSTFCQLSICQGNVTCQPTGAHPGELVCQCDSGLLGQDCLSSAQLCAQGHCGDSAHCLAVRDQSPGYACICQEGYTGRSCEKEVDHCSPNPCRNRAICRSRRNGPTCFCVP-GFQGQLCEIEVNECVSRPCRNGATCVDKIGHYICLCRPGYMGSSCELEIDECQSQPCLHGASCHDHINGFTCTCLAGFQGESCEINIDECRDQPCQNGALCVDEINSYRCDCSQTANFTGVDCEIPPPPCWSQPCLNSALCENQQENYTCNCWPGFEGRNCEVDVSECESNPCVNEGICMELSWKTLYGTEPLFTARYNPRLASGFICKCP-PGFSGALCEQNTTA 408          

HSP 3 Score: 78.5666 bits (192), Expect = 1.104e-13
Identity = 106/424 (25.00%), Postives = 166/424 (39.15%), Query Frame = 2
Query: 2897 IYIEFKTR-YGGIIWHGYDMYNSGRNYMTLMLIDNKLIL--VHHINEVKSVNIIEDGSQFQLDDNNWHRVVIML----NKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFY--FGGMPEDLFTNVFTQLR------VSLPYLAE-KVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE 4108
            I    +TR    I+ H      SG  ++T+ L D  L+L  +       S++ +   S   + D  WH + +++    +     I+V +D+  +P   + ++  ++D  +   Y   GG+  D  +N+   L       + LPY  + +V  P T             E+ F  NK+S      P+ +    GC   + CE   C + G+C     +   C C  G+ G+ CE    TC  + CR+G  C + D    C C   G+ G NCE     C+   C N   C     +  C C + +  G +C+ P    S C +  + Y                             C NGG C   D+   C C P F+G  C     +C SN C N G C     R QC C   F G+ CE++
Sbjct:  976 IVFNIRTRKRNAIVLHA----ESGSEFVTVSLQDGFLVLELLSGPTTSSSLSPVTLHSPRVVADGEWHVIELLMATPGSNSSHWIMVPLDEKDEPTKSD-SMTGNLDFLRESVYIMLGGLGPDSGSNLIGCLSNVEIGGIVLPYYGQTEVRFPRT------------QEEMF--NKIS----EEPVQT----GCFGEVVCEPNPCLHGGICDD-HFNLFHCFCLPGWGGDHCELNTNTCASNPCRHG-YCSVQDLTYNCTCE-DGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTD-KFTGPLCKPPKLPVSICGDEQQNYT----------------------------CFNGGNC--SDTNMPCDCHPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMTFAGETCEVD 1338          

HSP 4 Score: 70.0922 bits (170), Expect = 4.996e-11
Identity = 68/216 (31.48%), Postives = 92/216 (42.59%), Query Frame = 2
Query: 3830 NEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCS---------NGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +E+P+     TG  G+     +C  N C +GG+C    +   C C P + G  C  N   C+SN C   G C + +    C+C   + G  CE++   C    C  G  C        C C +  + G  C  PK  P+  C          NGGNC   N    C+C  GF G  C+ E  EC  N CKN G C  + N F C C  T + G +C
Sbjct: 1134 SEEPV----QTGCFGEV----VCEPNPCLHGGICDDHFNLFHCFCLPGWGGDHCELNTNTCASNPC-RHGYCSVQDLTYNCTCEDGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTD-KFTGPLCKPPKL-PVSICGDEQQNYTCFNGGNCSDTN--MPCDCHPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMT-FAGETC 1335          

HSP 5 Score: 54.299 bits (129), Expect = 3.028e-6
Identity = 60/196 (30.61%), Postives = 81/196 (41.33%), Query Frame = 2
Query: 3674 CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNF---------CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI 4219
            C  + C + GIC     L  C C      G  CE     C+ + C + G C V +    C C   G+ G  CE ++  C  + C NG  C+   +  +C CT +FTG  C   K   +          CFN G C  S+    C C   F G  CE+E   C S+ C  GG CQ       C C+ T + G  C +
Sbjct: 1148 CEPNPCLHGGICDDHFNLFHCFCL-PGWGGDHCELNTNTCASNPCRH-GYCSVQDLTYNCTC-EDGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTDKFTGPLCKPPKLPVSICGDEQQNYTCFNGGNC--SDTNMPCDCHPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMT-FAGETCEV 1337          

HSP 6 Score: 53.9138 bits (128), Expect = 3.675e-6
Identity = 59/196 (30.10%), Postives = 79/196 (40.31%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFC---------YYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ 4327
            +C  + C + G C  H     C C   G+ G  CE     C SN C++G  C  +D    C C   +TG  C  +   C+ + C N  TC        C CT  F G  C+  K  P   C         + GG C   N  P CDC +  + G  C +    C    C NGG CQ    ++ C C+  F G  C+
Sbjct: 1147 VCEPNPCLHGGICDDHFNLFHCFCLP-GWGGDHCELNTNTCASNPCRHG-YCSVQDLTYNCTCEDGYTGTNCEMKVDACAGHRCANGATCLRGFNMYSCLCTDKFTGPLCKPPKL-PVSICGDEQQNYTCFNGGNCSDTN-MP-CDC-HPGFSGHWCELELDECRSNPCKNGGYCQNMVNRFQCVCEMTFAGETCE 1336          
BLAST of Cell polarity protein vs. Ensembl Zebrafish
Match: notch1a (notch receptor 1a [Source:NCBI gene;Acc:30718])

HSP 1 Score: 132.109 bits (331), Expect = 6.209e-30
Identity = 118/364 (32.42%), Postives = 162/364 (44.51%), Query Frame = 2
Query: 3428 CRNPLK-CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLE----------FCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C N L  C    C+N G+C +        CNC  G+ G+ CE     C R+ C NGG C       +C C+  GF G  CE     C  + C N G+C       VC C     +G+ C + I  C  + C N G C        C C A GF G  CE     CT + C NGG CV   S  +C C P FTG  C     +C S  C N G+C       +C+C   + G  C+ + + C S  C  GG C  +     C C  + + G  C++P   C +            C + G C      + C CQ G+ GS CQE+  EC PN C+N   C+    G++C+C   GY G++CS+++
Sbjct:   42 CENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQCRCN-PGFTGALCENDIDDCEPNPCSNGGVCQDRVNGFVCVCL-AGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCPA-GFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSCQDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCWQQGASFTCQCA-SGWTGIYCDVPSVSCEVAARQQGVSVAVLCRHAGQCVDAGNTHLCRCQAGYTGSYCQEQVDECQPNPCQNGATCTDYLGGYSCECV-PGYHGMNCSKEI 400          

HSP 2 Score: 100.138 bits (248), Expect = 3.951e-20
Identity = 100/352 (28.41%), Postives = 143/352 (40.62%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDF--------CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGG--NCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINN---GFTCDCTHTGYFGISC 4438
            +C+   CQN G C Q       C C  G+TG  C+ +   C    C+NGG C+       C C+ +G+ G  C+                    +P   C          ++ +     C + G+C       +C C A G+ G  C+ ++  C  N C+NG  C       +C+C P + G  C++   +C S  C N GTC       +CSC +  +G  CEI+   C            C+ GG C  R G   C C    + G RC      C  + C   G  NC      + CEC+ G+ G RC+     C    CKN G C+V +N   G+ C C   GY G SC
Sbjct:  240 ECDSRPCQNGGSC-QDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCWQQGASFTCQCA-SGWTGIYCD--------------------VPSVSCEVAAR-----QQGVSVAVLCRHAGQCVDAGNTHLCRCQA-GYTGSYCQEQVDECQPNPCQNGATCTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCP-AGFVGERCEGDVNECLSDPCDPSGSYNCVQLINDFRCECRTGYTGKRCETVFNGCKDTPCKNGGTCAVASNTKHGYICKC-QPGYSGSSC 561          

HSP 3 Score: 86.6557 bits (213), Expect = 4.907e-16
Identity = 72/198 (36.36%), Postives = 92/198 (46.46%), Query Frame = 2
Query: 3872 GQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQ--CSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            G  C+  I  C SN C N G C+   +   C C   +TG  C      CS   C N G C  S +     C+C   ++GQ CE++   C  + C  GGVC+   G   C C N  + G  C N    C    CSNGG CQ R   + C C  GF+G RC E   EC    C+N G C+   N +TC C   G+ GI+C
Sbjct:    1 GPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQCRC-NPGFTGALCENDIDDCEPNPCSNGGVCQDRVNGFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTDCVNSYTCSCP-AGFSGINC 196          

HSP 4 Score: 83.5741 bits (205), Expect = 3.315e-15
Identity = 91/329 (27.66%), Postives = 126/329 (38.30%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDC-RNTQHKGKVCE----------KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI------------------------------------------CTSNFCKNGGLCVPRDSQP---TCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE--IEKRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIPKRCPLEFCSNGG 4258
            C++ G C       L C C  G+TG  C++    C  + C+NG  C  Y     C+C   G+ G NC +    C    CQN G C        C C R TQ  G  CE           P+  E  C N GRC        C C A GF+G++CE ++                                          C    CKNGG C    +      C+C P ++G  C  + + C S  C N  TC   +  P+C C   F G  C+  ++  C  + CY GG CQ  +  P+  C    N+ G  C+I     L++  +GG
Sbjct:  332 CRHAGQCVDAGNTHL-CRCQAGYTGSYCQEQVDECQPNPCQNGATCTDYLGGYSCECV-PGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQ--GVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCPA-GFVGERCEGDVNECLSDPCDPSGSYNCVQLINDFRCECRTGYTGKRCETVFNGCKDTPCKNGGTCAVASNTKHGYICKCQPGYSGSSCEYDSQSCGSLRCRNGATCVSGHLSPRCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLCHI-----LDYSFSGG 650          
BLAST of Cell polarity protein vs. Ensembl Zebrafish
Match: notch1b (notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415-183])

HSP 1 Score: 132.494 bits (332), Expect = 6.354e-30
Identity = 121/395 (30.63%), Postives = 164/395 (41.52%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-GTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQN-------------------------------------TNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C    C N+G C    +    CNC   +TGE CE +   C    C+NGG C   +      C    G++G  CE     C  + C+N+ IC    G   C C+   + G+ CE  I  C  + C+N G C        C C   GF G +CE +I  C SN CKNG  C    +  TC C P F+G  C  N   C+ + CFN GTC        C C K F G  C+ +   C S  C  GG CQ   G   C C                                       T + G  C++P   C +            C N G C      +YC CQ G+ GS C+E+  EC PN C+N   C+    G++C+C   GY G++CS+++
Sbjct:  745 ECASNPCLNQGTCID-DVAGYKCNCLLPYTGENCETLLAPCGSKPCKNGGVCKESEDYESFSCVCPAGWQGQTCEVDINECVKNPCRNDAICQNSIGSYKCSCK-AGYTGRNCETDIDDCKPNPCSNGGFCKDAVNAFACTCLP-GFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTCQDSYGTYKCTCPQGYHGLNCQELVNWCKPSPCKNGGICRQSGTRYSCQCQTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECV-PGYHGVNCSDEI 1135          

HSP 2 Score: 117.857 bits (294), Expect = 1.698e-25
Identity = 115/354 (32.49%), Postives = 152/354 (42.94%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSD--SFCQNNGICSIENGLPVCDCRNTQHKGKVCEK--PICSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G C   +I    C C  G++G+ C++ +  C  + C NGG+C  +D    C C+   F G  C+Q    C+   S C+N G+C    G   C+C   ++ GK CE     C+ S C + G C    E    C C   GF GQ CE  I  C  + C NGG CV   +   CQC PE+TG  C    NE     N C N GTC  +     C C   + G  C E    C    C+ G  C  R     C+C +    G  C++   C    C  G NC     NG+  C C  G+ G  C Q+  EC    N C++ G C      F C C   GY G  C   +
Sbjct:   57 CLGAPCRNGGTCELTSIHNYRCKCPPGWSGKTCQQAD-PCASNPCANGGQCSPFDSDFLCHCTPY-FSGQTCKQDVNECAQIPSPCKNGGVCENGVGTYHCNCP-AEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECSCLP-GFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGDDCSENIDDCADAACHTGATCHDRVASFLCECPH-GRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSLGANPCEHAGKCINTKGSFQCKCLQ-GYVGARCELDI 404          

HSP 3 Score: 103.99 bits (258), Expect = 2.804e-21
Identity = 111/351 (31.62%), Postives = 151/351 (43.02%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY----MYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C + G C Q       C+C  GF+G+ CE+    CP   C NGG C      Y+ Q K + +G  F   +  +     + CQN G C    G   C C N    G  C + I  C+++ C+    C+      +C+C   G  G  C   + C SN C+ G  C   P + +  C C   + G  C++   +CS  +N C + G C  +    QC C + + G RCE++   C S  C     C  + G  +C C    YEG  C I    C    C N G C  +   Y CEC  GF GS+CQ +  EC    CKN   C    N +TC CT  GY G  C   V
Sbjct:  173 CNPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQ-FCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGW-TGDDCSENIDDCADAACHTGATCHDRVASFLCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSLGANPCEHAGKCINTKGSFQCKCLQGYVGARCELDINECLSTPCQNDATCLDQIGGFHCICM-PGYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDGPNMYTCQCTE-GYTGQHCETDV 518          

HSP 4 Score: 103.219 bits (256), Expect = 5.177e-21
Identity = 111/362 (30.66%), Postives = 147/362 (40.61%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ--SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS------------ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLK 4462
            N   C    C N G C    I+   C C +GFTG  C+     C    C NGG C       KC C   G+ G NC++  ++C  S C+N GIC        C C+ T   G  C+ P  S               C N G+C        C C A G+ G  CE ++  C  N C+NG  C       +C+C P + G  C++   +C S  C N GTC       +CSC +  +G  CEI                I +  P+ D     +E      PK      C N G C  R G Y+C C  G+ G RC+ +  EC  N C     C  + N + C+C  TGY G  C +   G K
Sbjct:  934 NTPDCTESSCFNGGTCVD-GINSFTCLCPKGFTGNYCQHDINECDSRPCMNGGTCQDSYGTYKCTCP-QGYHGLNCQELVNWCKPSPCKNGGICRQSGTRYSCQCQ-TGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQA-GYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEI---------------NIDDCTPFTD--PITHE------PK------CFNQGRCVDRVGGYHCICPPGYVGERCEGDVNECLSNPCGTHS-CIQLKNNYRCEC-RTGYTGQHCDKVFDGCK 1260          

HSP 5 Score: 101.293 bits (251), Expect = 1.919e-20
Identity = 112/381 (29.40%), Postives = 148/381 (38.85%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGIC------------------SIENGLPVC---DCRN------------------TQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C  G+C+++       ++   C C  G++G  C+     C  + C NGG C        C C   GF G NC+ +   C+ + C N G C                  + E  L  C    C+N                     +G+ CE  I  C ++ C N   C        C C A G+ G+ CE +I  C  N C NGG C    +   C C P F G +C E   +C SN C N   C        C+C   F G  CE     C    C+ GG C        C C    + G  C      C    C NGG CQ   G Y C C +G+ G  CQE    C P+ CKN GIC      ++C C  TG+ G+ C
Sbjct:  676 CIHGHCEDK-------VNGYNCICDSGWSGVNCDINNNECESNPCMNGGTCKDMTSGYVCTCR-AGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLAPCGSKPCKNGGVCKESEDYESFSCVCPAGWQGQTCEVDINECVKNPCRNDAICQNSIGSYKCSCKA-GYTGRNCETDIDDCKPNPCSNGGFCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVNSYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPK-GFTGNYCQHDINECDSRPCMNGGTCQDSYGTYKCTCPQGYHGLNCQELVNWCKPSPCKNGGICRQSGTRYSCQC-QTGWTGLYC 1045          

HSP 6 Score: 92.8189 bits (229), Expect = 5.659e-18
Identity = 117/371 (31.54%), Postives = 160/371 (43.13%), Query Frame = 2
Query: 3368 SNKLSG-AINTYPLNSLDCGGCRNPLKCEMGY--CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +N ++G AI T PL  +     ++  +C +G   C++ G C         C C +G+ G +CE     C    C+N   C        C C   G+ G  C+     C+   C NNG C  +     C+C  T   G  C+  I  C+ + C N  +C        C CT  G+ GQ CE ++  C SN C  G  C    +  TC C   F G  C  N  +C S  C N GTC        C C K   G  CEI    C S+ C +G      NGY  C C+   Y G  CNI    C +  C NGG C      + C C+EG+  + CQ +  EC  N C + G C    NG+ C C  +G+ G++C
Sbjct:  340 TNPVNGKAICTCPLGYVGPACDQDVDECSLGANPCEHAGKCINTK-GSFQCKCLQGYVGARCELDINECLSTPCQNDATCLDQIGGFHCICM-PGYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECP-TGFSGSQCQFDIDECASTPCKNGAKCMDGPNMYTCQCTE-GYTGQHCETDVDECLSNPCHYG-TCKDGLASFTCVCRAGFMGRLCEININECLSQPCQNGGTCQDRENAYLCVCPKGTAGANCEINLDDCQSNPCDFGRCIDKINGY-ECACE-PGYTGKMCNINIDECAINPCHNGGTCVDGVNGFTCLCREGYHDTTCQSQLNECLSNPCIH-GHCEDKVNGYNCICD-SGWSGVNC 701          

HSP 7 Score: 92.0485 bits (227), Expect = 1.195e-17
Identity = 93/281 (33.10%), Postives = 128/281 (45.55%), Query Frame = 2
Query: 3674 CSDSFCQNNGICSIENGLP----VCDCRNTQHKGKVCEKP---ICSESFCNNRGRC---YVHNEQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  S C+N G+C +         VC+C +  +  ++C  P   +C  + C N G C    +HN +  C C   G+ G+ C++ + C SN C NGG C P DS   C CTP F+G  C    NE     + C N G C        C+C   + G+ CE + + C    C +GG C  +    Y C C    + G  C  NI   CP   C NGG C      Y C+C+  + G  C E   EC   PN C+N G C     G+ C C + G+ G  CSE +
Sbjct:   14 CFQSPCRNGGVCRLITSANKVDFVCNC-SLGYTDRLCLTPTNNVCLGAPCRNGGTCELTSIHNYR--CKCPP-GWSGKTCQQADPCASNPCANGGQCSPFDSDFLCHCTPYFSGQTCKQDVNECAQIPSPCKNGGVCENGVGTYHCNCPAEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECSCL-PGFSGQNCEENI-DDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVN-GWTGDDCSENI 287          

HSP 8 Score: 87.0409 bits (214), Expect = 3.616e-16
Identity = 104/340 (30.59%), Postives = 140/340 (41.18%), Query Frame = 2
Query: 3527 FTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK----CDCSGTGFRGNNC---EQSFCSDSFCQNNGIC---SIENGLPVCDCRNTQHKGKVCEKP-ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTS--NFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERP-QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEK 4477
            + G  C+     C +  CRNGG C +     K    C+CS  G+    C     + C  + C+N G C   SI N    C C      GK C++   C+ + C N G+C   +   +C CT   F GQ C++++  C    + CKNGG+C        C C  E+TG  C    + C+ + C + GTC    E   +CSC   F GQ CE     CP   C  GG C        C C+   + G  C      C L    C NGG C    G Y C C  G+ G  C E   +C    C     C      F C+C H G  G+ C      + N  +K
Sbjct:    3 YAGPACQ-FRNPCFQSPCRNGGVCRLITSANKVDFVCNCS-LGYTDRLCLTPTNNVCLGAPCRNGGTCELTSIHNYR--CKCP-PGWSGKTCQQADPCASNPCANGGQCSPFDSDFLCHCTPY-FSGQTCKQDVNECAQIPSPCKNGGVCENGVGTYHCNCPAEYTGKHCESLYQPCNPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCK-PEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGDDCSENIDDCADAACHTGATCHDRVASFLCECPH-GRTGLLCHLDDACISNPCQK 334          

HSP 9 Score: 79.337 bits (194), Expect = 8.853e-14
Identity = 102/346 (29.48%), Postives = 141/346 (40.75%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-GTGFRGNNCEQSFCSDSF----CQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCS 4441
            C    C     C+      L C C  G TG  C  ++  C  + C+ G  C       K  C+   G+ G  C+Q     S     C++ G C    G   C C    + G  CE  I  C  + C N   C        C C   G+ G  C+   + C S  C N G C+ + +   C+C   F+G QC  +  +C+S  C N   C        C CT+ + GQ CE +   C S+ C+YG  C+       C C+   + G  C I    C  + C NGG CQ R   Y C C +G  G+ C+    +C  N C + G C    NG+ C C   GY G  C+
Sbjct:  290 CADAACHTGATCHDRVASFL-CECPHGRTGLLCH-LDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSLGANPCEHAGKCINTKGSFQCKCLQG-YVGARCELDINECLSTPCQNDATCLDQIGGFHCICMP-GYEGVFCQINTDECASMPCLNNGKCIDKINNYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDGPNMYTCQCTEGYTGQHCETDVDECLSNPCHYG-TCKDGLASFTCVCR-AGFMGRLCEININECLSQPCQNGGTCQDRENAYLCVCPKGTAGANCEINLDDCQSNPC-DFGRCIDKINGYECAC-EPGYTGKMCN 627          

HSP 10 Score: 77.411 bits (189), Expect = 2.727e-13
Identity = 100/355 (28.17%), Postives = 130/355 (36.62%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDC-RNTQHKGKVCE----------KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQ---CSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERK--ECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGL 4459
            C+N G C   A +   C+C  G+TG  CE+    C  + C+NG  C  Y     C+C   G+ G NC      C    CQN G C        C C R TQ  G  CE           PI  E  C N+GRC        C C   G++G++CE ++  C SN C     C+   +   C+C   +TG  C++    C    C N GTC +++  P    C C   F G  CE                               Y+   C   +      C NGG C   +    C C   F G  CQ+     C  N C N G C  I        T   Y+   C     GL
Sbjct: 1067 CRNSGQCLD-AGNTHYCHCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECV-PGYHGVNCSDEINECLSQPCQNGGTCIDLINTYKCSCPRGTQ--GVHCEINIDDCTPFTDPITHEPKCFNQGRCVDRVGGYHCICPP-GYVGERCEGDVNECLSNPCGTHS-CIQLKNNYRCECRTGYTGQHCDKVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGSTCE-------------------------------YDAHACGSLQ------CKNGGTCVSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCEYI--------TEEPYYHCICPTNFNGL 1370          
BLAST of Cell polarity protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 138.272 bits (347), Expect = 1.421e-31
Identity = 133/418 (31.82%), Postives = 187/418 (44.74%), Query Frame = 2
Query: 3272 SLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLS-------GAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTA-TGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            S  Y  E+   PN  +L      F   E   L N +        G  +   L  +D     NP       C+N G C  L+ +    C C  G+TG+ C++ +  C  + C NGG+C  ++ Q  C C  +GF G  C+Q    CS + C+N G C  E G   C+C+N +  G+ CE+P   C+ S C N G C   ++    +CT   GF GQ CE  I  C SN C+NGG CV   +   CQC P++TG  C E     +   N C N GTC+ +     C C   + G+ C E    C +  C+ G  C  R    +C+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C  +  EC    N C++ G C+     F C+C   GY G  C   V
Sbjct:    7 SSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDNACVNNP-------CRNGGTCELLSSVSDYRCRCPPGWTGDSCQQAD-PCASNPCANGGKCLPFETQYICKCP-SGFHGATCKQDINECSQNPCRNGGQCLNEFGSYRCNCQN-RFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSY-ECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPH-GRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQ-GYAGPRCEIDV 411          

HSP 2 Score: 109.768 bits (273), Expect = 6.325e-23
Identity = 108/333 (32.43%), Postives = 141/333 (42.34%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDC 4408
            +C    C + G C    I++  C C  GF G  C+     C    C+NG +C        C C+  GF G +CEQ    C    C   G C        C CR   + G++C+  I  C    C N G+C       IC C   G  G  CE  +  C SN C + G C+ +     C C P +TG  CN    +C+SN C N GTC        C C   +    C  E   C S+ C +G      NGY  CDC +  + G+ C++    C    C NGG C+   G Y C C+ GF G  CQ    EC  N C N G C     G+ C+C
Sbjct:  451 ECASNPCLHNGKCVD-KINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCT-EGFTGRHCEQDINECIPDPCHY-GTCKDGIATFTCLCR-PGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTC-PKGTTGVNCETNLDDCASNPC-DYGKCIDKIDGYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGY-KCDC-DAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNC 775          

HSP 3 Score: 109.768 bits (273), Expect = 7.357e-23
Identity = 114/359 (31.75%), Postives = 155/359 (43.18%), Query Frame = 2
Query: 3428 CRNP-LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE-ICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  P + C    C N G C Q       C C  GF+G+ CE+    CP + CRNGG C        C C    + G  C +         + CQN G C    G   C C N    G+ C + I  C+ + C++   C+       C+C   G  G  C  +  C SN C  G  C   P + +  C C P +TG  CN    +CS  +N C + G C  +    QC+C + + G RCEI+   C S+ C     C  + G   C C    YEG  C  NI   C    C + G C  +  +++CEC  GF G+ CQ +  EC    CKN   C    N +TC CT  G+ G  C + +
Sbjct:  173 CEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCP-PDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGW-TGEDCSENIDDCANAACHSGATCHDRVASFFCEC-PHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICM-PGYEGLYCETNI-DECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCTE-GFTGRHCEQDI 525          

HSP 4 Score: 102.834 bits (255), Expect = 9.608e-21
Identity = 99/340 (29.12%), Postives = 132/340 (38.82%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C+   C N G C    I+   CNC  GF G KCE+    C  + C+NG  C        C C   GF G +CE +                                    P C+ES C N G C        C C   GF G  C+ +I  C S  C NGG C        C C   +TG  C    R C S+ C N G C+ +N   +C C   + G  C++    PS  C    V   + G                          C N G C      ++C CQ G+ GS C+E+  EC PN C+N   C+    G++C+C   GY G++CSE++
Sbjct:  869 CQPNPCHNGGSCSD-GINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQ-PGFSGIHCENN-----------------------------------TPDCTESSCFNGGTCIDGINTFSCQC-PPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDV----PSVSCE---VAAKQQGVDI--------------------AHLCRNSGMCVDTGNTHFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECV-AGYHGVNCSEEI 1142          

HSP 5 Score: 101.293 bits (251), Expect = 2.792e-20
Identity = 109/347 (31.41%), Postives = 148/347 (42.65%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGK-VCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C    CQN G C       + C C +G TG  CE     C  + C + G+C       +C C   G+ G  C  +   C+ + C+N G C  +     C C +  H    + E   C+ + C   G C+       CDC A G+ G  C+     C SN C NGG C        C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE +   C    C  GG C+    Y    C+    ++G  C I    C    C NG  CQ  NG Y C C+ G+ G  C+ +  +C PN C N G CS   N F C+C   G+ G  C E +
Sbjct:  564 ECLSQPCQNGGQCTDRENGYI-CTCPKGTTGVNCETNLDDCASNPC-DYGKCIDKIDGYECTCE-PGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCI-HGTCHDGINGYKCDCDA-GWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCP-AGFRGPKCEEDI 904          

HSP 6 Score: 98.2117 bits (243), Expect = 2.338e-19
Identity = 108/371 (29.11%), Postives = 161/371 (43.40%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS------------DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNF--------CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV---CQIRNGYPYCDCQNTNYEGTRCN-IPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C+   C N G C Q +     C C +G+TG  C+ +   C    C+NGG+C+  +   +C+C  +G+ G  C+    S               C+N+G+C        C C+   + G  CE+ +  CS + C N   C  +     C+C A G+ G  C  EI  C S+ C NGG C+   +   C C     G  C  N   C+  +        CFN+G C        C C   F G+RCE +   C S+ C   G     Q+ N Y  C+C+   + G RC+ +   C    C NGG C V +     + C+C  GF G+ C+ + + C    C+N G C  +     C C+  GY G +C   V
Sbjct:  982 ECDSKPCLNGGTC-QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECK-SGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMCVDTGNTHFCRCQ-AGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVA-GYHGVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVNDY-RCECRQ-GFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTCISVLKSSKCVCSE-GYTGATCQYPV 1345          

HSP 7 Score: 62.003 bits (149), Expect = 2.252e-8
Identity = 72/243 (29.63%), Postives = 98/243 (40.33%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLG---CNCSEGFTGEKCEKIEFTCPRDFC--RNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN---ERKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEIEKRCPSDFCYYGGV 4147
            C N G C    ID++G   C C  GF GE+CE     C  + C  R    C       +C+C   GF G  C+     C    C+N G C++ +        NT+ +G +C+ P                           GF G  CE +   C +  C+NGG C+       C C+  +TG  C       C+S  C+N GTC  S E P  QC C  NF G  C I      D+ + GG+
Sbjct: 1196 CFNNGKC----IDRVGGYNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVNDYRCECR-QGFTGRRCDSVVDGCKGLPCRNGGTCAVAS--------NTE-RGFICKCP--------------------------PGFDGATCEYDARTCGNLRCQNGGTCISVLKSSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHI-----LDYGFIGGL 1393          
BLAST of Cell polarity protein vs. Ensembl Xenopus
Match: emid1 (EMI domain containing 1 [Source:Xenbase;Acc:XB-GENE-5872275])

HSP 1 Score: 133.265 bits (334), Expect = 4.228e-30
Identity = 135/468 (28.85%), Postives = 196/468 (41.88%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCY-ISNE-----RPQ-------------CSCTKNFEGQRCEIE-KRCPSDFCYYGGVC-QIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECP-------PNFCKNDGICSVINNG----FTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQ-----TQSNVNDGQYYVVSI 4708
            +C    CQN  LC    +D+  C C  GF G  CE     C    C+N G C     Q +C C+  G+ G NCE     C    CQN   C    G   CDC    + G+ C+  I  C    C N G+C     +  CDC+ TGF+G +CE EI  C SN C+N G C+ R +   C C   ++G  C  ++ +C    C N G C  +SN+      P+             C C + F G  C +    C S  C  GG C  + NG+  C+C  + Y G  C+I    C    C NG +C+     Y C C    Q       K C         + C+N   C  +  G    +TC C   G+ G +CS   T     +   GY++Y       +    ++V F+T +    +  +R  +  + +L++ NG L + + GN            VNDG ++ V +
Sbjct:  183 ECASNPCQNEALCVD-KVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACA-NGYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCP-AGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLCWKGYSGIHCEIDDNECFEEPCVNGGLCLELSNQSYYGTEPEFNKFSYSQAAGYLCRCQQGFTGPNCSVNIDECESWPCLNGGTCTDLINGF-LCNCA-SGYTGFDCSINIDECKDSPCKNGASCEDGVADYSCICPPAAQDGTVWGGKNCSVMLIGCLEHSCQNAAECIPLYTGQSHSYTCKC-QPGFVGNNCSTPTTF---SFLSQGYLMYDSPLSNESYQSNMSVRFRTTLPD-MVLMYRGDEDSFLALEIYNGFLHMRLKGNGRLFPLVIDDYKVNDGHWHNVEV 640          

HSP 2 Score: 122.865 bits (307), Expect = 6.048e-27
Identity = 125/390 (32.05%), Postives = 169/390 (43.33%), Query Frame = 2
Query: 3347 ISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCT-PEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI-EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            + ED F+    SG         +DC    +P  C    CQN   C     D   C C  GFTG++CE     C  + C+N   C     +  C C   GF+G++CE     C+   CQNNG C  +     C C N  + G  CE  I  C    C N   C  H     CDC A G+ G++C+ +I  C S  C+NGG C+   ++  C C+   F G +C     +C SN C N+GTC       +C C K + G  CEI +  C  + C  GG+C         +  N +Y GT    P+     +    G        Y C CQ+GF G  C     EC    C N G C+ + NGF C+C  +GY G  CS  +   K+   K G
Sbjct:  121 VGEDSFMCKCQSG------YGGVDCNFEVSP--CFQNPCQNNATCLAEG-DSFRCVCEPGFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCV-PGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACANG-YTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCPA-GYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLCWKGYSGIHCEIDDNECFEEPCVNGGLCL--------ELSNQSYYGTE---PEFNKFSYSQAAG--------YLCRCQQGFTGPNCSVNIDECESWPCLNGGTCTDLINGFLCNCA-SGYTGFDCSINIDECKDSPCKNG 478          

HSP 3 Score: 118.627 bits (296), Expect = 1.065e-25
Identity = 111/346 (32.08%), Postives = 153/346 (44.22%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSE---GFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQP--KCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVC--EKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQE-GFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C    C N G C + A     C C      FTG  C  +   C  D C +   C      P  +C C       N C+++ C       N  C++     +C C+ + + G  C  E   C ++ C N   C    +   C C   GF GQ+CE  +  C SN C+N  LCV +  +  C C P F G  C  +  +C+S  C N+GTC    ++ +C+C   + G  CE+E   C S  C  G  C+   GY  CDC    Y+G +C      C  + C NGG C     ++ C+C   GF G RC+ E  EC  N C+N+G C    NG+ C C   GY GI C
Sbjct:   32 CVSSPCLNGGTCQETA-SGFTCLCPAEPLAFTGTTCGDLYDACAIDRCPSTHSCQSTPGHPHFQCVCQPGLNCTNECQRNSCP----FQNFQCTVGEDSFMCKCQ-SGYGGVDCNFEVSPCFQNPCQNNATCLAEGDSFRCVCEP-GFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACANGYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCP-AGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLC-WKGYSGIHC 368          

HSP 4 Score: 105.531 bits (262), Expect = 1.166e-21
Identity = 95/311 (30.55%), Postives = 133/311 (42.77%), Query Frame = 2
Query: 3560 TCPRDFCRNGGRCYMYDKQPKCDCSG--TGFRGNNCEQSF--CSDSFCQNNGICSIENGLP--VCDCRNTQHKGKVCEKPICS-ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            TC    C NGG C        C C      F G  C   +  C+   C +   C    G P   C C+   +    C++  C  ++F     +C V  +  +C C  +G+ G  C  E+  C  N C+N   C+       C C P FTG +C  N  +C+SN C N+  C    +R  C C   F+G  CEI+   C S  C   G C  +     C C N  Y G  C +    C    C NG  C+   G + C+C  G+ G +CQ +  EC    C+N G C    N F CDC++TG+ G  C  ++
Sbjct:   31 TCVSSPCLNGGTCQETASGFTCLCPAEPLAFTGTTCGDLYDACAIDRCPSTHSCQSTPGHPHFQCVCQPGLNCTNECQRNSCPFQNF-----QCTVGEDSFMCKC-QSGYGGVDCNFEVSPCFQNPCQNNATCLAEGDSFRCVCEPGFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACAN-GYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCPAGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEI 334          

HSP 5 Score: 72.0182 bits (175), Expect = 1.525e-11
Identity = 96/402 (23.88%), Postives = 152/402 (37.81%), Query Frame = 2
Query: 2870 IAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLR-------RIIVHVDKGYQPKVINLAVIKS-IDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSES-----FCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCF 4024
            I+   +   I + F+TR    +     +  S +N  ++++      L   +    +V+ ++      + D  WHRVVI + +  +       ++   V K +Q +  NL  +++ I I   E Y G + +     ++      LP+                    L  +D+F+  + S A+           GCR    C    C + G C  L  +   C C  G+ G +CE     C    C +G  C   +   +C C   G+   NCE +   C    C N G C        C C    + G  C+ P   E       C N GRC        C C   GF G++CE  +  C SN C NGG C    +   C C   F+G +C +   +S F F
Sbjct: 1033 ISEEHNLTSISLAFRTRDRDAV-----LLQSSKNVDSVLIEIQGGYLFVDLQSGNNVDGVQLNGTIDVADAIWHRVVITMERATKVNSHWTFQLDDSVQKKFQWEGDNLNFMRNNISIVLAEGYTGCLGDVSIGGIY------LPFT----------------DHVLPQQDQFI--RKSDALEL---------GCRGADVCSESPCLHGGTCQDL-FNSFSCTCRIGWNGHRCEINIDDCKSSPCLHG-FCIDLEADYQCSCEA-GYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCP-ANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCRP-GFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCICNSSFSGVRCEKSDAASMFPF 1391          

HSP 6 Score: 67.3958 bits (163), Expect = 4.241e-10
Identity = 70/248 (28.23%), Postives = 100/248 (40.32%), Query Frame = 2
Query: 3890 EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP---KRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWS 4609
            ++C+ + C +GG C    +  +C C   + G +C  N   C S+ C + G C       QCSC   +  + CEI    C    C  GG C        C C   NY GT C  P   ++C     C NGG C        C C+ GF G RC+    +C  N C N G C    N F C C ++ + G+ C +      +    + + +  V+ P       VT G    +  G I+   T   R  S
Sbjct: 1193 DVCSESPCLHGGTCQDLFNSFSCTCRIGWNGHRCEINIDDCKSSPCLH-GFCIDLEADYQCSCEAGYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCP-ANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCRPGFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCIC-NSSFSGVRCEK-----SDAASMFPFPLVGVAVP-------VTCGVLLLLVIGVIFMVLTARKRRQS 1425          

HSP 7 Score: 62.3882 bits (150), Expect = 1.407e-8
Identity = 59/192 (30.73%), Postives = 81/192 (42.19%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE---KRCPSDF-CYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQE 4330
            +CSES C + G C        C C   G+ G +CE  I  C S+ C +G  C+  ++   C C   +T   C  N   C  + C N GTC        C C  N+ G  C+     ++C  +  C+ GG C        C C+   + G RC I    C    C NGG CQ     + C C   F G RC++
Sbjct: 1194 VCSESPCLHGGTCQDLFNSFSCTCR-IGWNGHRCEINIDDCKSSPCLHG-FCIDLEADYQCSCEAGYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCPANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCR-PGFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCICNSSFSGVRCEK 1382          
BLAST of Cell polarity protein vs. Ensembl Xenopus
Match: emid1 (EMI domain containing 1 [Source:Xenbase;Acc:XB-GENE-5872275])

HSP 1 Score: 133.265 bits (334), Expect = 4.483e-30
Identity = 135/468 (28.85%), Postives = 196/468 (41.88%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCY-ISNE-----RPQ-------------CSCTKNFEGQRCEIE-KRCPSDFCYYGGVC-QIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECP-------PNFCKNDGICSVINNG----FTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQ-----TQSNVNDGQYYVVSI 4708
            +C    CQN  LC    +D+  C C  GF G  CE     C    C+N G C     Q +C C+  G+ G NCE     C    CQN   C    G   CDC    + G+ C+  I  C    C N G+C     +  CDC+ TGF+G +CE EI  C SN C+N G C+ R +   C C   ++G  C  ++ +C    C N G C  +SN+      P+             C C + F G  C +    C S  C  GG C  + NG+  C+C  + Y G  C+I    C    C NG +C+     Y C C    Q       K C         + C+N   C  +  G    +TC C   G+ G +CS   T     +   GY++Y       +    ++V F+T +    +  +R  +  + +L++ NG L + + GN            VNDG ++ V +
Sbjct:  183 ECASNPCQNEALCVD-KVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACA-NGYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCP-AGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLCWKGYSGIHCEIDDNECFEEPCVNGGLCLELSNQSYYGTEPEFNKFSYSQAAGYLCRCQQGFTGPNCSVNIDECESWPCLNGGTCTDLINGF-LCNCA-SGYTGFDCSINIDECKDSPCKNGASCEDGVADYSCICPPAAQDGTVWGGKNCSVMLIGCLEHSCQNAAECIPLYTGQSHSYTCKC-QPGFVGNNCSTPTTF---SFLSQGYLMYDSPLSNESYQSNMSVRFRTTLPD-MVLMYRGDEDSFLALEIYNGFLHMRLKGNGRLFPLVIDDYKVNDGHWHNVEV 640          

HSP 2 Score: 122.865 bits (307), Expect = 6.148e-27
Identity = 125/390 (32.05%), Postives = 169/390 (43.33%), Query Frame = 2
Query: 3347 ISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCT-PEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI-EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            + ED F+    SG         +DC    +P  C    CQN   C     D   C C  GFTG++CE     C  + C+N   C     +  C C   GF+G++CE     C+   CQNNG C  +     C C N  + G  CE  I  C    C N   C  H     CDC A G+ G++C+ +I  C S  C+NGG C+   ++  C C+   F G +C     +C SN C N+GTC       +C C K + G  CEI +  C  + C  GG+C         +  N +Y GT    P+     +    G        Y C CQ+GF G  C     EC    C N G C+ + NGF C+C  +GY G  CS  +   K+   K G
Sbjct:  121 VGEDSFMCKCQSG------YGGVDCNFEVSP--CFQNPCQNNATCLAEG-DSFRCVCEPGFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCV-PGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACANG-YTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCPA-GYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLCWKGYSGIHCEIDDNECFEEPCVNGGLCL--------ELSNQSYYGTE---PEFNKFSYSQAAG--------YLCRCQQGFTGPNCSVNIDECESWPCLNGGTCTDLINGFLCNCA-SGYTGFDCSINIDECKDSPCKNG 478          

HSP 3 Score: 118.627 bits (296), Expect = 1.139e-25
Identity = 111/346 (32.08%), Postives = 153/346 (44.22%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSE---GFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQP--KCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVC--EKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQE-GFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C    C N G C + A     C C      FTG  C  +   C  D C +   C      P  +C C       N C+++ C       N  C++     +C C+ + + G  C  E   C ++ C N   C    +   C C   GF GQ+CE  +  C SN C+N  LCV +  +  C C P F G  C  +  +C+S  C N+GTC    ++ +C+C   + G  CE+E   C S  C  G  C+   GY  CDC    Y+G +C      C  + C NGG C     ++ C+C   GF G RC+ E  EC  N C+N+G C    NG+ C C   GY GI C
Sbjct:   32 CVSSPCLNGGTCQETA-SGFTCLCPAEPLAFTGTTCGDLYDACAIDRCPSTHSCQSTPGHPHFQCVCQPGLNCTNECQRNSCP----FQNFQCTVGEDSFMCKCQ-SGYGGVDCNFEVSPCFQNPCQNNATCLAEGDSFRCVCEP-GFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACANGYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCP-AGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLC-WKGYSGIHC 368          

HSP 4 Score: 105.531 bits (262), Expect = 1.195e-21
Identity = 95/311 (30.55%), Postives = 132/311 (42.44%), Query Frame = 2
Query: 3560 TCPRDFCRNGGRCYMYDKQPKCDCSG--TGFRGNNCEQSF--CSDSFCQNNGICSIENGLP--VCDCRNTQHKGKVCEKPICS-ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            TC    C NGG C        C C      F G  C   +  C+   C +   C    G P   C C+   +    C++  C  ++F     +C V  +  +C C  +G+ G  C  E+  C  N C+N   C+       C C P FTG +C  N  +C+SN C N+  C    +R  C C   F+G  CEI+   C S  C   G C  +     C C N  Y G  C +    C    C NG  C+   G + C+C  G+ G +CQ    EC    C+N G C    N F CDC++TG+ G  C  ++
Sbjct:   31 TCVSSPCLNGGTCQETASGFTCLCPAEPLAFTGTTCGDLYDACAIDRCPSTHSCQSTPGHPHFQCVCQPGLNCTNECQRNSCPFQNF-----QCTVGEDSFMCKC-QSGYGGVDCNFEVSPCFQNPCQNNATCLAEGDSFRCVCEPGFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACAN-GYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCPAGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEI 334          

HSP 5 Score: 71.2478 bits (173), Expect = 2.725e-11
Identity = 98/423 (23.17%), Postives = 153/423 (36.17%), Query Frame = 2
Query: 2870 IAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLR-------RIIVHVDKGYQPKVINLAVIKS-IDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE 4102
            I+   +   I + F+TR    +     +  S +N  ++++      L   +    +V+ ++      + D  WHRVVI + +  +       ++   V K +Q +  NL  +++ I I   E Y G + +     ++      LP+                    L  +D+F+  + S A+           GCR    C    C + G C  L  +   C C  G+ G +CE     C    C +G  C   +   +C C   G+   NCE +   C    C N G C        C C    + G  C+ P                            F  ++C + I     C NGG C        C C P F+G +C  N   C SN C N GTC  S    +C C  +F G RCE
Sbjct: 1033 ISEEHNLTSISLAFRTRDRDAV-----LLQSSKNVDSVLIEIQGGYLFVDLQSGNNVDGVQLNGTIDVADAIWHRVVITMERATKVNSHWTFQLDDSVQKKFQWEGDNLNFMRNNISIVLAEGYTGCLGDVSIGGIY------LPFT----------------DHVLPQQDQFI--RKSDALEL---------GCRGADVCSESPCLHGGTCQDL-FNSFSCTCRIGWNGHRCEINIDDCKSSPCLHG-FCIDLEADYQCSCEA-GYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCP-ANYAGTFCQWP----------------------------FPPEQCNKNI----TCFNGGRCNSGIWGANCTCRPGFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCICNSSFSGVRCE 1381          

HSP 6 Score: 63.1586 bits (152), Expect = 7.296e-9
Identity = 60/193 (31.09%), Postives = 83/193 (43.01%), Query Frame = 2
Query: 3890 EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI---PKRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSE 4444
            ++C+ + C +GG C    +  +C C   + G +C  N   C S+ C + G C       QCSC   +  + CEI    C    C  GG C        C C   NY GT C     P++C     C NGG C        C C+ GF G RC+    +C  N C N G C    N F C C ++ + G+ C +
Sbjct: 1193 DVCSESPCLHGGTCQDLFNSFSCTCRIGWNGHRCEINIDDCKSSPCLH-GFCIDLEADYQCSCEAGYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCP-ANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCRPGFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCIC-NSSFSGVRCEK 1382          

HSP 7 Score: 62.7734 bits (151), Expect = 1.066e-8
Identity = 59/194 (30.41%), Postives = 82/194 (42.27%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE---KRCPSDF-CYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERK 4336
            +CSES C + G C        C C   G+ G +CE  I  C S+ C +G  C+  ++   C C   +T   C  N   C  + C N GTC        C C  N+ G  C+     ++C  +  C+ GG C        C C+   + G RC I    C    C NGG CQ     + C C   F G RC++ +
Sbjct: 1194 VCSESPCLHGGTCQDLFNSFSCTCR-IGWNGHRCEINIDDCKSSPCLHG-FCIDLEADYQCSCEAGYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCPANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCR-PGFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCICNSSFSGVRCEKPR 1384          
BLAST of Cell polarity protein vs. Ensembl Xenopus
Match: emid1 (EMI domain containing 1 [Source:Xenbase;Acc:XB-GENE-5872275])

HSP 1 Score: 132.88 bits (333), Expect = 5.248e-30
Identity = 135/468 (28.85%), Postives = 196/468 (41.88%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCY-ISNE-----RPQ-------------CSCTKNFEGQRCEIE-KRCPSDFCYYGGVC-QIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECP-------PNFCKNDGICSVINNG----FTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQ-----TQSNVNDGQYYVVSI 4708
            +C    CQN  LC    +D+  C C  GF G  CE     C    C+N G C     Q +C C+  G+ G NCE     C    CQN   C    G   CDC    + G+ C+  I  C    C N G+C     +  CDC+ TGF+G +CE EI  C SN C+N G C+ R +   C C   ++G  C  ++ +C    C N G C  +SN+      P+             C C + F G  C +    C S  C  GG C  + NG+  C+C  + Y G  C+I    C    C NG +C+     Y C C    Q       K C         + C+N   C  +  G    +TC C   G+ G +CS   T     +   GY++Y       +    ++V F+T +    +  +R  +  + +L++ NG L + + GN            VNDG ++ V +
Sbjct:  159 ECASNPCQNEALCVD-KVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACA-NGYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCP-AGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLCWKGYSGIHCEIDDNECFEEPCVNGGLCLELSNQSYYGTEPEFNKFSYSQAAGYLCRCQQGFTGPNCSVNIDECESWPCLNGGTCTDLINGF-LCNCA-SGYTGFDCSINIDECKDSPCKNGASCEDGVADYSCICPPAAQDGTVWGGKNCSVMLIGCLEHSCQNAAECIPLYTGQSHSYTCKC-QPGFVGNNCSTPTTF---SFLSQGYLMYDSPLSNESYQSNMSVRFRTTLPD-MVLMYRGDEDSFLALEIYNGFLHMRLKGNGRLFPLVIDDYKVNDGHWHNVEV 616          

HSP 2 Score: 122.479 bits (306), Expect = 6.968e-27
Identity = 125/390 (32.05%), Postives = 169/390 (43.33%), Query Frame = 2
Query: 3347 ISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCT-PEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI-EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            + ED F+    SG         +DC    +P  C    CQN   C     D   C C  GFTG++CE     C  + C+N   C     +  C C   GF+G++CE     C+   CQNNG C  +     C C N  + G  CE  I  C    C N   C  H     CDC A G+ G++C+ +I  C S  C+NGG C+   ++  C C+   F G +C     +C SN C N+GTC       +C C K + G  CEI +  C  + C  GG+C         +  N +Y GT    P+     +    G        Y C CQ+GF G  C     EC    C N G C+ + NGF C+C  +GY G  CS  +   K+   K G
Sbjct:   97 VGEDSFMCKCQSG------YGGVDCNFEVSP--CFQNPCQNNATCLAEG-DSFRCVCEPGFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCV-PGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACANG-YTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCPA-GYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLCWKGYSGIHCEIDDNECFEEPCVNGGLCL--------ELSNQSYYGTE---PEFNKFSYSQAAG--------YLCRCQQGFTGPNCSVNIDECESWPCLNGGTCTDLINGFLCNCA-SGYTGFDCSINIDECKDSPCKNG 454          

HSP 3 Score: 118.242 bits (295), Expect = 1.405e-25
Identity = 111/346 (32.08%), Postives = 153/346 (44.22%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSE---GFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQP--KCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVC--EKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQE-GFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C    C N G C + A     C C      FTG  C  +   C  D C +   C      P  +C C       N C+++ C       N  C++     +C C+ + + G  C  E   C ++ C N   C    +   C C   GF GQ+CE  +  C SN C+N  LCV +  +  C C P F G  C  +  +C+S  C N+GTC    ++ +C+C   + G  CE+E   C S  C  G  C+   GY  CDC    Y+G +C      C  + C NGG C     ++ C+C   GF G RC+ E  EC  N C+N+G C    NG+ C C   GY GI C
Sbjct:    8 CVSSPCLNGGTCQETA-SGFTCLCPAEPLAFTGTTCGDLYDACAIDRCPSTHSCQSTPGHPHFQCVCQPGLNCTNECQRNSCP----FQNFQCTVGEDSFMCKCQ-SGYGGVDCNFEVSPCFQNPCQNNATCLAEGDSFRCVCEP-GFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACANGYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCP-AGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEILECDSNPCQNNGTCMERVNGYECLC-WKGYSGIHC 344          

HSP 4 Score: 105.145 bits (261), Expect = 1.369e-21
Identity = 95/311 (30.55%), Postives = 133/311 (42.77%), Query Frame = 2
Query: 3560 TCPRDFCRNGGRCYMYDKQPKCDCSG--TGFRGNNCEQSF--CSDSFCQNNGICSIENGLP--VCDCRNTQHKGKVCEKPICS-ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            TC    C NGG C        C C      F G  C   +  C+   C +   C    G P   C C+   +    C++  C  ++F     +C V  +  +C C  +G+ G  C  E+  C  N C+N   C+       C C P FTG +C  N  +C+SN C N+  C    +R  C C   F+G  CEI+   C S  C   G C  +     C C N  Y G  C +    C    C NG  C+   G + C+C  G+ G +CQ +  EC    C+N G C    N F CDC++TG+ G  C  ++
Sbjct:    7 TCVSSPCLNGGTCQETASGFTCLCPAEPLAFTGTTCGDLYDACAIDRCPSTHSCQSTPGHPHFQCVCQPGLNCTNECQRNSCPFQNF-----QCTVGEDSFMCKC-QSGYGGVDCNFEVSPCFQNPCQNNATCLAEGDSFRCVCEPGFTGQECEVNVNECASNPCQNEALCVDKVDRYMCFCVPGFQGHHCEIDINECASRPCQNNGTCMNQLDQYECACAN-GYTGINCEMEIDECQSVPCQNGATCRDHIGYFTCDCPAGYDGEQCQHDIDECQSQPCQNGGQCMDEINRFRCDCSNTGFVGGRCEVEI 310          

HSP 5 Score: 71.633 bits (174), Expect = 2.004e-11
Identity = 96/402 (23.88%), Postives = 152/402 (37.81%), Query Frame = 2
Query: 2870 IAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLR-------RIIVHVDKGYQPKVINLAVIKS-IDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSES-----FCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCF 4024
            I+   +   I + F+TR    +     +  S +N  ++++      L   +    +V+ ++      + D  WHRVVI + +  +       ++   V K +Q +  NL  +++ I I   E Y G + +     ++      LP+                    L  +D+F+  + S A+           GCR    C    C + G C  L  +   C C  G+ G +CE     C    C +G  C   +   +C C   G+   NCE +   C    C N G C        C C    + G  C+ P   E       C N GRC        C C   GF G++CE  +  C SN C NGG C    +   C C   F+G +C +   +S F F
Sbjct: 1009 ISEEHNLTSISLAFRTRDRDAV-----LLQSSKNVDSVLIEIQGGYLFVDLQSGNNVDGVQLNGTIDVADAIWHRVVITMERATKVNSHWTFQLDDSVQKKFQWEGDNLNFMRNNISIVLAEGYTGCLGDVSIGGIY------LPFT----------------DHVLPQQDQFI--RKSDALEL---------GCRGADVCSESPCLHGGTCQDL-FNSFSCTCRIGWNGHRCEINIDDCKSSPCLHG-FCIDLEADYQCSCEA-GYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCP-ANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCRP-GFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCICNSSFSGVRCEKSDAASMFPF 1367          

HSP 6 Score: 67.3958 bits (163), Expect = 4.792e-10
Identity = 70/248 (28.23%), Postives = 100/248 (40.32%), Query Frame = 2
Query: 3890 EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP---KRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWS 4609
            ++C+ + C +GG C    +  +C C   + G +C  N   C S+ C + G C       QCSC   +  + CEI    C    C  GG C        C C   NY GT C  P   ++C     C NGG C        C C+ GF G RC+    +C  N C N G C    N F C C ++ + G+ C +      +    + + +  V+ P       VT G    +  G I+   T   R  S
Sbjct: 1169 DVCSESPCLHGGTCQDLFNSFSCTCRIGWNGHRCEINIDDCKSSPCLH-GFCIDLEADYQCSCEAGYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCP-ANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCRPGFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCIC-NSSFSGVRCEK-----SDAASMFPFPLVGVAVP-------VTCGVLLLLVIGVIFMVLTARKRRQS 1401          

HSP 7 Score: 62.3882 bits (150), Expect = 1.551e-8
Identity = 59/192 (30.73%), Postives = 81/192 (42.19%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE---KRCPSDF-CYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQE 4330
            +CSES C + G C        C C   G+ G +CE  I  C S+ C +G  C+  ++   C C   +T   C  N   C  + C N GTC        C C  N+ G  C+     ++C  +  C+ GG C        C C+   + G RC I    C    C NGG CQ     + C C   F G RC++
Sbjct: 1170 VCSESPCLHGGTCQDLFNSFSCTCR-IGWNGHRCEINIDDCKSSPCLHG-FCIDLEADYQCSCEAGYTSRNCEININDCQHHQCLNGGTCVDGVNNYTCKCPANYAGTFCQWPFPPEQCNKNITCFNGGRCNSGIWGANCTCR-PGFSGRRCEINVNDCESNPCLNGGTCQDSVNTFKCICNSSFSGVRCEK 1358          
BLAST of Cell polarity protein vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 133.265 bits (334), Expect = 5.584e-30
Identity = 131/416 (31.49%), Postives = 184/416 (44.23%), Query Frame = 2
Query: 3272 SLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLS-------GAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTA-TGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            S  Y  E+   PN  +L      F   E   L N +        G  +   L  +D     NP       C+N G C  L+ +    C C  G+TG+ C++ +  C  + C NGG+C  ++ Q  C C  +GF G  C+Q    CS + C+N G C  E G   C+C+N +  G+ CE+P   C+ S C N G C   ++    +CT   GF GQ CE  I  C SN C+NGG CV   +   CQC P++TG  C E     +   N C N GTC+ +     C C   + G+ C E    C +  C+ G  C  R    +C+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C  +  EC      + G C+     F C+C   GY G  C   V
Sbjct:    7 SSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCPVGFTDKVCLTPVDNACVNNP-------CRNGGTCELLSSVSDYRCRCPPGWTGDSCQQAD-PCASNPCANGGKCLPFETQYICKCP-SGFHGATCKQDINECSQNPCRNGGQCLNEFGSYRCNCQN-RFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSY-ECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPH-GRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDEC------SLGKCTNTLGSFQCNCPQ-GYAGPRCEIDV 403          

HSP 2 Score: 109.768 bits (273), Expect = 6.988e-23
Identity = 108/333 (32.43%), Postives = 141/333 (42.34%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDC 4408
            +C    C + G C    I++  C C  GF G  C+     C    C+NG +C        C C+  GF G +CEQ    C    C   G C        C CR   + G++C+  I  C    C N G+C       IC C   G  G  CE  +  C SN C + G C+ +     C C P +TG  CN    +C+SN C N GTC        C C   +    C  E   C S+ C +G      NGY  CDC +  + G+ C++    C    C NGG C+   G Y C C+ GF G  CQ    EC  N C N G C     G+ C+C
Sbjct:  440 ECASNPCLHNGKCVD-KINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCT-EGFTGRHCEQDINECIPDPCHY-GTCKDGIATFTCLCR-PGYTGRLCDNDINECLSQPCQNGGQCTDRENGYICTC-PKGTTGVNCETNLDDCASNPC-DYGKCIDKIDGYECTCEPGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCIHGTCHDGINGY-KCDC-DAGWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNC 764          

HSP 3 Score: 102.449 bits (254), Expect = 1.116e-20
Identity = 99/340 (29.12%), Postives = 132/340 (38.82%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C+   C N G C    I+   CNC  GF G KCE+    C  + C+NG  C        C C   GF G +CE +                                    P C+ES C N G C        C C   GF G  C+ +I  C S  C NGG C        C C   +TG  C    R C S+ C N G C+ +N   +C C   + G  C++    PS  C    V   + G                          C N G C      ++C CQ G+ GS C+E+  EC PN C+N   C+    G++C+C   GY G++CSE++
Sbjct:  858 CQPNPCHNGGSCSD-GINMFFCNCPAGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQ-PGFSGIHCENN-----------------------------------TPDCTESSCFNGGTCIDGINTFSCQC-PPGFTGNYCQHDINECDSKPCLNGGTCQDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECKSGWTGVYCDV----PSVSCE---VAAKQQGVDI--------------------AHLCRNSGMCVDTGNTHFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECV-AGYHGVNCSEEI 1131          

HSP 4 Score: 102.449 bits (254), Expect = 1.126e-20
Identity = 109/355 (30.70%), Postives = 148/355 (41.69%), Query Frame = 2
Query: 3428 CRNP-LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE-ICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  P + C    C N G C Q       C C  GF+G+ CE+    CP + CRNGG C        C C    + G  C +         + CQN G C    G   C C N    G+ C + I  C+ + C++   C+       C+C   G  G  C  +  C SN C  G  C   P + +  C C P +TG  CN    +CS   C N    +      QC+C + + G RCEI+   C S+ C     C  + G   C C       T  NI   C    C + G C  +  +++CEC  GF G+ CQ +  EC    CKN   C    N +TC CT  G+ G  C + +
Sbjct:  173 CEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCP-PDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGW-TGEDCSENIDDCANAACHSGATCHDRVASFFCEC-PHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGKCTNTLGSF------QCNCPQGYAGPRCEIDVNECLSNPCQNDATCLDQIGEFQCICMPGVLSAT--NI-DECASNPCLHNGKCVDKINEFHCECPTGFNGNLCQHDVDECASTPCKNGAKCLDGPNSYTCQCTE-GFTGRHCEQDI 514          

HSP 5 Score: 100.908 bits (250), Expect = 3.111e-20
Identity = 109/347 (31.41%), Postives = 148/347 (42.65%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGK-VCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C    CQN G C       + C C +G TG  CE     C  + C + G+C       +C C   G+ G  C  +   C+ + C+N G C  +     C C +  H    + E   C+ + C   G C+       CDC A G+ G  C+     C SN C NGG C        C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE +   C    C  GG C+    Y    C+    ++G  C I    C    C NG  CQ  NG Y C C+ G+ G  C+ +  +C PN C N G CS   N F C+C   G+ G  C E +
Sbjct:  553 ECLSQPCQNGGQCTDRENGYI-CTCPKGTTGVNCETNLDDCASNPC-DYGKCIDKIDGYECTCE-PGYTGKMCNINIDECASNPCRNGGTCKDKINGFTCVCPDGYHDHMCLSEVNECNSNPCI-HGTCHDGINGYKCDCDA-GWSGSNCDVNNNECESNPCMNGGTCKDMTGAYICTCRAGFSGPNCQTNINECASNPCLNRGTCIDDVAGYKCNCMLPYTGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCNCKPGYAGRHCETDIDDCQPNPCHNGGSCSDGINMFFCNCP-AGFRGPKCEEDI 893          

HSP 6 Score: 97.8265 bits (242), Expect = 2.671e-19
Identity = 108/371 (29.11%), Postives = 161/371 (43.40%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS------------DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNF--------CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV---CQIRNGYPYCDCQNTNYEGTRCN-IPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C+   C N G C Q +     C C +G+TG  C+ +   C    C+NGG+C+  +   +C+C  +G+ G  C+    S               C+N+G+C        C C+   + G  CE+ +  CS + C N   C  +     C+C A G+ G  C  EI  C S+ C NGG C+   +   C C     G  C  N   C+  +        CFN+G C        C C   F G+RCE +   C S+ C   G     Q+ N Y  C+C+   + G RC+ +   C    C NGG C V +     + C+C  GF G+ C+ + + C    C+N G C  +     C C+  GY G +C   V
Sbjct:  971 ECDSKPCLNGGTC-QDSYGAYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECK-SGWTGVYCDVPSVSCEVAAKQQGVDIAHLCRNSGMCVDTGNTHFCRCQ-AGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVA-GYHGVNCSEEINECLSHPCHNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSVSLEPKCFNNGKCIDRVGGYNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVNDY-RCECRQ-GFTGRRCDSVVDGCKGLPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDARTCGNLRCQNGGTCISVLKSSKCVCSE-GYTGATCQYPV 1334          

HSP 7 Score: 92.8189 bits (229), Expect = 8.152e-18
Identity = 100/327 (30.58%), Postives = 139/327 (42.51%), Query Frame = 2
Query: 3515 CSEGFTGEKCEKIEFTCPRDFCRNGGRCYMY----DKQPKCDCSGTGFRGNNC---EQSFCSDSFCQNNGICSIENGLPVCDCR-NTQHKGKVCEKP-ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERP-QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            CS  + GE+C+       ++ C N G C            C C   GF    C     + C ++ C+N G C + + +    CR      G  C++   C+ + C N G+C     Q IC C  +GF G  C+++I  C+ N C+NGG C+       C C   FTG  C E    C+ + C N GTC  +++   +C+C   F GQ CE     CPS+ C  GG C        C C   ++ G  C      C L    C NGG C    G Y C C  G+ G  C E   +C    C +   C      F C+C H G  G+ C
Sbjct:    6 CSSSYFGERCQYPNPCALKNQCMNFGTCEPVLLGNAIDFTCHCP-VGFTDKVCLTPVDNACVNNPCRNGGTCELLSSVSDYRCRCPPGWTGDSCQQADPCASNPCANGGKCLPFETQYICKC-PSGFHGATCKQDINECSQNPCRNGGQCLNEFGSYRCNCQNRFTGRNCEEPYVPCNPSPCLNGGTCRQTDDTSYECTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCP-PDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFFCECPH-GRTGLLC 328          

HSP 8 Score: 61.6178 bits (148), Expect = 2.469e-8
Identity = 72/243 (29.63%), Postives = 98/243 (40.33%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLG---CNCSEGFTGEKCEKIEFTCPRDFC--RNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE--ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN---ERKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEIEKRCPSDFCYYGGV 4147
            C N G C    ID++G   C C  GF GE+CE     C  + C  R    C       +C+C   GF G  C+     C    C+N G C++ +        NT+ +G +C+ P                           GF G  CE +   C +  C+NGG C+       C C+  +TG  C       C+S  C+N GTC  S E P  QC C  NF G  C I      D+ + GG+
Sbjct: 1185 CFNNGKC----IDRVGGYNCICPPGFVGERCEGDVNECLSNPCDPRGTQNCIQLVNDYRCECR-QGFTGRRCDSVVDGCKGLPCRNGGTCAVAS--------NTE-RGFICKCP--------------------------PGFDGATCEYDARTCGNLRCQNGGTCISVLKSSKCVCSEGYTGATCQYPVVSPCASRPCYNGGTCQFSPEEPFFQCFCPTNFNGLFCHI-----LDYGFIGGL 1382          
BLAST of Cell polarity protein vs. Ensembl Mouse
Match: Notch1 (notch 1 [Source:MGI Symbol;Acc:MGI:97363])

HSP 1 Score: 138.658 bits (348), Expect = 8.858e-32
Identity = 124/362 (34.25%), Postives = 162/362 (44.75%), Query Frame = 2
Query: 3428 CRNPL--KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDS--FCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  PL   C    C+N G C  L + +  C C  G++G+ C++ +  C  + C NGG+C  ++    C C   GF G  C Q    CS +   C++ G C  E G   C CR T H G  CE P   CS S C N G C    +    C C   GF GQ CE  +  C  N CKNGG CV   +   C+C PE+TG  C E     +   N C N GTC+ ++    C C   + G+ C E    C S  C+ G  C  R    YC+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   98 CLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQAD-PCASNPCANGGQCLPFESSYICRCP-PGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRAT-HTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLP-GFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPH-GRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQ-GYTGPRCEIDV 453          

HSP 2 Score: 136.346 bits (342), Expect = 4.878e-31
Identity = 115/357 (32.21%), Postives = 164/357 (45.94%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLE----------FCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +    +   C C  G+ G+ CE     C +  CR+G  C   +   +C C   G+ G NCE     C  + C N G C+       CDC     +G  CE+ I  C+ + C N   C    +   C C   GF G  CE     CT + C NGG CV   +  TC C P FTG  C  +  +C S  C + GTC  S    +C+C + + G  C+ + + C S  C  GG C   N   +C+C+ + + G  C++    C +            C +GG C     ++YC CQ G+ GS C+ E  EC PN C+N   C+    GF+C C   GY G +CSE++
Sbjct:  833 CATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQA-GYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTC-PVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECR-SGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCV-AGYHGSNCSEEI 1184          

HSP 3 Score: 102.064 bits (253), Expect = 1.049e-20
Identity = 108/346 (31.21%), Postives = 143/346 (41.33%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            N  +C    C + G C    I++  C C +GF G  C+     C    C+NG +C        C C+  G+ G +CE     C    C   G C        C C+   + G  CE  I  C    C + G C   +   +C C   G  G  CE  +  C SN C + G C+ +     C C P +TG  CN    +C+ + C N GTC        C C + +    C  E   C S+ C +G      NGY  CDC    + GT C+I    C    C NGG C+     Y C C+EGF G  CQ    EC  N C N G C     G+ C+C    Y G +C
Sbjct:  490 NTDECASSPCLHNGHCMD-KINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCT-EGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCQ-PGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLK-GTTGPNCEINLDDCASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGY-KCDCA-PGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCP-LPYTGATC 826          

HSP 4 Score: 102.064 bits (253), Expect = 1.122e-20
Identity = 116/386 (30.05%), Postives = 156/386 (40.41%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGI--------CSIENG-------LPVCDCRNTQ-HKGKVCEKPI------CSESF-----------CNN----RGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +P  C  G C++        +    C C  G+TG  CE     C    CR+GG C   D    C C   G  G NCE +   C+ + C +           C+ E G       + + +C  +  H G  CE  I      C E +           CN+     G C        CDC A G+ G  C+     C SN C NGG C    S   C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE+    C +  C   GVC+    Y    C   T ++G  C +    C    C +G +CQ  NG Y C CQ G+ G  C+ +  +C PN C N G C+   N   CDC   G+ G  C E +
Sbjct:  571 DPDPCHYGSCKD-------GVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCL-KGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDC-APGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFQGAFCEEDI 946          

HSP 5 Score: 102.064 bits (253), Expect = 1.262e-20
Identity = 104/316 (32.91%), Postives = 143/316 (45.25%), Query Frame = 2
Query: 3566 PRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQS-FCSDSFCQNNGICSI-ENGLPV---CDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHN-EQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSN--FCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P   C NGGRC + +    C CSG  F G  C+ S  C  + C+N G C + ++G  V   C C      G +C  P+   C  + C N G C +    +  C C   G+ G+ C++ + C SN C NGG C+P +S   C+C P F G  C +   +CS N   C + GTC+      +C+C     G  CE+    C    C  GG C+      + C C    + G  C  N+   CP   C NGG C      Y C C   + G  C E   EC   PN C+N G C   + G+ C C + G+ G  CSE +
Sbjct:   27 PSGTCLNGGRCEVANGTEACVCSG-AFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCP-LGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPP-GWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACL-PGFAGQNCEENV-DDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVN-GWTGEDCSENI 336          

HSP 6 Score: 101.679 bits (252), Expect = 1.557e-20
Identity = 108/364 (29.67%), Postives = 148/364 (40.66%), Query Frame = 2
Query: 3440 LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            + C    CQN G C         C C  GF G+ CE+    CP + C+NGG C        C C    + G  C +         + CQN G C   +G   C C N    G+ C + I  C+ + C     C+       C+C   G  G  C   + C SN C  G  C   P + +  C C   +TG  C    +E    +N C + G C  +    +C C + + G RCEI+   C S+ C     C  + G   C C    YEG  C I    C    C + G+C  +  ++ C+C +GF G  CQ +  EC    CKN   C    N +TC CT  GY G  C   +     +   YG
Sbjct:  220 VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPE-WTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGW-TGEDCSENIDDCASAACFQGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICM-PGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTE-GYTGTHCEVDIDECDPDPCHYG 578          

HSP 7 Score: 101.293 bits (251), Expect = 1.751e-20
Identity = 106/356 (29.78%), Postives = 152/356 (42.70%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS------------DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN----------ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV--CQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDC 4408
            +C+   C + G C Q +     C C +G+TG  C+ +   C    C+NGGRC+  + Q  C+C  +G+ G NC+    S               CQ+ G+C  E     C C+   + G  CE  +  CS + C N   C  +     C C A G+ G  C  EI  C S  C+NGG C+   +   C C     G  C           +    S  CFN+GTC        C+C   F G+RCE +   C S+ C   G   C  R    +C+C+   + G RC ++   C  + C NGG C V +     + C C  GF+G+ C+ + + C    C N G C       TC C
Sbjct: 1024 ECDSRPCLHGGTC-QDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECR-SGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQ-AGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVA-GYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECR-AGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLC 1374          

HSP 8 Score: 67.781 bits (164), Expect = 2.384e-10
Identity = 50/164 (30.49%), Postives = 69/164 (42.07%), Query Frame = 2
Query: 3980 GFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYP----YCDCQNTNYEGTRCNIP--KRCPLEFCSNGGNCQVRN-GQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            G +C++    S  C N G C ++N    C C+  F GQRC+    C S  C   G C + +        C C    + G  C  P    C    C NGG C +    +Y C C  G+ G  CQ+   C  N C N G C    + + C C   G+ G +C + V
Sbjct:   21 GLRCSQ---PSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCP-LGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCP-PGFHGPTCRQDV 179          

HSP 9 Score: 53.1434 bits (126), Expect = 8.103e-6
Identity = 34/88 (38.64%), Postives = 42/88 (47.73%), Query Frame = 2
Query: 4202 GTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKN 4465
            G RC+ P       C NGG C+V NG   C C   F G RCQ+   C    CKN G C V+++G T D   +   G S    +T L N
Sbjct:   21 GLRCSQPSG----TCLNGGRCEVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDN 104          
BLAST of Cell polarity protein vs. Ensembl Mouse
Match: Sned1 (sushi, nidogen and EGF-like domains 1 [Source:MGI Symbol;Acc:MGI:3045960])

HSP 1 Score: 130.954 bits (328), Expect = 1.288e-29
Identity = 109/320 (34.06%), Postives = 140/320 (43.75%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRC--YVHNEQPICDCTATGFIGQKCER------EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDF---CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE--CPPNFCKNDGICSVINNGFTCDCTH 4414
            C+C  GFTG +C      C    C+NGG C        C C   GF+G  CE  QS C +  CQN G C  E+   VC C+   + G  CE  +  CS   C N G C   V N   IC      F G +CE         C SN C+NGG CV  D    C+C   F G  C ER  +   C N G C  +N    C C   F G  CE E    P +    C  GG C    G   C C +T++  +  ++P  C  + C NGG+C      Y CEC  GF G  C++ +   C    C+N G C  + + + C C +
Sbjct:  297 CSCLAGFTGRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPA-GFKGPTCESAQSPCDNKVCQNGGQCQAESSSAVCVCQ-AGYTGATCETDVDECSSDPCQNGGSCVDLVGNYSCIC---VEPFEGPQCETGSYLVPSPCLSNPCQNGGTCVDADEGYVCECPEGFMGLDCRERILNDCDCRNGGRCLGANTT-LCQCPPGFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVC-HTDHNISH-SLPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHCEKARPHLCSSGPCRNGGTCKEMGDEYRCTCPY 608          

HSP 2 Score: 118.242 bits (295), Expect = 9.991e-26
Identity = 119/382 (31.15%), Postives = 148/382 (38.74%), Query Frame = 2
Query: 3383 GAINTYPLNSLDC---GGCRNPL------KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ------SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI-----------------------------------------CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK---CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK--RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKEC 4342
            G   T+ +NS  C    G + P        C+   CQN G C Q       C C  G+TG  CE     C  D C+NGG C        C C    F G  CE       S C  + CQN G C   +   VC+C      G  C + I ++  C N GRC   N   +C C   GF G  CE E+                                         C S+ C NGG C   +   TC+C   F G  C + +   CSS  C N GTC    +  +C+C   F G+ CEI K   C S  C+ GG C    G   CDC    + G  C I P  C    C NGG C+     + C CQ G+ G RCQ   +C
Sbjct:  323 GGTCTHGVNSFSCQCPAGFKGPTCESAQSPCDNKVCQNGGQC-QAESSSAVCVCQAGYTGATCETDVDECSSDPCQNGGSCVDLVGNYSCICV-EPFEGPQCETGSYLVPSPCLSNPCQNGGTCVDADEGYVCECPE-GFMGLDCRERILNDCDCRNGGRCLGANTT-LCQCPP-GFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDHNISHSLPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHCEKARPHLCSSGPCRNGGTCKEMGDEYRCTCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCP-PGFSGRHCEIAPSPCFRSPCMNGGTCEDLGTDFSCYCQPGYTGHRCQAEVDC 698          

HSP 3 Score: 105.916 bits (263), Expect = 6.241e-22
Identity = 131/460 (28.48%), Postives = 183/460 (39.78%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIE-FTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE---QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI-------CTSNFCKNGGLCVPRDSQPTCQ-------------CTPEFTGFQ---CNE-RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV---TGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSI 4708
            P  C+   C N G C     D   C C  GF G  CEK     C    CRNGG C     + +C C    F G +CE      C+   C N G C    G   CDC      G+ CE     C  S C N G C        C C   G+ G +C+ E+             +  G  V   +  TC+             C P+    Q   C E  +C S  C + G+C       QC C+  +EG  CE+E   C +  C  GG C+       C C    + G  C      C    C +GG C+   G Y C C EGF G  C+   + C  + C + G C   N   +C C   GY G  C++++   T L+ E  +   V    SPP GTT+ QV  G+          T+ ++DG   S + D     +D + + +Q ++ +  G+ Y +S+
Sbjct:  542 PSPCDSDPCFNGGSC-DAHEDSYTCECPRGFHGRHCEKARPHLCSSGPCRNGGTCKEMGDEYRCTCP-YRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDC-PPGFSGRHCEIAPSPCFRSPCMNGGTCEDLGTDFSCYCQP-GYTGHRCQAEVDCGHPEEVEHATMRFNGTHVGSVALYTCEPGFSLSALSHIRVCQPQGVWSQPPQCIEVDECRSQPCLHGGSCQDLIADYQCLCSPGYEGVHCELETDECQAQPCRNGGSCRDLPRAFICQCPE-GFVGIHCETEVDACASSPCQHGGRCEDGGGAYLCVCPEGFFGYNCETVSDPCFSSPCGSRGYCLASNGSHSCTC-KVGYTGKDCTKELLPPTALRVERVEESGVSISWSPPEGTTARQVLDGYAV--------TYASSDGS--SRRTD----FVDRSRSSHQLRA-LAAGRAYNISV 980          
BLAST of Cell polarity protein vs. Ensembl Mouse
Match: Notch3 (notch 3 [Source:MGI Symbol;Acc:MGI:99460])

HSP 1 Score: 124.02 bits (310), Expect = 2.485e-27
Identity = 108/362 (29.83%), Postives = 148/362 (40.88%), Query Frame = 2
Query: 3428 CRNPLKCEMGYCQNRGLCYQLAI---DKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYM-YDKQPKCDCSGTGFRGNNCEQSF--C-SDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C+    C  G C  RG+C    +    +  C C  GF G  C + +  C    C +G  C +  D +  C C   G++G +C+     C S + C++ G C    G   C C    + G +CE P+  C+ S C N G C   ++         GF GQ CE  +  C  + C NGG CV   +   CQC PE+TG  C E     +   N C N GTC+       C C   + G+ C      C +  C++G  C  R    YC C      G  C++   C    C     C     +G+  C C  GF G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   77 CQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQPD-PCVSRPCVHGAPCSVGPDGRFACACP-PGYQGQSCQSDIDECRSGTTCRHGGTCLNTPGSFRCQC-PLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACP-MGKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGR-GYTGPRCETDV 433          

HSP 2 Score: 122.865 bits (307), Expect = 5.034e-27
Identity = 110/357 (30.81%), Postives = 145/357 (40.62%), Query Frame = 2
Query: 3428 CRNPL-KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDC--SGTG-FRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLC--VPRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C NP+  C    C+N G C Q +     C C  GF G+ CE     CP   C NGG C        C C    TG F   + ++     + C N G C    G   C C N    G+ C + I  C+ + C +   C+       C C   G  G  C   + C SN C    +C   P   +  C C P FTG  C++   +CS  +N C + G C  +     C C + + G RCE +   C S  C     C  R G   C C    + GT C +    C    C NGG C+ R   + C C  GF GS CQ +  EC    C+N   C    +G+ C C   G+ G  C   V
Sbjct:  195 CENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGW-TGESCSQNIDDCATAVCFHGATCHDRVASFYCAC-PMGKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICM-AGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAE-GFEGTLCERNV 547          

HSP 3 Score: 117.857 bits (294), Expect = 1.853e-25
Identity = 111/384 (28.91%), Postives = 151/384 (39.32%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVC-QIRNGY----------PYCDCQN-------------------------TNYEGTRCN---IPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C  G C+N+  C    I +  C C  GFTG  CE     C    C NGG C        C C  +GF G+ C+     C+ + C+N   C  +     C C     +G +CE+ +  CS   C++ GRC        C C A G+ G +CE ++  C S  C+ GG C+    +  C+C P  TG  C  N   C+SN C   G C     R  C C   F G  C +E   C S  C  GG C    NG+          P C   N                           + G RC+    P  C  + C  GG C      + C C  GFQG +C+    C P+ C++ G C    +  T      G+ G  C + V
Sbjct:  435 ECLSGPCRNQATCLD-RIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCP-SGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEG-FEGTLCERNVDDCSPDPCHH-GRCVDGIASFSCAC-APGYTGIRCESQVDECRSQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPC-TFGVCRDGINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQDV 812          

HSP 4 Score: 116.316 bits (290), Expect = 5.387e-25
Identity = 106/347 (30.55%), Postives = 141/347 (40.63%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYM-YDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI----CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN-ERKCSSNFCFNDGTCYIS--NERPQCSCTKNFEGQRCEI---EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C++ G C         C C  G+TG  CE     C    CRNGG C    D    C C   GF G NCE +   C    C N G C        C C   +  G+ C + +       + C+N G C+       C C   G+ G+ C + I  C +  C +G  C  R +   C C    TG  C+ +  C SN C  D  C  +  + R  C+C   F G  C+    E    ++ C + G C    G   C C    Y G RC      C    C N   C  R GQ+ C C  GF G+ C+ +  EC  + C N G+C    NGF+C C  +G+ G  C   V
Sbjct:  169 CRHGGTCLNTP-GSFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACL-PGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQC-PPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCV-NGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC-GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCP-SGFSGSMCQLDV 509          

HSP 5 Score: 112.079 bits (279), Expect = 9.381e-24
Identity = 111/404 (27.48%), Postives = 154/404 (38.12%), Query Frame = 2
Query: 3419 CGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYM-YDKQPKCDCSGTGFRGNNCEQSF---CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI---------------------------------------CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK--CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLE-----------FCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C     P  CE   CQ  G C    I    C C+ GF G +CE +   C    C +GG C    D+   C C   G++G  C+Q        S C  +G C+   G   C C    + G  C++ I  C  + C + G C        C C   GF G +C R++                                       C+ + C NGG CV   S  +C C P +TG  C      C S  C + G C  ++   +C+C + F G +C+     C    C  GG C ++ G  YC C    + G  C+I      E            C  GG C  +   +YC C EG  GS C+ E   C    C++ G C     G+ C+C   GY G SC + +
Sbjct:  730 CSQSLAPDACESQPCQAGGTCTSDGIG-FRCTCAPGFQGHQCEVLS-PCTPSLCEHGGHCESDPDRLTVCSCP-PGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHRG-YTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCL-DGFAGPRCARDVDECLSSPCGPGTCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHCQYEADPCFSRPCLHGGICNPTHPGFECTCREGFTGSQCQNPVDWCSQAPCQNGGRC-VQTG-AYCICP-PGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGGYVCECP-AGYAGDSCEDNI 1124          

HSP 6 Score: 95.9005 bits (237), Expect = 8.609e-19
Identity = 101/346 (29.19%), Postives = 140/346 (40.46%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE-QSF-CSDS----------FCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKC-------SSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYG---GVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQ-----YYCECQEGFQGSRCQE-RKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C C EGFTG +C+     C +  C+NGGRC        C C   G+ G  C+ QS  C+++           CQ  G C  +     C C   +  G  CE  +  C+   C + G C  +    +C+C A G+ G  CE  I  C S  C+NGG C+   ++  C C P   G  C  NE  C       S   C ++GTC       +C+C   + G  CE +   C    C+        Q   G+  C C +  + G RC I    C  + C +GG C+   G+     + C C   F G RC+   + C    C     C     G  C C   G  G SC
Sbjct:  987 CTCREGFTGSQCQNPVDWCSQAPCQNGGRC--VQTGAYCICP-PGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGR-TGSHCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPA-GYAGDSCEDNIDECASQPCQNGGSCIDLVARYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFRCVC-HPGFTGPRCQIALSPCESQPCQHGGQCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACP-PGLSGPSC 1325          

HSP 7 Score: 95.1301 bits (235), Expect = 1.289e-18
Identity = 104/351 (29.63%), Postives = 137/351 (39.03%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC--EQSFCSDSFCQNNGIC-SIENGL----------PVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE-RKCSSNFCFNDGTCYISNER-PQCSCTKNFEGQRCE--IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C    C+  G C  L +DK  C C  G TG  CE     C  + C   G C     +  C C   GF G  C  E + C+ S C   G C   ENG           P+C   N     K C   +C ++    R  C      P C         Q    + C S  C+ GG C        C C P F G QC     C+ + C + G C    +R   CSC   ++G RC+  +++   +  C   G C    G   C C    Y G  C+     C    C +GG+CQ   G + C C +GF G RC ++  EC  + C   G C+     FTC C   GY G  C
Sbjct:  586 ECRSQPCRYGGKCLDL-VDKYLCRCPPGTTGVNCEVNIDDCASNPC-TFGVCRDGINRYDCVCQ-PGFTGPLCNVEINECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCVCEPGWSGPRCS--------QSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHR-GYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCARDVDECLSSPC-GPGTCTDHVASFTCACP-PGYGGFHC 922          

HSP 8 Score: 72.0182 bits (175), Expect = 1.450e-11
Identity = 98/393 (24.94%), Postives = 132/393 (33.59%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---------KPICSESFCNNRGRCY----------------VHNEQPICDCTA------------------------TGFIGQKCEREI--CTSNFCKNGGLCVPRDSQP-----TCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK---------RCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIPK---RCPLEFCSNGGNCQVRNGQYYC--ECQE---GFQGSRCQERKECPPNFCKNDGICSVINNGFTCD 4405
            CQ  G C         C C EG TG  CE     C    C++GG C  Y     C+C   G+ G++CE +   C+   CQN G C       +C C      G +CE           + S   C + G C                 +H E  I +C                           GF G +C+  +  C S  C++GG C     +      TC C P F G +C    R C    C     C  +   P+C+C     G  C + +          C S  C +GG C      P+  C     + G RC  P      P E       CQ + G   C  EC     G+ G  C    + P   C+      + NN   CD
Sbjct: 1056 CQEGGKCIDKGRSHY-CVCPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPA-GYAGDSCEDNIDECASQPCQNGGSCIDLVARYLCSCPPGT-LGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCESQPCQHGGQCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPGLSGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAAPEVPEEPRCPRAACQAKRGDQNCDRECNTPGCGWDGGDCSLNVDDPWRQCEALQCWRLFNNS-RCD 1444          

HSP 9 Score: 63.1586 bits (152), Expect = 6.834e-9
Identity = 49/154 (31.82%), Postives = 71/154 (46.10%), Query Frame = 2
Query: 4019 CFNDGTCYISNERPQ----CSCTKNFEGQRCEIEKRCPSDFCYYGGVCQ--IRNGYPYCDCQN-TNYEGTRCNIPKRCPLEFCSNGGNCQV-RNGQYYCECQEGFQGSRCQ-ERKECPP-NFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C N G C  ++++P     C C   + G+RC++E  C S  C   GVCQ  +  G     C+    ++G  C+ P  C    C +G  C V  +G++ C C  G+QG  CQ +  EC     C++ G C      F C C   GY G+ C   V
Sbjct:   49 CANGGRC--THQQPSLEAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQPDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPGSFRCQCP-LGYTGLLCENPV 199          

HSP 10 Score: 53.1434 bits (126), Expect = 6.352e-6
Identity = 98/417 (23.50%), Postives = 129/417 (30.94%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE---------QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCN------------NRGRCYVH---------------NEQP-------------------ICDCTATGFIGQKCER--EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK----------CSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEI---------EKRCPSDFC-------------------YYGGVCQIRNGYPYCDCQNTN----YEGTRCNIPKRCPLEF-----CSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGI 4372
            C    CQ+ G C +  +    C C  G+ G+ CE     C    C+NGG C     +  C C   G  G  CE          S  S   C +NG C    G   C+C    + G  CE  I  C    C+               RC  H                 QP                    C C    F G +CER    C    C  G  C      P C C P  +G  C   +          C+S  C + G+C      P  +C C   + G RCE          E RCP   C                   + GG C +    P+  C+       +  +RC+     P        C +GG  +  N  Y   C + F   RC +   C    C  DG+
Sbjct: 1089 CTAQPCQHGGTC-RGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCIDLVARYLCSCP-PGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNC-PPGYTGLHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCESQPCQHGGQCRHSLGRGGGLTFTCHCVPP-FWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPGLSGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAAPEVPEEPRCPRAACQAKRGDQNCDRECNTPGCGWDGGDCSLNVDDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADHFADGRCDQ--GCNTEECGWDGL 1499          
BLAST of Cell polarity protein vs. Ensembl Mouse
Match: Tnxb (tenascin XB [Source:MGI Symbol;Acc:MGI:1932137])

HSP 1 Score: 119.013 bits (297), Expect = 9.263e-26
Identity = 109/341 (31.96%), Postives = 142/341 (41.64%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVC-------DC------RNTQHKGKVCEKPIC---------------SESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEK 4447
            C C  G++GE C     TCPRD CR  GRC    +  +C C   G+ G++C    C    C   G C  E+G  VC       DC      R+ + +G+ CE  +C                   C  RG C    E   C C   G+ G+ C    C  + C+  G CV       C C P FTG  C  R+C  + C   G C    E   C C   + G  C   + CPSD C   G C   NG   C+C +  Y G  C I +RCP + CS  G CQ       C C  G+ G  C  R  CP + C+  G C    +G  C C + GY G +C+ +
Sbjct:  344 CVCWPGYSGEDCST--RTCPRD-CRGRGRC----EDGECICDA-GYSGDDCGVRSCPGD-CNQRGHC--EDGRCVCWPGYTGADCSTRACPRDCRGRGR-CEDGVCVCHAGYSGEDCGVRSCPGDCRGRGNC----ESGRCVCWP-GYTGRDCGTRACPGD-CRGRGRCV----DGRCVCNPGFTGEDCGSRRCPGD-CRGHGHC----ENGVCVCAVGYSGDDCST-RSCPSD-CRGRGQCL--NG--LCEC-DEGYSGEDCGI-RRCPRD-CSQHGVCQ----DGLCMCHAGYAGEDCSIRT-CPAD-CRRRGRCE---DG-RCVC-NPGYTGPACATR 637          

HSP 2 Score: 103.605 bits (257), Expect = 4.586e-21
Identity = 99/331 (29.91%), Postives = 128/331 (38.67%), Query Frame = 2
Query: 3416 DCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYG----GVCQIRNGYPYCDCQNTNYEGTRCNIPKRC-PLEFCSNG-------------------GNCQVRNG--QYYCECQEGFQGSRCQE 4330
            DCG    P     G C+ RG C     +   C C  G+TG  C      CP D CR  GRC       +C C+  GF G +C    C    C+ +G C  ENG+ VC      + G  C    C  S C  RG+C       +C+C   G+ G+ C    C  + C   G+C        C C   + G  C+ R C ++ C   G C    E  +C C   + G  C   + CP+D    G    GVC    GY   DC       + C  P  C P E C  G                   G+C+ R    Q  C CQEG+ G  C E
Sbjct:  447 DCGVRSCP-----GDCRGRGNC-----ESGRCVCWPGYTGRDCGT--RACPGD-CRGRGRCV----DGRCVCN-PGFTGEDCGSRRCPGD-CRGHGHC--ENGVCVC---AVGYSGDDCSTRSCP-SDCRGRGQCL----NGLCECDE-GYSGEDCGIRRCPRD-CSQHGVC----QDGLCMCHAGYAGEDCSIRTCPAD-CRRRGRC----EDGRCVCNPGYTGPACAT-RTCPADCRGRGRCVQGVCMCYVGYSGEDCGQEEPPASAC--PGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGRCVCQEGYAGDDCGE 734          

HSP 3 Score: 101.293 bits (251), Expect = 2.075e-20
Identity = 109/381 (28.61%), Postives = 145/381 (38.06%), Query Frame = 2
Query: 3422 GGCRNPLKCEMGYCQN--RGLCYQ---LAIDKLGCNCSEGFTGEKCEKIEFT-----------CPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRN-----GYPYCDCQ---------------------NTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            GGC  P   + G  Q   R LC       + +  C+C  G+ G  C     T           CP D C + GRC     + +C C   G+ G +C    C    CQ  G C       VC CR     G  C +  C  + CN RGRC    E+  C C   G+ G+ C    C    C   G C        C C P ++G  C  R C    C   G C    E  +C C   + G+ C + + CP D C  GG C         GY   DC                      +  Y G  C + + CP + C+  G+C+  +G+  C C  G+ G+ C  R  CP + C+  G C    +G  C C H GY G  C
Sbjct:  112 GGC-CPTAAQAGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPED-CNDQGRCV----RGRCVCF-PGYSGPSCSWPSCPGD-CQGRGRCV----KGVCVCR-AGFSGPDCSQRSCPRN-CNQRGRC----EEGRCVCDP-GYSGEDCGVRSCPRG-CSQRGRC----ENGLCVCNPGYSGEDCGVRNCPRG-CSQRGRC----EDGRCVCDPGYSGEDCSM-RTCPWD-CGDGGRCVDGRCVCWPGYSGEDCSTRTCPRDCRGRGRCEDGECICDAGYSGDDCGV-RSCPGD-CNQRGHCE--DGR--CVCWPGYTGADCSTRA-CPRD-CRGRGRCE---DG-VCVC-HAGYSGEDC 448          
BLAST of Cell polarity protein vs. Ensembl Mouse
Match: Tnxb (tenascin XB [Source:MGI Symbol;Acc:MGI:1932137])

HSP 1 Score: 118.242 bits (295), Expect = 1.585e-25
Identity = 109/341 (31.96%), Postives = 140/341 (41.06%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVC-------DC------RNTQHKGKVCEKPIC---------------SESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEK 4447
            C C  G++GE C     TCPRD CR  GRC    +  +C C   G+ G++C    C    C   G C  E+G  VC       DC      R+ + +G+ CE  +C                   C  RG C    E   C C   G+ G+ C    C  + C+  G CV       C C P FTG  C  R+C  + C   G C    E   C C   + G  C   + CPSD C   G C   NG   CD     Y G  C I +RCP + CS  G CQ       C C  G+ G  C  R  CP + C+  G C    +G  C C + GY G +C+ +
Sbjct:  344 CVCWPGYSGEDCST--RTCPRD-CRGRGRC----EDGECICDA-GYSGDDCGVRSCPGD-CNQRGHC--EDGRCVCWPGYTGADCSTRACPRDCRGRGR-CEDGVCVCHAGYSGEDCGVRSCPGDCRGRGNC----ESGRCVCWP-GYTGRDCGTRACPGD-CRGRGRCV----DGRCVCNPGFTGEDCGSRRCPGD-CRGHGHC----ENGVCVCAVGYSGDDCST-RSCPSD-CRGRGQCL--NGLCECD---EGYSGEDCGI-RRCPRD-CSQHGVCQ----DGLCMCHAGYAGEDCSIRT-CPAD-CRRRGRCE---DG-RCVC-NPGYTGPACATR 637          

HSP 2 Score: 102.834 bits (255), Expect = 7.224e-21
Identity = 99/331 (29.91%), Postives = 128/331 (38.67%), Query Frame = 2
Query: 3416 DCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYG----GVCQIRNGYPYCDCQNTNYEGTRCNIPKRC-PLEFCSNG-------------------GNCQVRNG--QYYCECQEGFQGSRCQE 4330
            DCG    P     G C+ RG C     +   C C  G+TG  C      CP D CR  GRC       +C C+  GF G +C    C    C+ +G C  ENG+ VC      + G  C    C  S C  RG+C       +C+C   G+ G+ C    C  + C   G+C        C C   + G  C+ R C ++ C   G C    E  +C C   + G  C   + CP+D    G    GVC    GY   DC       + C  P  C P E C  G                   G+C+ R    Q  C CQEG+ G  C E
Sbjct:  447 DCGVRSCP-----GDCRGRGNC-----ESGRCVCWPGYTGRDCGT--RACPGD-CRGRGRCV----DGRCVCN-PGFTGEDCGSRRCPGD-CRGHGHC--ENGVCVC---AVGYSGDDCSTRSCP-SDCRGRGQCL----NGLCECDE-GYSGEDCGIRRCPRD-CSQHGVC----QDGLCMCHAGYAGEDCSIRTCPAD-CRRRGRC----EDGRCVCNPGYTGPACAT-RTCPADCRGRGRCVQGVCMCYVGYSGEDCGQEEPPASAC--PGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGRCVCQEGYAGDDCGE 734          

HSP 3 Score: 100.523 bits (249), Expect = 3.161e-20
Identity = 109/381 (28.61%), Postives = 145/381 (38.06%), Query Frame = 2
Query: 3422 GGCRNPLKCEMGYCQN--RGLCYQ---LAIDKLGCNCSEGFTGEKCEKIEFT-----------CPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRN-----GYPYCDCQ---------------------NTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            GGC  P   + G  Q   R LC       + +  C+C  G+ G  C     T           CP D C + GRC     + +C C   G+ G +C    C    CQ  G C       VC CR     G  C +  C  + CN RGRC    E+  C C   G+ G+ C    C    C   G C        C C P ++G  C  R C    C   G C    E  +C C   + G+ C + + CP D C  GG C         GY   DC                      +  Y G  C + + CP + C+  G+C+  +G+  C C  G+ G+ C  R  CP + C+  G C    +G  C C H GY G  C
Sbjct:  112 GGC-CPTAAQAGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPED-CNDQGRCV----RGRCVCF-PGYSGPSCSWPSCPGD-CQGRGRCV----KGVCVCR-AGFSGPDCSQRSCPRN-CNQRGRC----EEGRCVCDP-GYSGEDCGVRSCPRG-CSQRGRC----ENGLCVCNPGYSGEDCGVRNCPRG-CSQRGRC----EDGRCVCDPGYSGEDCSM-RTCPWD-CGDGGRCVDGRCVCWPGYSGEDCSTRTCPRDCRGRGRCEDGECICDAGYSGDDCGV-RSCPGD-CNQRGHCE--DGR--CVCWPGYTGADCSTRA-CPRD-CRGRGRCE---DG-VCVC-HAGYSGEDC 448          
BLAST of Cell polarity protein vs. UniProt/SwissProt
Match: sp|P21783|NOTC1_XENLA (Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3)

HSP 1 Score: 144.436 bits (363), Expect = 1.008e-32
Identity = 117/357 (32.77%), Postives = 165/357 (46.22%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCP----------LEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G C +    +   C C  G+ G+ CE     C    CRNG  C   +   KC+C   G+ G NCE     C  + C N G CS    +  C+C     +G  CE+ I  C+ + C N   C        C C   GF G  CE     CT + C NGG C+   +  TCQC P FTG  C     +C S  C N GTC  S    +C+C + + G  C+ + + C S  C  GG C   N +  C+C+ + + G  C++P   C           +  C N G C      ++C CQ G+ GS C+E+  EC PN C+N   C+    G++C+C   GY G++CSE++
Sbjct:  832 CAGSPCKNGGRCKESEDFETFSCECPPGWQGQTCEIDMNECVNRPCRNGATCQNTNGSYKCNCK-PGYTGRNCEMDIDDCQPNPCHNGGSCSDGINMFFCNCP-AGFRGPKCEEDINECASNPCKNGANCTDCVNSYTCTCQP-GFSGIHCESNTPDCTESSCFNGGTCIDGINTFTCQCPPGFTGSYCQHDINECDSKPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECK-SGWTGVYCDVPSVSCEVAAKQQGVDIVHLCRNSGMCVDTGNTHFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECV-AGYHGVNCSEEI 1183          

HSP 2 Score: 116.316 bits (290), Expect = 4.195e-24
Identity = 111/333 (33.33%), Postives = 143/333 (42.94%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDC 4408
            +C    C + G C    I++  C+C  GF+G  C+     C    C+NG +C        C C+  GF G +CEQ    C    C   G C        C CR   + G++C+  I  C    C N G+C       IC C   G  G  CE +I  C SN C NG  C+ +     C C P +TG  CN    +C SN C N GTC        C C   +    C  E   C S+ C +G      NGY  CDC+   + G+ C+I    C    C NGG C+   G Y C C+ GF G  CQ    EC  N C N G C     G+ C+C
Sbjct:  492 ECASNPCLHNGKCID-KINEFRCDCPTGFSGNLCQHDFDECTSTPCKNGAKCLDGPNSYTCQCT-EGFTGRHCEQDINECIPDPCHY-GTCKDGIATFTCLCR-PGYTGRLCDNDINECLSKPCLNGGQCTDRENGYICTC-PKGTTGVNCETKIDDCASNLCDNGK-CIDKIDGYECTCEPGYTGKLCNININECDSNPCRNGGTCKDQINGFTCVCPDGYHDHMCLSEVNECNSNPCIHGACHDGVNGY-KCDCE-AGWSGSNCDINNNECESNPCMNGGTCKDMTGAYICTCKAGFSGPNCQTNINECSSNPCLNHGTCIDDVAGYKCNC 816          

HSP 3 Score: 113.235 bits (282), Expect = 3.098e-23
Identity = 125/402 (31.09%), Postives = 171/402 (42.54%), Query Frame = 2
Query: 3428 CRNPLKCEM-GYCQNRGLCYQL----AIDKLGCNCSEGFTGEKC-EKIEFTCPRDFCRNGGRCYMYDK--QPKCDCS------------------------------------GTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCT-ATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C+ P  C +   C N G C  +    AID + C+C  GFT + C   ++  C  + CRNGG C + +   + KC C                                       GF G  C+Q    CS + C+N G C  E G   C C+N +  G+ C++P   C+ S C N G C   ++    DCT   GF GQ CE  I  C SN C+NGG CV   +   CQC P++TG  C E     +   N C N GTC+ +     C C   + G+ C E    C +  C+ G  C  R    YC+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C  +  EC    N C++ G C+     F C+C   GY G  C   V
Sbjct:   56 CQFPNPCTIKNQCMNFGTCEPVLQGNAIDFI-CHCPVGFTDKVCLTPVDNACVNNPCRNGGTCELLNSVTEYKCRCPPGWTGDSCQQADPCASNPCANGGKCLPFEIQYICKCPPGFHGATCKQDINECSQNPCKNGGQCINEFGSYRCTCQN-RFTGRNCDEPYVPCNPSPCLNGGTCRQTDDTSY-DCTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFYCECPH-GRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQ-GYAGPRCEIDV 452          

HSP 4 Score: 105.916 bits (263), Expect = 4.948e-21
Identity = 111/354 (31.36%), Postives = 151/354 (42.66%), Query Frame = 2
Query: 3440 LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE-ICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            + C    C N G C Q       C C  GF+G+ CE+    CP + CRNGG C        C C    + G  C +         + CQN G C    G   C C N    G+ C + I  C+ + C++   C+       C+C   G  G  C  +  C SN C  G  C   P + +  C C P +TG  CN    +CS  +N C + G C  +    QC+C + + G RCEI+   C S+ C     C  + G   C C    YEG  C  NI   C    C + G C  +  ++ C+C  GF G+ CQ    EC    CKN   C    N +TC CT  G+ G  C + +
Sbjct:  219 VPCNPSPCLNGGTCRQTDDTSYDCTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCP-PDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGW-TGEDCSENIDDCANAACHSGATCHDRVASFYCEC-PHGRTGLLCHLDNACISNPCNEGSNCDTNPVNGKAICTCPPGYTGPACNNDVDECSLGANPCEHGGRCTNTLGSFQCNCPQGYAGPRCEIDVNECLSNPCQNDSTCLDQIGEFQCICM-PGYEGLYCETNI-DECASNPCLHNGKCIDKINEFRCDCPTGFSGNLCQHDFDECTSTPCKNGAKCLDGPNSYTCQCTE-GFTGRHCEQDI 566          

HSP 5 Score: 103.99 bits (258), Expect = 1.897e-20
Identity = 104/325 (32.00%), Postives = 139/325 (42.77%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGK-VCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C C +G TG  CE     C  + C NG +C       +C C   G+ G  C  +   C  + C+N G C  +     C C +  H    + E   C+ + C   G C+       CDC A G+ G  C+     C SN C NGG C        C C   F+G  C  N  +CSSN C N GTC       +C+C   + G  CE +   C    C  GG C+    +    C+    ++G  C I    C    C NG  CQ  NG Y C C+ G+ G  C+ +  +C PN C N G CS   N F C+C   G+ G  C E +
Sbjct:  626 CTCPKGTTGVNCETKIDDCASNLCDNG-KCIDKIDGYECTCE-PGYTGKLCNININECDSNPCRNGGTCKDQINGFTCVCPDGYHDHMCLSEVNECNSNPCI-HGACHDGVNGYKCDCEA-GWSGSNCDINNNECESNPCMNGGTCKDMTGAYICTCKAGFSGPNCQTNINECSSNPCLNHGTCIDDVAGYKCNCMLPYTGAICEAVLAPCAGSPCKNGGRCKESEDFETFSCECPPGWQGQTCEIDMNECVNRPCRNGATCQNTNGSYKCNCKPGYTGRNCEMDIDDCQPNPCHNGGSCSDGINMFFCNCP-AGFRGPKCEEDI 945          

HSP 6 Score: 100.138 bits (248), Expect = 3.216e-19
Identity = 108/371 (29.11%), Postives = 162/371 (43.67%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS------------DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNF--------CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV---CQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C+   C N G C Q +     C C +G+TG  C+ +   C    C+NGG+C+  +   +C+C  +G+ G  C+    S               C+N+G+C        C C+   + G  CE+ +  CS + C N   C  +     C+C A G+ G  C  EI  C S+ C+NGG C+   +   C C     G  C  N   C+  +        CFN+G C        C C   F G+RCE +   C S+ C   G     Q+ N Y  C+C+   + G RC ++   C    C NGG C V +     + C+C  GF G+ C+ + + C    C+N G C  +     C C+  GY G +C   V
Sbjct: 1023 ECDSKPCLNGGTC-QDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNFYRCECK-SGWTGVYCDVPSVSCEVAAKQQGVDIVHLCRNSGMCVDTGNTHFCRCQ-AGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVA-GYHGVNCSEEINECLSHPCQNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCTPFYDSFTLEPKCFNNGKCIDRVGGYNCICPPGFVGERCEGDVNECLSNPCDSRGTQNCIQLVNDY-RCECRQ-GFTGRRCESVVDGCKGMPCRNGGTCAVASNTERGFICKCPPGFDGATCEYDSRTCSNLRCQNGGTCISVLTSSKCVCSE-GYTGATCQYPV 1386          

HSP 7 Score: 95.1301 bits (235), Expect = 9.568e-18
Identity = 106/345 (30.72%), Postives = 143/345 (41.45%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK----CDCSGTGFRGNNC---EQSFCSDSFCQNNGICSIENGLPVCDCR-NTQHKGKVCEKP-ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERP-QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C N G C         C C   + GE+C+       ++ C N G C    +       C C   GF    C     + C ++ C+N G C + N +    CR      G  C++   C+ + C N G+C     Q IC C   GF G  C+++I  C+ N CKNGG C+       C C   FTG  C+E    C+ + C N GTC  +++    C+C   F GQ CE     CPS+ C  GG C        C C   ++ G  C      C L    C NGG C    G Y C C  G+ G  C E   +C    C +   C      F C+C H G  G+ C
Sbjct:   29 CLNGGRCEMTPGGTGVCLCGNLYFGERCQFPNPCTIKNQCMNFGTCEPVLQGNAIDFICHCP-VGFTDKVCLTPVDNACVNNPCRNGGTCELLNSVTEYKCRCPPGWTGDSCQQADPCASNPCANGGKCLPFEIQYICKC-PPGFHGATCKQDINECSQNPCKNGGQCINEFGSYRCTCQNRFTGRNCDEPYVPCNPSPCLNGGTCRQTDDTSYDCTCLPGFSGQNCEENIDDCPSNNCRNGGTCVDGVNTYNCQCP-PDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVNGWTGEDCSENIDDCANAACHSGATCHDRVASFYCECPH-GRTGLLC 369          

HSP 8 Score: 92.8189 bits (229), Expect = 5.262e-17
Identity = 105/329 (31.91%), Postives = 140/329 (42.55%), Query Frame = 2
Query: 3572 DFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE-QSFCS-DSFCQNNGICSI---ENGLP-VCDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHNE--QPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIY 4495
            + C NGGRC M          G  + G  C+  + C+  + C N G C      N +  +C C       KVC  P+   C  + C N G C + N   +  C C   G+ G  C++ + C SN C NGG C+P + Q  C+C P F G  C +   +CS N C N G C       +C+C   F G+ C E    C    C  GG C+  +   Y C C    + G  C  NI   CP   C NGG C      Y C+C   + G  C E   EC   PN C+N G C     G+ C C + G+ G  CSE +    N     G   +
Sbjct:   27 EMCLNGGRCEMTPGGTGVCLCGNLYFGERCQFPNPCTIKNQCMNFGTCEPVLQGNAIDFICHCP-VGFTDKVCLTPVDNACVNNPCRNGGTCELLNSVTEYKCRCPP-GWTGDSCQQADPCASNPCANGGKCLPFEIQYICKCPPGFHGATCKQDINECSQNPCKNGGQCINEFGSYRCTCQNRFTGRNCDEPYVPCNPSPCLNGGTCRQTDDTSYDCTCL-PGFSGQNCEENI-DDCPSNNCRNGGTCVDGVNTYNCQCPPDWTGQYCTEDVDECQLMPNACQNGGTCHNTYGGYNCVCVN-GWTGEDCSENIDDCANAACHSGATCH 350          

HSP 9 Score: 65.4698 bits (158), Expect = 9.163e-9
Identity = 79/248 (31.85%), Postives = 104/248 (41.94%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDF--------CRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPV-----CDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQP---ICDCTATGFIGQKCERE--ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE---RKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEI 4105
            +C    CQN G C  L I+   C+C  G  G  CE     C   +        C N G+C        C C   GF G  CE     C  + C + G    +N + +     C+CR     G+ CE  +  C    C N G C V +      IC C   GF G  CE +   C++  C+NGG C+   +   C C+  +TG  C       C+S+ C+N GTC    E P  QC C KNF G  C I
Sbjct: 1185 ECLSHPCQNGGTCIDL-INTYKCSCPRGTQGVHCEINVDDCTPFYDSFTLEPKCFNNGKCIDRVGGYNCICP-PGFVGERCEGDVNECLSNPCDSRGT---QNCIQLVNDYRCECRQG-FTGRRCESVVDGCKGMPCRNGGTCAVASNTERGFICKCPP-GFDGATCEYDSRTCSNLRCQNGGTCISVLTSSKCVCSEGYTGATCQYPVISPCASHPCYNGGTCQFFAEEPFFQCFCPKNFNGLFCHI 1425          
BLAST of Cell polarity protein vs. UniProt/SwissProt
Match: sp|Q07008|NOTC1_RAT (Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3)

HSP 1 Score: 139.813 bits (351), Expect = 2.564e-31
Identity = 125/362 (34.53%), Postives = 162/362 (44.75%), Query Frame = 2
Query: 3428 CRNPLK--CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDS--FCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  PL   C    C+N G C  L + +  C C  G++G+ C++ +  C  + C NGG+C  ++    C C   GF G  C Q    CS +   C++ G C  E G   C CR T H G  CE P   CS S C N G C    +    C C   GF GQ CE  +  C  N CKNGG CV   +   C+C PE+TG  C E     +   N C N GTC+ S+    C C   + G+ C E    C S  C+ G  C  R    YC+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   98 CLTPLANACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQAD-PCASNPCANGGQCLPFESSYICGCP-PGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRAT-HTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLP-GFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPH-GRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQ-GYTGPRCEIDV 453          

HSP 2 Score: 137.502 bits (345), Expect = 1.536e-30
Identity = 116/357 (32.49%), Postives = 165/357 (46.22%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLE----------FCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +    +   C C  G+ G+ CE     C +  CR+G  C   +   +C C   G+ G NCE     C  + C N G C+       CDC     +G  CE+ I  C+ + C N   C    +   C C  TGF G  CE     CT + C NGG CV   +  TC C P FTG  C  +  +C S  C + GTC  S    +C+C + + G  C+ + + C S  C  GG C   N   +C+C+ + + G  C++    C +            C +GG C     ++YC CQ G+ GS C+ E  EC PN C+N   C+    GF+C C   GY G +CSE++
Sbjct:  833 CATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQA-GYTGRNCESDIDDCRPNPCHNGGSCTDGVNAAFCDCL-PGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTC-PTGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQYHCECR-SGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCV-AGYHGSNCSEEI 1184          

HSP 3 Score: 103.219 bits (256), Expect = 3.475e-20
Identity = 117/386 (30.31%), Postives = 156/386 (40.41%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGI--------CSIENG-------LPVCDCRNTQ-HKGKVCEKPI------CSESF-----------CNN----RGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +P  C  G C++        +    C C  G+TG  CE     C    CR+GG C   D    C C   G  G NCE +   C+ + C +           C+ E G       + + +C  +  H G  CE  I      C E +           CN+     G C        CDC A G+ G  C+     C SN C NGG C    S   C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE+    C +  C   GVC+    Y    C   T ++G  C I    C    C +G +CQ  NG Y C CQ G+ G  C+ +  +C PN C N G C+   N   CDC   G+ G  C E +
Sbjct:  571 DPDPCHYGLCKD-------GVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNYYLCLCL-KGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDC-APGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGVNAAFCDCL-PGFQGAFCEEDI 946          

HSP 4 Score: 103.219 bits (256), Expect = 3.624e-20
Identity = 107/343 (31.20%), Postives = 144/343 (41.98%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C    C + G C    I++  C C +GF+G  C+     C    C+NG +C        C C+  G+ G +CE     C    C   G+C        C C+   + G  CE  I  C    C + G C   +   +C C   G  G  CE  +  C SN C + G C+ +     C C P +TG  CN    +C+ + C N GTC        C C + +    C  E   C S+ C +G      NGY  CDC    + GT C+I    C    C NGG C+     Y C C+EGF G  CQ    EC  N C N G C     G+ C+C    Y G +C
Sbjct:  493 ECASSPCLHNGRCVD-KINEFLCQCPKGFSGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCT-EGYTGTHCEVDIDECDPDPCHY-GLCKDGVATFTCLCQ-PGYTGHHCETNINECHSQPCRHGGTCQDRDNYYLCLCL-KGTTGPNCEINLDDCASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGY-KCDCA-PGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCP-LPYTGATC 826          

HSP 5 Score: 101.293 bits (251), Expect = 1.389e-19
Identity = 108/364 (29.67%), Postives = 147/364 (40.38%), Query Frame = 2
Query: 3440 LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            + C    CQN G C         C C  GF G+ CE+    CP + C+NGG C        C C    + G  C +         + CQN G C   +G   C C N    G+ C + I  C+ + C     C+       C+C   G  G  C   + C SN C  G  C   P + +  C C   +TG  C    +E    +N C + G C  +    +C C + + G RCEI+   C S+ C     C  + G   C C    YEG  C I    C    C + G C  +  ++ C+C +GF G  CQ +  EC    CKN   C    N +TC CT  GY G  C   +     +   YG
Sbjct:  220 VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPE-WTGQYCTEDVDECQLMPNACQNGGTCHNSHGGYNCVCVNGW-TGEDCSENIDDCASAACFQGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICM-PGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTE-GYTGTHCEVDIDECDPDPCHYG 578          

HSP 6 Score: 99.3673 bits (246), Expect = 5.022e-19
Identity = 105/356 (29.49%), Postives = 152/356 (42.70%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS------------DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN----------ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV--CQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDC 4408
            +C+   C + G C Q +     C C +G+TG  C+ +   C    C+NGG+C+  + Q  C+C  +G+ G NC+    S               CQ+ G+C  E     C C+   + G  CE  +  CS + C N   C  +     C C A G+ G  C  EI  C S  C+NGG C+   +   C C     G  C           +    S  CFN+GTC        C+C   F G+RCE +   C S+ C   G   C  R    +C+C+   + G RC ++   C  + C NGG C V +     + C C  GF+G+ C+ + + C    C N G C       TC C
Sbjct: 1024 ECDSRPCLHGGTC-QDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQYHCECR-SGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQ-AGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVA-GYHGSNCSEEINECLSQPCQNGGTCIDLTNTYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECR-AGHTGRRCESVINGCRGKPCRNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLC 1374          

HSP 7 Score: 99.3673 bits (246), Expect = 5.416e-19
Identity = 104/316 (32.91%), Postives = 142/316 (44.94%), Query Frame = 2
Query: 3566 PRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ-SFCSDSFCQNNGIC-SIENGLPV---CDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHN-EQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSN--FCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P   C NGGRC + +    C CSG  F G  C+  S C  + C+N G C  +++G  V   C C      G +C  P+   C  + C N G C +    +  C C   G+ G+ C++ + C SN C NGG C+P +S   C C P F G  C +   +CS N   C + GTC+      +C+C     G  CE+    C    C  GG C+      + C C    + G  C  N+   CP   C NGG C      Y C C   + G  C E   EC   PN C+N G C   + G+ C C + G+ G  CSE +
Sbjct:   27 PSGTCLNGGRCEVANGTEACVCSGA-FVGQRCQDPSPCLSTPCKNAGTCYVVDHGGIVDYACSCP-LGFSGPLCLTPLANACLANPCRNGGTCDLLTLTEYKCRCPP-GWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACL-PGFAGQNCEENV-DDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNSHGGYNCVCVN-GWTGEDCSENI 336          

HSP 8 Score: 93.2041 bits (230), Expect = 3.795e-17
Identity = 110/356 (30.90%), Postives = 144/356 (40.45%), Query Frame = 2
Query: 3440 LKCEM--GYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDK----QPKCDCSGTGFRGNNCEQSF---CSDSFCQNNGICSIENGLPVCDCR-NTQHKGKVCEKP-ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSN--FCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERP-QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            L+C    G C N G C ++A     C CS  F G++C+     C    C+N G CY+ D        C C   GF G  C       C  + C+N G C +   L    CR      GK C++   C+ + C N G+C       IC C   GF G  C +++  C+ N   C++GG C        C C    TG  C      CS + C N GTC  + +   +C+C   F GQ CE     CP + C  GG C        C C    + G  C      C L    C NGG C   +G Y C C  G+ G  C E   +C    C     C      F C+C H G  G+ C
Sbjct:   22 LRCSQPSGTCLNGGRC-EVANGTEACVCSGAFVGQRCQDPS-PCLSTPCKNAGTCYVVDHGGIVDYACSCP-LGFSGPLCLTPLANACLANPCRNGGTCDLLT-LTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGC-PPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCP-PEWTGQYCTEDVDECQLMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPH-GRTGLLC 370          

HSP 9 Score: 67.0106 bits (162), Expect = 3.404e-9
Identity = 50/164 (30.49%), Postives = 69/164 (42.07%), Query Frame = 2
Query: 3980 GFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYP----YCDCQNTNYEGTRCNIP--KRCPLEFCSNGGNCQVRN-GQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            G +C++    S  C N G C ++N    C C+  F GQRC+    C S  C   G C + +        C C    + G  C  P    C    C NGG C +    +Y C C  G+ G  CQ+   C  N C N G C    + + C C   G+ G +C + V
Sbjct:   21 GLRCSQ---PSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDPSPCLSTPCKNAGTCYVVDHGGIVDYACSCP-LGFSGPLCLTPLANACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCP-PGFHGPTCRQDV 179          
BLAST of Cell polarity protein vs. UniProt/SwissProt
Match: sp|Q01705|NOTC1_MOUSE (Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3)

HSP 1 Score: 138.658 bits (348), Expect = 6.196e-31
Identity = 124/362 (34.25%), Postives = 162/362 (44.75%), Query Frame = 2
Query: 3428 CRNPL--KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDS--FCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  PL   C    C+N G C  L + +  C C  G++G+ C++ +  C  + C NGG+C  ++    C C   GF G  C Q    CS +   C++ G C  E G   C CR T H G  CE P   CS S C N G C    +    C C   GF GQ CE  +  C  N CKNGG CV   +   C+C PE+TG  C E     +   N C N GTC+ ++    C C   + G+ C E    C S  C+ G  C  R    YC+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   98 CLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQAD-PCASNPCANGGQCLPFESSYICRCP-PGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRAT-HTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLP-GFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPH-GRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQ-GYTGPRCEIDV 453          

HSP 2 Score: 136.346 bits (342), Expect = 3.412e-30
Identity = 115/357 (32.21%), Postives = 164/357 (45.94%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLE----------FCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +    +   C C  G+ G+ CE     C +  CR+G  C   +   +C C   G+ G NCE     C  + C N G C+       CDC     +G  CE+ I  C+ + C N   C    +   C C   GF G  CE     CT + C NGG CV   +  TC C P FTG  C  +  +C S  C + GTC  S    +C+C + + G  C+ + + C S  C  GG C   N   +C+C+ + + G  C++    C +            C +GG C     ++YC CQ G+ GS C+ E  EC PN C+N   C+    GF+C C   GY G +CSE++
Sbjct:  833 CATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQA-GYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTC-PVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECR-SGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCV-AGYHGSNCSEEI 1184          

HSP 3 Score: 102.064 bits (253), Expect = 7.338e-20
Identity = 108/346 (31.21%), Postives = 143/346 (41.33%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            N  +C    C + G C    I++  C C +GF G  C+     C    C+NG +C        C C+  G+ G +CE     C    C   G C        C C+   + G  CE  I  C    C + G C   +   +C C   G  G  CE  +  C SN C + G C+ +     C C P +TG  CN    +C+ + C N GTC        C C + +    C  E   C S+ C +G      NGY  CDC    + GT C+I    C    C NGG C+     Y C C+EGF G  CQ    EC  N C N G C     G+ C+C    Y G +C
Sbjct:  490 NTDECASSPCLHNGHCMD-KINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCT-EGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCQ-PGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLK-GTTGPNCEINLDDCASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGY-KCDCA-PGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCP-LPYTGATC 826          

HSP 4 Score: 102.064 bits (253), Expect = 7.848e-20
Identity = 116/386 (30.05%), Postives = 156/386 (40.41%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGI--------CSIENG-------LPVCDCRNTQ-HKGKVCEKPI------CSESF-----------CNN----RGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +P  C  G C++        +    C C  G+TG  CE     C    CR+GG C   D    C C   G  G NCE +   C+ + C +           C+ E G       + + +C  +  H G  CE  I      C E +           CN+     G C        CDC A G+ G  C+     C SN C NGG C    S   C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE+    C +  C   GVC+    Y    C   T ++G  C +    C    C +G +CQ  NG Y C CQ G+ G  C+ +  +C PN C N G C+   N   CDC   G+ G  C E +
Sbjct:  571 DPDPCHYGSCKD-------GVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCL-KGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDC-APGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFQGAFCEEDI 946          

HSP 5 Score: 102.064 bits (253), Expect = 8.827e-20
Identity = 104/316 (32.91%), Postives = 143/316 (45.25%), Query Frame = 2
Query: 3566 PRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQS-FCSDSFCQNNGICSI-ENGLPV---CDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHN-EQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSN--FCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P   C NGGRC + +    C CSG  F G  C+ S  C  + C+N G C + ++G  V   C C      G +C  P+   C  + C N G C +    +  C C   G+ G+ C++ + C SN C NGG C+P +S   C+C P F G  C +   +CS N   C + GTC+      +C+C     G  CE+    C    C  GG C+      + C C    + G  C  N+   CP   C NGG C      Y C C   + G  C E   EC   PN C+N G C   + G+ C C + G+ G  CSE +
Sbjct:   27 PSGTCLNGGRCEVANGTEACVCSG-AFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCP-LGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPP-GWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACL-PGFAGQNCEENV-DDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVN-GWTGEDCSENI 336          

HSP 6 Score: 101.679 bits (252), Expect = 1.089e-19
Identity = 108/364 (29.67%), Postives = 148/364 (40.66%), Query Frame = 2
Query: 3440 LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            + C    CQN G C         C C  GF G+ CE+    CP + C+NGG C        C C    + G  C +         + CQN G C   +G   C C N    G+ C + I  C+ + C     C+       C+C   G  G  C   + C SN C  G  C   P + +  C C   +TG  C    +E    +N C + G C  +    +C C + + G RCEI+   C S+ C     C  + G   C C    YEG  C I    C    C + G+C  +  ++ C+C +GF G  CQ +  EC    CKN   C    N +TC CT  GY G  C   +     +   YG
Sbjct:  220 VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPE-WTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGW-TGEDCSENIDDCASAACFQGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICM-PGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTE-GYTGTHCEVDIDECDPDPCHYG 578          

HSP 7 Score: 101.293 bits (251), Expect = 1.225e-19
Identity = 106/356 (29.78%), Postives = 152/356 (42.70%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS------------DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN----------ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV--CQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDC 4408
            +C+   C + G C Q +     C C +G+TG  C+ +   C    C+NGGRC+  + Q  C+C  +G+ G NC+    S               CQ+ G+C  E     C C+   + G  CE  +  CS + C N   C  +     C C A G+ G  C  EI  C S  C+NGG C+   +   C C     G  C           +    S  CFN+GTC        C+C   F G+RCE +   C S+ C   G   C  R    +C+C+   + G RC ++   C  + C NGG C V +     + C C  GF+G+ C+ + + C    C N G C       TC C
Sbjct: 1024 ECDSRPCLHGGTC-QDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECR-SGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQ-AGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVA-GYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECR-AGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLC 1374          

HSP 8 Score: 67.781 bits (164), Expect = 1.668e-9
Identity = 50/164 (30.49%), Postives = 69/164 (42.07%), Query Frame = 2
Query: 3980 GFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYP----YCDCQNTNYEGTRCNIP--KRCPLEFCSNGGNCQVRN-GQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            G +C++    S  C N G C ++N    C C+  F GQRC+    C S  C   G C + +        C C    + G  C  P    C    C NGG C +    +Y C C  G+ G  CQ+   C  N C N G C    + + C C   G+ G +C + V
Sbjct:   21 GLRCSQ---PSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCP-LGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCP-PGFHGPTCRQDV 179          
BLAST of Cell polarity protein vs. UniProt/SwissProt
Match: sp|G3I6Z6|NOTC1_CRIGR (Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 1.078e-30
Identity = 124/362 (34.25%), Postives = 162/362 (44.75%), Query Frame = 2
Query: 3428 CRNPL--KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDS--FCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  PL   C    C+N G C  L + +  C C  G++G+ C++ +  C  + C NGG+C  ++    C C   GF G  C Q    CS +   C++ G C  E G   C CR T H G  CE P   CS S C N G C    +    C C   GF GQ CE  +  C  N CKNGG CV   +   C+C PE+TG  C E     +   N C N GTC+ ++    C C   + G+ C E    C S  C+ G  C  R    YC+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:  114 CLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQAD-PCASNPCANGGQCLPFESSYICGCP-PGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCVCRAT-HTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLP-GFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPH-GRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQ-GYTGPRCEIDV 469          

HSP 2 Score: 137.117 bits (344), Expect = 2.077e-30
Identity = 116/357 (32.49%), Postives = 165/357 (46.22%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLE----------FCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +    +   C C  G+ G+ CE     C +  CR+G  C   +   +C C   G+ G NCE     C  + C N G C+    +  CDC     +G  CE+ I  C+ + C N   C    +   C C A GF G  CE     CT + C NGG CV   +  TC C P FTG  C  +  +C S  C + GTC  S    +C+C + + G  C+ +   C S  C  GG C   N   +C+C+ + + G  C++    C +            C +GG C     ++YC CQ G+ GS C+ E  EC PN C+N   C+    GF+C C   GY G +CSE++
Sbjct:  849 CATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQA-GYTGRNCESDIDDCRPNPCHNGGSCTDGINMAFCDCL-PGFQGAFCEEDINECASNPCRNGANCTDCVDSYTCTCPA-GFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVHWCDSAPCKNGGKCWQTNTQYHCECR-SGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCV-AGYHGSNCSEEI 1200          

HSP 3 Score: 103.605 bits (257), Expect = 2.589e-20
Identity = 117/386 (30.31%), Postives = 157/386 (40.67%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGI--------CSIENG-------LPVCDCRNTQ-HKGKVCEKPI------CSESF-----------CNN----RGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +P  C  G+C++        +    C C  G+TG  CE     C    CR+GG C   D    C C   G  G NCE +   C+ + C +           C+ E G       + + +C  +  H G  CE  I      C E +           CN+     G C        CDC A G+ G  C+     C SN C NGG C    S   C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE+    C +  C   GVC+    Y    C   T ++G  C I    C    C +G +CQ  NG Y C CQ G+ G  C+ +  +C PN C N G C+   N   CDC   G+ G  C E +
Sbjct:  587 DPDPCHYGFCKD-------GVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCL-KGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDC-APGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINMAFCDCL-PGFQGAFCEEDI 962          

HSP 4 Score: 103.219 bits (256), Expect = 3.746e-20
Identity = 108/365 (29.59%), Postives = 149/365 (40.82%), Query Frame = 2
Query: 3440 LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGY 4486
            + C    CQN G C         C C  GF G+ CE+    CP + C+NGG C        C C    + G  C +         + CQN G C   +G   C C N    G+ C + I  C+ + C     C+       C+C   G  G  C   + C SN C  G  C   P + +  C C   +TG  C    +E    +N C + G C  +    +C C + + G RCEI+   C S+ C     C  + G   C C    YEG  C I    C    C + G+C  +  ++ C+C +GF G  CQ +  EC    CKN   C    N +TC CT  GY G  C   +     +   YG+
Sbjct:  236 VPCSPSPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPE-WTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGW-TGEDCSENIDDCASAACFQGATCHDRVASFYCEC-PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICM-PGYEGVYCEINTDECASSPCLHNGHCMDKINEFLCQCPKGFSGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTE-GYTGTHCEVDIDECDPDPCHYGF 595          

HSP 5 Score: 102.834 bits (255), Expect = 4.780e-20
Identity = 108/346 (31.21%), Postives = 144/346 (41.62%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            N  +C    C + G C    I++  C C +GF+G  C+     C    C+NG +C        C C+  G+ G +CE     C    C   G C        C C+   + G  CE  I  C    C + G C   +   +C C   G  G  CE  +  C SN C + G C+ +     C C P +TG  CN    +C+ + C N GTC        C C + +    C  E   C S+ C +G      NGY  CDC    + GT C+I    C    C NGG C+     Y C C+EGF G  CQ    EC  N C N G C     G+ C+C    Y G +C
Sbjct:  506 NTDECASSPCLHNGHCMD-KINEFLCQCPKGFSGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCT-EGYTGTHCEVDIDECDPDPCHY-GFCKDGVATFTCLCQ-PGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCL-KGTTGPNCEINLDDCASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGY-KCDCA-PGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCP-LPYTGATC 842          

HSP 6 Score: 100.908 bits (250), Expect = 1.657e-19
Identity = 106/356 (29.78%), Postives = 153/356 (42.98%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCS------------DSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNF--------CFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV--CQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDC 4408
            +C+   C + G C Q +     C C +G+TG  C+ +   C    C+NGG+C+  + Q  C+C  +G+ G NC+    S               CQ+ G+C  E     C C+   + G  CE  +  CS + C N   C  +     C C A G+ G  C  EI  C S  C+NGG C+   +   C C     G  C  N   C  +         CFN+GTC        C+C   F G+RCE +   C S+ C   G   C  R    +C+C+   + G RC ++   C  + C NGG C V +     + C C  GF+G+ C+ + + C    C N G C       TC C
Sbjct: 1040 ECDSRPCLHGGTC-QDSYGTYKCTCPQGYTGLNCQNLVHWCDSAPCKNGGKCWQTNTQYHCECR-SGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQ-AGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVA-GYHGSNCSEEINECLSQPCQNGGTCIDLTNTYKCSCPRGTQGVHCEINVDDCHPHLDPASRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDINECLSNPCDPRGTQDCVQRVNDFHCECR-AGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLC 1390          

HSP 7 Score: 98.5969 bits (244), Expect = 8.239e-19
Identity = 104/316 (32.91%), Postives = 141/316 (44.62%), Query Frame = 2
Query: 3566 PRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ-SFCSDSFCQNNGICSI-ENGLPV---CDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHN-EQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSN--FCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P   C NGGRC + +    C CSG  F G  C+  + C  + C+N G C + E+G  V   C C      G +C  P+   C  + C N G C +    +  C C   G+ G+ C++ + C SN C NGG C+P +S   C C P F G  C +   +CS N   C + GTC+      +C C     G  CE+    C    C  GG C+      + C C    + G  C  N+   CP   C NGG C      Y C C   + G  C E   EC   PN C+N G C   + G+ C C + G+ G  CSE +
Sbjct:   43 PSGTCLNGGRCEVANGTEACVCSGP-FVGQRCQDPNPCLSTPCKNAGTCHVVEHGGTVNYACSCP-LGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPP-GWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCVCRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACL-PGFAGQNCEENV-DDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVN-GWTGEDCSENI 352          
BLAST of Cell polarity protein vs. UniProt/SwissProt
Match: sp|P46531|NOTC1_HUMAN (Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4)

HSP 1 Score: 136.732 bits (343), Expect = 2.364e-30
Identity = 124/366 (33.88%), Postives = 163/366 (44.54%), Query Frame = 2
Query: 3428 CRNPL--KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSD--SFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCT-----ATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  PL   C    C+N G C  L + +  C C  G++G+ C++ +  C  + C NGG+C  ++    C C  + F G  C Q    C      C++ G C  E G   C CR T H G  CE+P   CS S C N G C     +P  D T       GF GQ CE  I  C  N CKNGG CV   +   C+C PE+TG  C E     +   N C N GTC+ ++    C C   + G+ C E    C S  C++G  C  R    YC+C +    G  C++   C    C+ G NC     NG+  C C  G+ G  C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   98 CLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQAD-PCASNPCANGGQCLPFEASYICHCPPS-FHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRAT-HTGPNCERPYVPCSPSPCQNGGTC-----RPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPH-GRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQ-GYTGPRCEIDV 453          

HSP 2 Score: 127.872 bits (320), Expect = 1.176e-27
Identity = 112/357 (31.37%), Postives = 157/357 (43.98%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G C Q    +   C C  G+ G+ CE     C    CR+G  C       +C C   G+ G NCE     C  + C N G C+       CDC     +G  CE+ I  C+   C N   C    +   C C A GF G  CE     CT + C NGG CV   +  TC C P FTG  C     +C S  C + GTC       +C+C + + G  C+ +   C S  C  GG C   +    C+C  + + G  C++P   C +            C +GG C      ++C CQ G+ GS C++   EC P+ C+N   C+    G++C C   GY G++CSE++
Sbjct:  833 CAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQ-AGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPA-GFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECP-SGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCV-AGYHGVNCSEEI 1184          

HSP 3 Score: 106.301 bits (264), Expect = 3.889e-21
Identity = 111/346 (32.08%), Postives = 145/346 (41.91%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            N  +C    C + G C    I++  C C  GFTG  C+     C    C+NG +C        C C+  G+ G +CE     C    C   G C        C CR   + G  CE  I  CS   C + G C   +   +C C   G  G  CE  +  C S+ C + G C+ +     C C P +TG  CN    +C+ N C N GTC        C C + +    C  E   C S+ C +G      NGY  CDC +  + GT C+I    C    C NGG C+     Y C C+EGF G  CQ    EC  N C N G C     G+ C+C    Y G +C
Sbjct:  490 NTDECASSPCLHNGRCLD-KINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCT-EGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLCR-PGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCL-KGTTGPNCEINLDDCASSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGY-KCDC-DPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCL-LPYTGATC 826          

HSP 4 Score: 103.219 bits (256), Expect = 3.044e-20
Identity = 117/386 (30.31%), Postives = 152/386 (39.38%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGI--------CSIENGLPVCDCR--------NTQHKGKVCEKPI------CSESF-----------CNN----RGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +P  C  G C++        +    C C  G+TG  CE     C    CR+GG C   D    C C   G  G NCE +   C+ S C +           C+ E G     C         N  H G  CE  I      C E +           CN+     G C        CDC   G+ G  C+     C SN C NGG C    S   C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE+    C    C  GG C+    Y    C   T ++G  C +    C L  C +G +CQ  +G Y C CQ G+ G  C+ +  +C PN C N G C+   N   CDC   G+ G  C E +
Sbjct:  571 DPDPCHYGSCKD-------GVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCL-KGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDP-GWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCL-PGFRGTFCEEDI 946          

HSP 5 Score: 100.138 bits (248), Expect = 2.819e-19
Identity = 106/356 (29.78%), Postives = 153/356 (42.98%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE------------QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCS--------SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGV--CQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDC 4408
            +C+   C + G C Q       C C +G+TG  C+ +   C    C+NGG+C+    Q +C+C  +G+ G  C+            Q       CQ+ G+C        C C+   + G  CE  +  CS S C N   C  +     C C A G+ G  C  EI  C S+ C+NGG C+   +   C C     G  C  N   C+        S  CFN+GTC        C+C   F G+RCE +   C S+ C   G   C  R    +C+C+   + G RC ++   C  + C NGG C V +     + C+C  GF+G+ C+ + + C    C N G C       TC C
Sbjct: 1024 ECDSQPCLHGGTC-QDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECP-SGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQ-AGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVA-GYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECR-AGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLC 1374          

HSP 6 Score: 92.8189 bits (229), Expect = 4.573e-17
Identity = 111/406 (27.34%), Postives = 160/406 (39.41%), Query Frame = 2
Query: 3428 CRNP-LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-------------------------GT--------------GFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE-KPICSESFCNNRGRCYVH--NEQPICDCTATGFIGQKCEREI--CT--SNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            C  P + C    CQN G C         C C  GFTG+ CE+    CP + C+NGG C        C C                          GT              G+ G +C ++   C+ + C +   C        C+C + +  G +C     C  + CN    C  +  N + IC C  +G+ G  C +++  C+  +N C++ G C+       CQC   +TG +C  +  +C SN C ND TC       QC C   +EG  CE+    C S  C + G C  +     C+C  T + G  C      C    C NG  C      Y C C EG+ G+ C+ +  EC P+ C   G C      FTC C   GY G  C   +    ++  ++G
Sbjct:  215 CERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGR-TGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTC-PSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECP-TGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHY-GSCKDGVATFTCLC-RPGYTGHHCETNINECSSQPCRHG 615          

HSP 7 Score: 90.8929 bits (224), Expect = 1.812e-16
Identity = 99/316 (31.33%), Postives = 134/316 (42.41%), Query Frame = 2
Query: 3566 PRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ-SFCSDSFCQNNGICSIENGLPV----CDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHN-EQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P + C NGG+C   +    C C G  F G  C+  + C  + C+N G C + +   V    C C      G +C  P+   C  + C N G C +    +  C C   G+ G+ C++ + C SN C NGG C+P ++   C C P F G  C    NE       C + GTC+      +C C     G  CE     C    C  GG C+      + C C    + G  C  NI   CP   C NGG C      Y C C   + G  C E   EC   PN C+N G C   + G+ C C + G+ G  CSE +
Sbjct:   27 PGETCLNGGKCEAANGTEACVCGGA-FVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCA-LGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRC-PPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACL-PGFTGQNCEENI-DDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVN-GWTGEDCSENI 336          
BLAST of Cell polarity protein vs. TrEMBL
Match: A0A3Q0KLP9 (Cell polarity protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1030.39 bits (2663), Expect = 0.000e+0
Identity = 586/1711 (34.25%), Postives = 895/1711 (52.31%), Query Frame = 2
Query:  812 ERYDTKSSQQKRTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFG-----------EVTITEKTSYDYTHTGDYLISATPVPFTFTEFD-KLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGD-QSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTL-----QPD-ATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGS---DNFEAGKE------------KFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIY-IEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQF-QLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQL-RVSLPYLAEKVATPNTW-SLVGCLGEFLISEDKFLSNKLS---GAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCS-EGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSD-SFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYV--HNEQPICDCTATGFIGQKCEREICTSNFCKN--------------------------------------GGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYI-SNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQ-EGFQGSRCQERKECPPNFCKNDGICSVI-NNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGN-KYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPP---TSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLL-----------NSVNKKGEVIIILMPNLTR 5641
            E+  T   +   ++NF   ++++Y+F NR+ R  E E L + F      TSGLLW+SE    KSY+Y+K+S LYY Y        AQ T TEEI++   L P     L + R  D      NLT+T++   +A+++I  GR PL+  +G +Y+GG  +    TEG++D  F G I    ++ +  +  +L+N+  D      ++  G           ++ I   +S     + +   S TPVP TF   D  +VRF  W+FE + S EI+F T EP G+L FVGPD  H D+VC+E +D N+Y  + + G     ++NP  T V  G  +++++ R+  H+FT KF N  +D+ + +  HQ  F +YTYIG IDN  RLPW+VWSRE F GCI+ + VNE+ Y+D   +  Q++    G+ +G+C    + C    C GG C  RSYP+L + NF CDCS   +T+     +I R   C R++  +  DG   YV+DF  E+  +K++ THTDDI++ FKT      Q D   +F +       YF V LV G + V+TNIN K      + F +P   LNDN+WH ++I RRA++I+I VD  +  I GKIP+L    TF    + I++GS    NF   ++            +F+G  RNFYWNQ+D +GT+     Y   +  P       P +PR      T +    Y  +      ++    + IEFKT Y GI++   D+ N    ++T M++  ++ +++ I++ + V  I  G     + D NWHR+ I L K  + I+ ++D GY  + +    ++   +S+ + +FGG+PE  +  +   L R S+  L    A      SL GC+G F I  + F  N L      +  YP N L  G C +  +C   YC + G C Q++  ++ C C+  G  G +C      CP  +C+N GRC + + QP CDCS TG+ G  CE S CS  ++C NNG C +   +  CDC+ T   G  C + IC+  +C   G C V    +QP+C+C  TG+ G +CE  IC  N+C+N                                       G+CV R   PTC C P + G +C    C SN+C N GTCY   + RP C+C  NFEG++CE+ K CP D+C +GG C +  G P CDC  T+Y+GT+C IP+ CP+ +C N G C V++G Y C+C   G++G  C E   CPPN+C N GICSV+  N + CDC+ T   G  C     G+   YE+ GY+IY + P + T  D VT GF+T+M +GT+ TF TTDG+YW++K+ +G++++D  G   +      NDG Y++++I+++G   I    G   E   +S   + +   N + Y  I +    ++ DIF+G IGG +WNG+Y  + +        GT+ I+  P     PP     C   +C+N G C   +Y   C C  T + G RCE++  G  P     G Y++  I P  +T++D+ +   Q + ++ P++R    D  +YE+ + +GKL    NG    L +  Q  ++   +++   R K    + I+G  TS + + +I+S DGSLI ++IILGAD++Y+  F+G IG F WNG  +I+  G+L            N      E++++LMP L +
Sbjct:  315 EQIPTNPIKYISSVNFPEGSFVRYDFMNRLQRTVEEEVLTINFTLPFGVTSGLLWFSESDQSKSYVYIKNSLLYYIYAITDQTGKAQRTVTEEIFLNSSLIPEKPQVLQLIRDRD------NLTITLDHRSQASRSI-AGRAPLVSTDGKVYLGGSVDPIKDTEGKVDRTFEGRITKAEITRKGDKDVNLLNVLIDPKWKDSIQQTGITDVRFRLPKAQLIIGPTSSNKRFTSLESEFSRTPVPITFMGTDDSIVRFDTWNFELYRSFEIKFSTYEPNGILFFVGPDQEHRDFVCVELFDGNVYFVYAVGGHYKHIRLNPPKTVVNDGGIYSVYVSRNAQHRFTVKFNNQLIDVEEGKEAHQAAFATYTYIGSIDNVGRLPWHVWSRENFAGCIHSILVNENSYLDVSSRMIQHTDIGKGIRLGQCEVPKQRCNEKICGGGRCSRRSYPFLEELNFACDCSESDKTFPEKTMDIRRSVGCDRDAPILEMDGDMVYVIDF--EEQINKLI-THTDDISLQFKTETTLYGQSDHLPLFYSVSRADKSYFRVDLVNGQIRVQTNINHKGKSHEYEEFFLPSSTLNDNRWHTLHIARRADYIVISVDRAS--ITGKIPLLDPHDTFQLIAQQIYLGSAGPPNFGYYQDIDTKKIMLPPGPRFIGEFRNFYWNQYDLIGTKLFPTKYTTHLLNPPSIRHKFPIWPRQQTYAITCKSGLIYAHMNKPITMKNGGDTWLIEFKTNYDGILFRARDINNPSGIHITAMILSGRIHIIYSIHDQQGVYQITSGPGADNVADGNWHRLAITLRKYNKEILAYLD-GYSNEYLVGKNLRVDLLSQFDIFFGGIPEHEWLTLLNLLRRYSIQSLERSEAKDGQQPSLTGCIGSFNIRANNFTDNLLKLYDSYLTAYPANELIRGYCMDLKRCTPSYCHHGGTCRQISDSEVQCICTGTGHEGPRCANPITECPPGYCKNNGRCKIVNGQPVCDCSSTGYTGTMCEISPCSSGTYCHNNGRCYMMGSVAACDCKGTGFTGPRCLESICTPGYCGYGGVCTVDPRTQQPVCNCRGTGYTGARCETRICPVNYCENYGECKVGPDDRPTCDCSRTNYAGPTCNIPLCPPNYCTGHGICVVRQRNPTCDCYPGYRGPRCEIEVCPSNYCMNGGTCYPGPDHRPHCTCPVNFEGEQCEMRKLCPPDYCLHGGRCTMNRGIPKCDCLGTDYKGTQCEIPETCPIGYCQNNGVCSVKSGSYVCDCTGTGYRGRTCTEPITCPPNYCNNGGICSVLPGNVYRCDCSMTARTGPQCDSSAHGIHIGYERDGYLIYNLIPSIRTIDDNVTFGFKTYMNSGTLVTFLTTDGKYWAIKLRDGRVIVDTGGKITHDFGMRSNDGNYHIINIERKGRTMIVTQDG---EVLRLSLQDLVNPYDNSLIYNAIHLAVDEKKSDIFRGVIGGLHWNGRYPIDDLNARIVTSTGTVTIVPTPGFQIHPPRPQPECISDYCSNGGRCYAENYQRKCDCRYTAYNGARCERQSRGFMPQLPDNGAYVIYQIQPLNRTNRDQLRVAFQTWYNDGPIVRVVQTDGSYYEVYLRNGKLYTNINGVEFTLSNPSQIFNDGRMHVITMDRNKSQFNYTIDGHHTSHY-VPSIVSVDGSLISQEIILGADRTYQNTFKGVIGAFYWNGQYLINQIGSLASNTKVMVAPGRNVAKSMDEIVVVLMPELLK 2008          

HSP 2 Score: 454.521 bits (1168), Expect = 8.780e-125
Identity = 226/418 (54.07%), Postives = 301/418 (72.01%), Query Frame = 2
Query: 6353 GHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEM--------PTEASDHHRLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTG-MDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            GH + LD++D+ G  G  +I RID    + D   R NV+  E MKVDC V+++NS+Y VTGS   PPQ+WD Q+G+L K+MDG E GCTDLHLAC D +LV  V+D++        P+E     R+KRLQ+WDFATG Q+ MP+++MC+A+CIT SS++++I +   +G  +I+ W+L  NQ    I Y   + +  + +++L IS +DR+VVAG     D+ A++MVFDL ASY    + QP   +FNAK  ATEIIG DEA+TGTR+GEL +WNL T + +RQI ISATLEG   T L PH + I+C+ +S +G +LVTGS DQT  ++TM DERL+HTLEGHADDVLS  ISLD+E++V+GSWDGS+RVW +  G+QMCWFTSNIEIL VK++NDK+A+VALGER G RKLIMLQ
Sbjct: 2200 GHNHRLDLTDQIGASGISTI-RIDQPVMD-DLSARQNVYNMEGMKVDCVVITKNSKYVVTGSGMGPPQVWDTQSGDLCKIMDGQEFGCTDLHLACDDSVLVAQVLDDITGLDTLNEPSEI----RVKRLQLWDFATGRQLEMPIEIMCTATCITRSSEYVIIAQVTQEGP-AILVWNLTGNQSDHIIPYHPVNPLLKDSVSYLNISLDDRLVVAGLNNPTDELAYFMVFDLTASYVG--IHQPKFITFNAKAEATEIIGNDEAVTGTRRGELFVWNLLTGRVMRQIQISATLEGGNLTMLPPHTETIHCVKLSTDGHYLVTGSQDQTARIWTMPDERLLHTLEGHADDVLSVAISLDSEVVVTGSWDGSIRVWRIRDGNQMCWFTSNIEILQVKISNDKRALVALGERSGHRKLIMLQ 2608          
BLAST of Cell polarity protein vs. TrEMBL
Match: A0A5K4ELY6 (Cell polarity protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 586/1711 (34.25%), Postives = 895/1711 (52.31%), Query Frame = 2
Query:  812 ERYDTKSSQQKRTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFG-----------EVTITEKTSYDYTHTGDYLISATPVPFTFTEFD-KLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGD-QSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTL-----QPD-ATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGS---DNFEAGKE------------KFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIY-IEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQF-QLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQL-RVSLPYLAEKVATPNTW-SLVGCLGEFLISEDKFLSNKLS---GAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCS-EGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSD-SFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYV--HNEQPICDCTATGFIGQKCEREICTSNFCKN--------------------------------------GGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYI-SNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQ-EGFQGSRCQERKECPPNFCKNDGICSVI-NNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGN-KYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPP---TSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLL-----------NSVNKKGEVIIILMPNLTR 5641
            E+  T   +   ++NF   ++++Y+F NR+ R  E E L + F      TSGLLW+SE    KSY+Y+K+S LYY Y        AQ T TEEI++   L P     L + R  D      NLT+T++   +A+++I  GR PL+  +G +Y+GG  +    TEG++D  F G I    ++ +  +  +L+N+  D      ++  G           ++ I   +S     + +   S TPVP TF   D  +VRF  W+FE + S EI+F T EP G+L FVGPD  H D+VC+E +D N+Y  + + G     ++NP  T V  G  +++++ R+  H+FT KF N  +D+ + +  HQ  F +YTYIG IDN  RLPW+VWSRE F GCI+ + VNE+ Y+D   +  Q++    G+ +G+C    + C    C GG C  RSYP+L + NF CDCS   +T+     +I R   C R++  +  DG   YV+DF  E+  +K++ THTDDI++ FKT      Q D   +F +       YF V LV G + V+TNIN K      + F +P   LNDN+WH ++I RRA++I+I VD  +  I GKIP+L    TF    + I++GS    NF   ++            +F+G  RNFYWNQ+D +GT+     Y   +  P       P +PR      T +    Y  +      ++    + IEFKT Y GI++   D+ N    ++T M++  ++ +++ I++ + V  I  G     + D NWHR+ I L K  + I+ ++D GY  + +    ++   +S+ + +FGG+PE  +  +   L R S+  L    A      SL GC+G F I  + F  N L      +  YP N L  G C +  +C   YC + G C Q++  ++ C C+  G  G +C      CP  +C+N GRC + + QP CDCS TG+ G  CE S CS  ++C NNG C +   +  CDC+ T   G  C + IC+  +C   G C V    +QP+C+C  TG+ G +CE  IC  N+C+N                                       G+CV R   PTC C P + G +C    C SN+C N GTCY   + RP C+C  NFEG++CE+ K CP D+C +GG C +  G P CDC  T+Y+GT+C IP+ CP+ +C N G C V++G Y C+C   G++G  C E   CPPN+C N GICSV+  N + CDC+ T   G  C     G+   YE+ GY+IY + P + T  D VT GF+T+M +GT+ TF TTDG+YW++K+ +G++++D  G   +      NDG Y++++I+++G   I    G   E   +S   + +   N + Y  I +    ++ DIF+G IGG +WNG+Y  + +        GT+ I+  P     PP     C   +C+N G C   +Y   C C  T + G RCE++  G  P     G Y++  I P  +T++D+ +   Q + ++ P++R    D  +YE+ + +GKL    NG    L +  Q  ++   +++   R K    + I+G  TS + + +I+S DGSLI ++IILGAD++Y+  F+G IG F WNG  +I+  G+L            N      E++++LMP L +
Sbjct:  372 EQIPTNPIKYISSVNFPEGSFVRYDFMNRLQRTVEEEVLTINFTLPFGVTSGLLWFSESDQSKSYVYIKNSLLYYIYAITDQTGKAQRTVTEEIFLNSSLIPEKPQVLQLIRDRD------NLTITLDHRSQASRSI-AGRAPLVSTDGKVYLGGSVDPIKDTEGKVDRTFEGRITKAEITRKGDKDVNLLNVLIDPKWKDSIQQTGITDVRFRLPKAQLIIGPTSSNKRFTSLESEFSRTPVPITFMGTDDSIVRFDTWNFELYRSFEIKFSTYEPNGILFFVGPDQEHRDFVCVELFDGNVYFVYAVGGHYKHIRLNPPKTVVNDGGIYSVYVSRNAQHRFTVKFNNQLIDVEEGKEAHQAAFATYTYIGSIDNVGRLPWHVWSRENFAGCIHSILVNENSYLDVSSRMIQHTDIGKGIRLGQCEVPKQRCNEKICGGGRCSRRSYPFLEELNFACDCSESDKTFPEKTMDIRRSVGCDRDAPILEMDGDMVYVIDF--EEQINKLI-THTDDISLQFKTETTLYGQSDHLPLFYSVSRADKSYFRVDLVNGQIRVQTNINHKGKSHEYEEFFLPSSTLNDNRWHTLHIARRADYIVISVDRAS--ITGKIPLLDPHDTFQLIAQQIYLGSAGPPNFGYYQDIDTKKIMLPPGPRFIGEFRNFYWNQYDLIGTKLFPTKYTTHLLNPPSIRHKFPIWPRQQTYAITCKSGLIYAHMNKPITMKNGGDTWLIEFKTNYDGILFRARDINNPSGIHITAMILSGRIHIIYSIHDQQGVYQITSGPGADNVADGNWHRLAITLRKYNKEILAYLD-GYSNEYLVGKNLRVDLLSQFDIFFGGIPEHEWLTLLNLLRRYSIQSLERSEAKDGQQPSLTGCIGSFNIRANNFTDNLLKLYDSYLTAYPANELIRGYCMDLKRCTPSYCHHGGTCRQISDSEVQCICTGTGHEGPRCANPITECPPGYCKNNGRCKIVNGQPVCDCSSTGYTGTMCEISPCSSGTYCHNNGRCYMMGSVAACDCKGTGFTGPRCLESICTPGYCGYGGVCTVDPRTQQPVCNCRGTGYTGARCETRICPVNYCENYGECKVGPDDRPTCDCSRTNYAGPTCNIPLCPPNYCTGHGICVVRQRNPTCDCYPGYRGPRCEIEVCPSNYCMNGGTCYPGPDHRPHCTCPVNFEGEQCEMRKLCPPDYCLHGGRCTMNRGIPKCDCLGTDYKGTQCEIPETCPIGYCQNNGVCSVKSGSYVCDCTGTGYRGRTCTEPITCPPNYCNNGGICSVLPGNVYRCDCSMTARTGPQCDSSAHGIHIGYERDGYLIYNLIPSIRTIDDNVTFGFKTYMNSGTLVTFLTTDGKYWAIKLRDGRVIVDTGGKITHDFGMRSNDGNYHIINIERKGRTMIVTQDG---EVLRLSLQDLVNPYDNSLIYNAIHLAVDEKKSDIFRGVIGGLHWNGRYPIDDLNARIVTSTGTVTIVPTPGFQIHPPRPQPECISDYCSNGGRCYAENYQRKCDCRYTAYNGARCERQSRGFMPQLPDNGAYVIYQIQPLNRTNRDQLRVAFQTWYNDGPIVRVVQTDGSYYEVYLRNGKLYTNINGVEFTLSNPSQIFNDGRMHVITMDRNKSQFNYTIDGHHTSHY-VPSIVSVDGSLISQEIILGADRTYQNTFKGVIGAFYWNGQYLINQIGSLASNTKVMVAPGRNVAKSMDEIVVVLMPELLK 2065          

HSP 2 Score: 454.521 bits (1168), Expect = 1.124e-124
Identity = 226/418 (54.07%), Postives = 301/418 (72.01%), Query Frame = 2
Query: 6353 GHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEM--------PTEASDHHRLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTG-MDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            GH + LD++D+ G  G  +I RID    + D   R NV+  E MKVDC V+++NS+Y VTGS   PPQ+WD Q+G+L K+MDG E GCTDLHLAC D +LV  V+D++        P+E     R+KRLQ+WDFATG Q+ MP+++MC+A+CIT SS++++I +   +G  +I+ W+L  NQ    I Y   + +  + +++L IS +DR+VVAG     D+ A++MVFDL ASY    + QP   +FNAK  ATEIIG DEA+TGTR+GEL +WNL T + +RQI ISATLEG   T L PH + I+C+ +S +G +LVTGS DQT  ++TM DERL+HTLEGHADDVLS  ISLD+E++V+GSWDGS+RVW +  G+QMCWFTSNIEIL VK++NDK+A+VALGER G RKLIMLQ
Sbjct: 2257 GHNHRLDLTDQIGASGISTI-RIDQPVMD-DLSARQNVYNMEGMKVDCVVITKNSKYVVTGSGMGPPQVWDTQSGDLCKIMDGQEFGCTDLHLACDDSVLVAQVLDDITGLDTLNEPSEI----RVKRLQLWDFATGRQLEMPIEIMCTATCITRSSEYVIIAQVTQEGP-AILVWNLTGNQSDHIIPYHPVNPLLKDSVSYLNISLDDRLVVAGLNNPTDELAYFMVFDLTASYVG--IHQPKFITFNAKAEATEIIGNDEAVTGTRRGELFVWNLLTGRVMRQIQISATLEGGNLTMLPPHTETIHCVKLSTDGHYLVTGSQDQTARIWTMPDERLLHTLEGHADDVLSVAISLDSEVVVTGSWDGSIRVWRIRDGNQMCWFTSNIEILQVKISNDKRALVALGERSGHRKLIMLQ 2665          
BLAST of Cell polarity protein vs. TrEMBL
Match: G4VG96 (Cell polarity protein OS=Schistosoma mansoni OX=6183 GN=Smp_130280 PE=4 SV=1)

HSP 1 Score: 997.268 bits (2577), Expect = 0.000e+0
Identity = 578/1711 (33.78%), Postives = 883/1711 (51.61%), Query Frame = 2
Query:  812 ERYDTKSSQQKRTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFG-----------EVTITEKTSYDYTHTGDYLISATPVPFTFTEFD-KLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGD-QSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTL-----QPD-ATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGS---DNFEAGKE------------KFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIY-IEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQF-QLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQL-RVSLPYLAEKVATPNTW-SLVGCLGEFLISEDKFLSNKLS---GAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCS-EGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSD-SFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYV--HNEQPICDCTATGFIGQKCEREICTSNFCKN--------------------------------------GGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYI-SNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQ-EGFQGSRCQERKECPPNFCKNDGICSVI-NNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGN-KYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPP---TSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLL-----------NSVNKKGEVIIILMPNLTR 5641
            E+  T   +   ++NF   ++++Y+F NR+ R  E E L + F      TSGLLW+SE    KSY+Y+K+S LYY Y        AQ T TEEI++   L P     L + R  D      NLT+T++   +A+++I  GR PL+  +G +Y+GG  +    TEG++D  F G I    ++ +  +  +L+N+  D      ++  G           ++ I   +S     + +   S TPVP TF   D  +VRF  W+FE + S EI+F T EP G+L FVGPD  H D+VC+E +D N+Y  + + G     ++NP  T V  G  +++++ R+  H+FT KF N  +D+ + +  HQ  F +YTYIG IDN  RLPW+VWSRE F GCI+ + VNE+ Y+D   +  Q++    G+ +G+C    + C    C GG C  RSYP+L + NF CDCS   +T+     +I R   C R++  +  DG   YV+DF  E+  +K++ THTDDI++ FKT      Q D   +F +       YF V LV G + V+TNIN K      + F +P   LNDN+WH ++I RRA++I+I VD  +  I GKIP+L    TF    + I++GS    NF   ++            +F+G  RNFYWNQ+D +GT+     Y   +  P       P +PR      T +    Y  +      ++    + IEFKT Y GI++   D+ N    ++T M++  ++ +++ I++ + V  I  G     + D NWHR+ I L K  + I+ ++D GY  +V+   +   + +S+ + +FGG+PE  +  +   L R S+  L    A      SL GC+G F I  + F  N L      +  YP N L  G C +  +C   YC + G C Q++  ++ C C+  G  G +C      CP  +C+N GRC + + QP CDCS TG+ G  CE S CS  ++C NNG C +   +  CDC+ T   G  C + IC+  +C   G C V    +QP+C+C  TG+ G +CE  IC  N+C+N                                       G+CV R   PTC C P + G +C    C SN+C N GTCY   + RP C+C  NFEG++CE+ K CP D+C +GG C +  G P CDC  T+Y+GT+C IP+ CP+ +C N G C V++G Y C+C   G++G  C E   CPPN+C N GICSV+  N + CDC+ T   G  C     G+   YE+ GY+IY + P + T  D VT GF+T+M +GT               + +G++++D  G   +      NDG Y++++I+++G   I    G   E   +S   + +   N + Y  I +    ++ DIF+G IGG +WNG+Y  + +        GT+ I+  P     PP     C   +C+N G C   +Y   C C  T + G RCE++  G  P     G Y++  I P  +T++D+ +   Q + ++ P++R    D  +YE+ + +GKL    NG    L +  Q  ++   +++   R K    + I+G  TS + + +I+S DGSLI ++IILGAD++Y+  F+G IG F WNG  +I+  G+L            N      E++++LMP L +
Sbjct:  293 EQIPTNPIKYISSVNFPEGSFVRYDFMNRLQRTVEEEVLTINFTLPFGVTSGLLWFSESDQSKSYVYIKNSLLYYIYAITDQTGKAQRTVTEEIFLNSSLIPEKPQVLQLIRDRD------NLTITLDHRSQASRSI-AGRAPLVSTDGKVYLGGSVDPIKDTEGKVDRTFEGRITKAEITRKGDKDVNLLNVLIDPKWKDSIQQTGITDVRFRLPKAQLIIGPTSSNKRFTSLESEFSRTPVPITFMGTDDSIVRFDTWNFELYRSFEIKFSTYEPNGILFFVGPDQEHRDFVCVELFDGNVYFVYAVGGHYKHIRLNPPKTVVNDGGIYSVYVSRNAQHRFTVKFNNQLIDVEEGKEAHQAAFATYTYIGSIDNVGRLPWHVWSRENFAGCIHSILVNENSYLDVSSRMIQHTDIGKGIRLGQCEVPKQRCNEKICGGGRCSRRSYPFLEELNFACDCSESDKTFPEKTMDIRRSVGCDRDAPILEMDGDMVYVIDF--EEQINKLI-THTDDISLQFKTETTLYGQSDHLPLFYSVSRADKSYFRVDLVNGQIRVQTNINHKGKSHEYEEFFLPSSTLNDNRWHTLHIARRADYIVISVDRAS--ITGKIPLLDPHDTFQLIAQQIYLGSAGPPNFGYYQDIDTKKIMLPPGPRFIGEFRNFYWNQYDLIGTKLFPTKYTTHLLNPPSIRHKFPIWPRQQTYAITCKSGLIYAHMNKPITMKNGGDTWLIEFKTNYDGILFRARDINNPSGIHITAMILSGRIHIIYSIHDQQGVYQITSGPGADNVADGNWHRLAITLRKYNKEILAYLD-GYSNEVVGKNLRVDL-LSQFDIFFGGIPEHEWLTLLNLLRRYSIQSLERSEAKDGQQPSLTGCIGSFNIRANNFTDNLLKLYDSYLTAYPANELIRGYCMDLKRCTPSYCHHGGTCRQISDSEVQCICTGTGHEGPRCANPITECPPGYCKNNGRCKIVNGQPVCDCSSTGYTGTMCEISPCSSGTYCHNNGRCYMMGSVAACDCKGTGFTGPRCLESICTPGYCGYGGVCTVDPRTQQPVCNCRGTGYTGARCETRICPVNYCENYGECKVGPDDRPTCDCSRTNYAGPTCNIPLCPPNYCTGHGICVVRQRNPTCDCYPGYRGPRCEIEVCPSNYCMNGGTCYPGPDHRPHCTCPVNFEGEQCEMRKLCPPDYCLHGGRCTMNRGIPKCDCLGTDYKGTQCEIPETCPIGYCQNNGVCSVKSGSYVCDCTGTGYRGRTCTEPITCPPNYCNNGGICSVLPGNVYRCDCSMTARTGPQCDSSAHGIHIGYERDGYLIYNLIPSIRTIDDNVTFGFKTYMNSGT---------------LRDGRVIVDTGGKITHDFGMRSNDGNYHIINIERKGRTMIVTQDG---EVLRLSLQDLVNPYDNSLIYNAIHLAVDEKKSDIFRGVIGGLHWNGRYPIDDLNARIVTSTGTVTIVPTPGFQIHPPRPQPECISDYCSNGGRCYAENYQRKCDCRYTAYNGARCERQSRGFMPQLPDNGAYVIYQIQPLNRTNRDQLRVAFQTWYNDGPIVRVVQTDGSYYEVYLRNGKLYTNINGVEFTLSNPSQIFNDGRMHVITMDRNKSQFNYTIDGHHTSHY-VPSIVSVDGSLISQEIILGADRTYQNTFKGVIGAFYWNGQYLINQIGSLASNTKVMVAPGRNVAKSMDEIVVVLMPELLK 1970          

HSP 2 Score: 255.373 bits (651), Expect = 6.077e-64
Identity = 127/226 (56.19%), Postives = 163/226 (72.12%), Query Frame = 2
Query: 6923 GITFLKISHNDRMVVA-------GFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            G T L ++ +D ++VA       G   +++ +   V  L   +      QP   +FNAK  ATEIIG DEA+TGTR+GEL +WNL T + +RQI ISATLEG   T L PH + I+C+ +S +G +LVTGS DQT  ++TM DERL+HTLEGHADDVLS  ISLD+E++V+GSWDGS+RVW +  G+QMCWFTSNIEIL VK++NDK+A+VALGER G RKLIMLQ
Sbjct: 2246 GCTDLHLACDDSVLVAQVLDDITGLDTLNEPSEIRVKRLQGIH------QPKFITFNAKAEATEIIGNDEAVTGTRRGELFVWNLLTGRVMRQIQISATLEGGNLTMLPPHTETIHCVKLSTDGHYLVTGSQDQTARIWTMPDERLLHTLEGHADDVLSVAISLDSEVVVTGSWDGSIRVWRIRDGNQMCWFTSNIEILQVKISNDKRALVALGERSGHRKLIMLQ 2465          
BLAST of Cell polarity protein vs. TrEMBL
Match: A0A183ME42 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS14317 PE=4 SV=1)

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 538/1631 (32.99%), Postives = 830/1631 (50.89%), Query Frame = 2
Query:  848 TINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFG-----------EVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQF------RTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGD-QSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTL-----QPD-ATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDN--------VNNQIIGKIPVLKYLRTFDNTFEYIFVGS---DNFEAGKE------------KFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIY-IEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQ-LDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTW--SLVGCLGEFLISEDKFLSNKL---SGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCS-EGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSD-SFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYV--HNEQPICDCTATGFIGQKCEREICTSNFCKN--------------------------------------GGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYI-SNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQ-EGFQGSRCQERKECPPNFCKNDGICSVI-NNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGN-KYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPP---TSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSF 5431
            ++NF   ++++Y+F NR+ R  E E L + F      TSGLLW+SE    KSY    +S LYY Y        AQ T TEEI++   L P     L + R  D      NLT+T++   +A+++I  GR PL+  +G +Y+GG  +    TEG++D  F+G I    ++ +  +  +L+N+  D +    ++  G           ++ I   +S     + +   S  PVP TF   D  +     D      + I         TK P G     GPD  H D+VC+E +D N+Y  + + G     ++NP  T V  G  +++++ R+  H+FT KF N  VD+ + +  HQ  F +YTYIG IDN  RLPW+VWSRE F GCI+ + VNE+ Y+D   +  Q++    G+ +G+C    + C    C GG C  RSYP+L + NF CDCS   +T+     +I R   C R++  +  DG   YVVDF+ + ++   + THTDDI++ FKT      Q D   +F +       YF V LV G + V+TNIN K      + F +P   LNDN+WH ++I RRA++I+I VD         ++  + GKIP+L    TF    + I++GS    NF   ++            KFVG  RNFYWNQ+D +GT+     Y   +  P       P +PR      T +    Y  +      ++    + IEFKT Y G+++   D+ N    ++T M+++ ++ +++ I++ + V  I  G     + D NWHR+ I L K  + I+ ++D GY  + +    ++   +S+ + +FGG+PE  +  +   LR    +  E+    +    SL GC+G F I  + F  N L      +  YP N L  G C +  +C   YC + GLC Q++ +++ C CS  G  G +C      CP  +C+N GRC + + QP CDCS TG+ G  CE S CS  ++C NNG C +   +  CDC+ T   G  C + IC+  +C   G C V    +QP+C+C  TG+ G +CE  IC  N+C+N                                       G+CV R   PTC C P + G +C    C SN+C N GTCY   + +P C+C  NFEG++CE+ K CP D+C +GG C +  G P CDC  T+Y+GT+C IP+ CP+ +C N G C V++G Y C+C   G++G  C E   CPPN+C N GICSV+  N + CDC+ T   G  C     G+   YE+ GY+IY + P + T  D VT GF+T+M +GT+ TF TTDG+YW++K+ +G++++D  G   +      NDG Y++++I+++G   I    G   E   +S   + +   N ++Y  I +    ++ DIF+G IGG +WNG+Y  + +        GT+ I+  P     PP     C   +C+N G C   +Y   C C  T + G RCE++  G  P     G +++  I P  +T++D+ +   Q + ++ P++R    D  +YE+ + DGKL    NG    L    Q  ++   +++   R+K    F I+G  T+ +
Sbjct:  356 SVNFPEGSFVRYDFMNRLQRTVEEEVLTINFTLPFGVTSGLLWFSESDQSKSY----NSLLYYIYAITDQTGKAQRTVTEEIFLNSSLIPEKPQVLQLIRDRD------NLTITLDHRSQASRSI-AGRAPLVSTDGKVYLGGSVDPIKDTEGKVDKTFQGRITKAEITRKGDKDVNLLNVLIDPNWKDSIQPTGITDVRFRLPKAQLIIGPTSSNKRFTSLESEFSRIPVPITFMGTDDSIVLGSRDQILCAGLWISIVDESHNMTKWPSGA--SSGPDQEHRDFVCVELFDGNVYFVYAVGGHYKHIRLNPPKTVVNDGGIYSVYVSRNAQHRFTVKFNNQLVDVEEGKEAHQAAFATYTYIGSIDNVGRLPWHVWSRENFAGCIHSILVNENSYLDVSSRMIQHTDIGKGIRLGQCEVPKQRCNEKICGGGRCSRRSYPFLEELNFACDCSESDKTFPEKTMDIRRSVGCDRDAPILEMDGDMVYVVDFEEQINK---LITHTDDISLQFKTETNLHGQTDHLPLFYSVSRADKSYFRVDLVNGQIRVQTNINHKGKSNAFEEFFLPSATLNDNRWHTLHIARRADYIVISVDRASITGRLLIDTPLRGKIPLLDPHDTFQLIAQQIYLGSAGPPNFGYYQDIDTKKIMLPPGPKFVGEFRNFYWNQYDLIGTKLFPTKYTTHLLNPPAIRHKFPIWPRQQTYSITCKSGLIYAHMNKPITMKNGGDTWLIEFKTNYDGVLFRARDINNPSGIHITAMILNGRIHIIYSIHDQQGVYQITSGPGADNVADGNWHRLAITLRKYNKEILAYLD-GYSNEYLVGKNVRVDLLSQFDIFFGGIPEHEWLTLLNLLRRYAMHSLERSEAKDGQQPSLTGCIGSFNIRANNFTDNLLKLYDSYLTAYPANELIRGYCMDLKRCTPSYCHHGGLCRQISDNEVQCICSGTGHEGPRCSNPITECPPGYCKNNGRCKIVNGQPICDCSNTGYTGTMCEISPCSSGTYCHNNGRCYMIGSVAACDCKGTGFTGPRCLESICTPGYCGYGGVCTVDPRTQQPVCNCRGTGYTGTRCETRICPVNYCENYGECKVGPDDRPTCDCSRTNYAGPTCNIPLCPPNYCTGHGICVVRQRNPTCDCYPGYRGPRCEIEVCPSNYCMNGGTCYPGPDHKPHCTCPANFEGEQCEMRKICPPDYCLHGGRCTMNRGIPKCDCLGTDYKGTQCEIPETCPVGYCQNNGVCSVKSGSYVCDCTGTGYRGRTCTEPITCPPNYCNNGGICSVLPGNVYRCDCSMTARTGPQCDSSAHGIHIGYERDGYLIYNLIPSIRTVDDNVTFGFKTYMNSGTLVTFLTTDGKYWAIKLRDGRVIVDTGGKITHDFGMRSNDGNYHIINIERKGRTMIVTQDG---EVLRLSLQDLVNPYDNSLTYNAIHLAVDEKKSDIFRGVIGGLHWNGRYPIDDLNARIVTSTGTVTIVSTPGFQIHPPRPQPECIADYCSNGGRCYAENYQRKCDCRYTAYNGARCERQSRGFMPQIPDNGAFVIYQIQPLNRTNRDQLRVAFQTWYNDGPIVRVVQTDGSYYEVYLRDGKLYADINGAEFTLSKPSQIFNDSRMHVITMDRDKARFNFTIDGHHTTHY 1966          

HSP 2 Score: 95.5153 bits (236), Expect = 1.882e-15
Identity = 64/219 (29.22%), Postives = 105/219 (47.95%), Query Frame = 2
Query: 4985 PTSCPKGFCANNGECIIMDYIPY-CKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISN-DGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNS--VNKKGEVIIILMP 5629
            P +CP  +C N G C ++    Y C C  T   G +C+   HGI  +     GYL+ N+IP  +T  D   F  + Y ++  ++ F   D +++ I + DG++I    GK       G R ++ N +++   R+   +    +G +    +L+++++  D SL +  I L  D+     F+G IGG  WNG   IDD    LN+  V   G V I+  P
Sbjct: 1598 PITCPPNYCNNGGICSVLPGNVYRCDCSMTARTGPQCDSSAHGIH-IGYERDGYLIYNLIPSIRTVDDNVTFGFKTYMNSGTLVTFLTTDGKYWAIKLRDGRVIVDTGGKITHDF--GMRSNDGNYHIINIERKGRTMIVTQDG-EVLRLSLQDLVNPYDNSLTYNAIHLAVDEKKSDIFRGVIGGLHWNGRYPIDD----LNARIVTSTGTVTIVSTP 1808          
BLAST of Cell polarity protein vs. TrEMBL
Match: A0A564XYW4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1196 PE=4 SV=1)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 475/1275 (37.25%), Postives = 687/1275 (53.88%), Query Frame = 2
Query:  818 YDTKSSQQKRTINFNGQN-YLKYNFENRIIRPSEN-----EELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSI--KNVTVSGENHETFDLINIFRDKS--------------------------SVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEF-DKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRK-QMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQ--SGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQ---IIGKIPVLKYLRTFDNTFEYIFVGS---DNFEAGK-----------EKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXX--XXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSN---KLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSE-GFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPE-FTGFQCNERKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQE-GFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            Y++        INF+G N +++++F+NRI  P  +     EE+ L F      TSGLLW+++    KS+I +KD RLYY YI      GA+ T TEEI + E L P   HRL ++R  D       L+L   +  K    I+ G+ PLIP NG IY+GG +N+ I+T+G ++  F GS+    +T  G      +++ + RD +                             I+   G +  T  T     H G   +  +P+P TF      +VRF  WDF  F S E++FRT EP GVL FVGPD  HTD+VC+E +D N+Y A+GI G  YR  Q+NP    V TG  H ++++R   H+F  K+ + E+D+ DQ  S HQ EF SYTY G ID PSR PW VWSRE F GCIN++RVN+DK++DP  + NQ++    G+  G C      C    C+GG CH+RSYP+    NF CDCSA  +T+R  V +I R E C R++  +  DG +  ++DF+ + +    + THTDDI + FKT    + +F    +    YF V+L  G + V TN+N   N      F +    LNDN WH + I+RRA+ + I VDN + +   +  +IP       F+N  + I+VG    DN+ +              KFVG +RNFYWNQ+DF GTR+L   Y   + TP+  LP     P      + CT + +    +V   A    ++ + +EFKT+Y G++ H  D   +  ++ TLM++  +L L++ I  V  V  I + S   + DN WHRV   L++   R +V VD    P+      ++   ++ L F+FGG+P  +++ +   +R+  P         +  +L GCLG F    D+FL +   K    + +YP   +  G CR+ ++C   YC N G+C +++   L CNC+  G++G KCE    TCP +FC NGG C +    P C+C GTG+ G++CE S CS  +C+N GIC++ NG PVCDCRNT + G  C+  IC   +C N G C V N +P+CDC+ TG  G  C++ +C+ ++C+NGG C+ +  QP C C+    +G  C    C  ++C N G C + N+RP C C    +EG  CE    C S +C  GGVC I NG P CDC NT Y G  C  P  C   FC NGG C V+NGQ  C+C++ G+ G  C E+  C  ++C N G+CSVIN    CDC +TG+ G  C + +
Sbjct:  287 YNSDRGANISAINFDGTNGFVRFDFQNRIRLPRTDAEVGREEVALDFVLKPGVTSGLLWFAKGAASKSFIIIKDRRLYYKYIAYDETYGAKRTLTEEIVINETLEPGKTHRLRLNRYQD----VLRLSLGTQQQFKK---IVSGKAPLIPENGVIYIGGSDNAAISTDGEVERNFDGSVTAAKITQEGSGITNLNMLELIRDPNWNRNVLRNGVVEYEYHMPYRPPVQVPKTSIIDPNGPLMPTASTR---GHAG-ITLHTSPIPVTFMGTQSSVVRFDTWDFSTFHSFEMEFRTFEPNGVLFFVGPDREHTDFVCVEIFDGNVYFAYGI-GDHYRHIQLNPVTRKVNTGTAHRVYVERTPQHRFIVKYNDQEIDV-DQGTSRHQAEFSSYTYFGSIDQPSRFPWIVWSRENFAGCINFIRVNDDKFLDPASRMNQHTDFSRGIQFGVCKAPELRCNREICDGGQCHERSYPFFEPMNFACDCSASDKTFREGVMDIRRSESCNRDAPIVEFDGETVLMIDFERQMN---TLTTHTDDINLQFKTESLYSPLFVAVSTAEKQYFRVELENGLIKVTTNMNKASNPPRDSQFILQSPRLNDNNWHTLRIRRRAQFLYISVDNTSEKDDVLTVEIP----KGVFNNIAQQIYVGGMMPDNYASPPYGNMAGFLPRGPKFVGEMRNFYWNQYDFFGTRQLPTHYTTDVLTPRLELPTFPSWPREPIYSITCTSKLNWGTIQVPMKATDAGDMWL-LEFKTKYDGVLTHARD--ETTGSHFTLMILKGRLHLIYSIGGVTGVQEIIN-SPITVSDNVWHRVTFGLDRIKGRFVVIVDDS-APETFGHR-LQHNTLNTLTFHFGGVPR-IWSKILEIIRLHAPTSLPSGYEMSPPALTGCLGGFSTRTDRFLVDLLKKYDANLESYPTGEIIRGYCRDLVRCTPDYCFNGGICVKVSDTVLLCNCTNTGYSGPKCEDRVTTCPPNFCLNGGYCSIIGTNPVCNCQGTGYYGDHCEFSVCSSDYCKNGGICTVVNGQPVCDCRNTPYGGARCDAIICPPDYCRNGGVCLVQNGRPVCDCSGTGHSGLYCDQPVCSPHYCRNGGRCIIQGGQPICDCSSTGHSGRFCEIPICRPDYCRNGGRCMVQNDRPVCDCRGTGYEGLHCE-NAICRSGYCMNGGVCSIVNGRPVCDCTNTGYGGQLCEQPI-CRPGFCLNGGRCIVQNGQPVCDCRDTGYVGPHC-EQGICRSDYCMNGGVCSVINGQPVCDCRNTGHGGSLCEQPI 1531          

HSP 2 Score: 556.599 bits (1433), Expect = 4.811e-157
Identity = 296/791 (37.42%), Postives = 443/791 (56.01%), Query Frame = 2
Query: 3344 LISEDKFLSNKLSGAINTYPLNSLDC-----GG--CRNPLKCEMGYCQNRGLCYQLAIDKLGCNCS-EGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYV-HNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYIS-NERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCEC-QEGFQGSRCQERKECPPNFCKNDGICSVINNG-FTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTII---NRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFP-RLISDG-QRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNL-LNS---------VNKKGEVIIILMPNL 5635
            +   D  ++  +   IN  P+   DC     GG  C  P+ C  GYC N G C  +   +  C+C+   + G++C      C  +FC NGG CY+Y+  P C+C+   FRG+ C+   C   +C+NNG C +    P+CDC  T H G  C  PIC + +C N G C+V  + QP CDC+ T + G +CE  IC  N+C   G C     +P C C  E+ G QC  + C   FC + GTCY   + RP C C + ++G +CEI K CP  +CY+GG C +++G P C+C NT+Y+G RC  PK CP  +C NGG C V  G+Y C C   GFQG  C +   CP  +C + GIC+V+  G + C+C  TG  G +C   V G+  +YEK GY++Y ++PP  TT D VTVGF+T+ ++GTI  F TT G +W +K+ NG +V+D NG +Y   + VNDG Y++VSI++ G+R +  L   Q     ++  G+T      I+Y  + +GA     DIF+GAIGG  WNG+Y  ++ K G     G +  +L+P+ I    +P   C   FC N G C + DY   C C  TG+ G RCE+   G+ P     G Y+++++ PPK+T+ D  +   Q Y ++ P+ RF  ND ++Y++ M  G+ +F+ N K   RLIS   Q+ D+   +++   R      + ++G  T+ ++   ++ N  SLI  +IILGAD++++  F G IG F+WNG  ++ +SG L +NS         V  K +V+I++MP+L
Sbjct: 1494 ICRSDYCMNGGVCSVINGQPV--CDCRNTGHGGSLCEQPI-CPDGYCANGGRCV-VQNGRPYCDCTGTDYRGDRCTHP--ICLPNFCLNGGYCYVYEGSPHCNCTAD-FRGDRCQSPVCPAGYCENNGRCYMSGSTPMCDCTGTGHTGDRCTNPICPDGYCQNGGVCHVLPSGQPFCDCSYTLYTGDQCENPICQPNYCSGRGTCRVEQGRPVCDCQLEYWGPQCQLQVCPPGFCRHGGTCYAGPDRRPHCRCPEGYDGDQCEIPKSCPPGYCYHGGECTMQSGMPVCNCINTDYQGPRCETPKTCPPGYCQNGGLCTVSGGRYICNCFGTGFQGPTCSDPVACPAGYC-HGGICTVLPGGRYLCNCWKTGLSGPTCDGDVNGIYIDYEKVGYMVYDLNPPFKTTEDNVTVGFKTYSQSGTILDFVTTIGAHWGIKIRNGHIVVDRNGQEYMYPNIVNDGAYHIVSIERRGDRMLVTLDNDQIVNLPMT--GITDRSDQSITYTTLYVGADRNREDIFRGAIGGLYWNGRYPIDEAKGGLQVITGEVIYVLLPSFILPGKKPVPQCLPDFCFNGGICYVKDYELKCDCRLTGWQGSRCEQPTRGVLPAVTGNGAYIILSVSPPKRTNVDRMRVAFQTYATDGPIARFMSNDGRYYDVYM-KGQQVFVSNTKDEIRLISAPYQQCDDGKMHVITLARNGSRWDWSVDGHHTTYYDTY-LLDNSASLITNEIILGADRNFRHSFNGVIGAFDWNGQNLVSESGELSVNSNVMIVPGRGVGDKDDVVIVVMPHL 2272          

HSP 3 Score: 278.87 bits (712), Expect = 4.322e-71
Identity = 139/319 (43.57%), Postives = 183/319 (57.37%), Query Frame = 2
Query: 3428 CRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSE-GFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCEIEKRCPSDFCYYGGVCQI-RNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGIC 4375
            C N + C  GYC N G+C  +   +  C+C+  G+ G+ CE+    C   FC NGGRC + + QP CDC  TG+ G +CEQ  C   +C N G+CS+ NG PVCDCRNT H G +CE+PIC + +C N GRC V N +P CDCT T + G +C   IC  NFC NGG C   +  P C CT +F G +C    C + +C N+G CY+S   P C CT     G RC     CP  +C  GGVC +  +G P+CDC  T Y G +C  P  C   +CS  G C+V  G+  C+CQ  + G +CQ  + CPP FC++ G C
Sbjct: 1416 CENAI-CRSGYCMNGGVC-SIVNGRPVCDCTNTGYGGQLCEQP--ICRPGFCLNGGRCIVQNGQPVCDCRDTGYVGPHCEQGICRSDYCMNGGVCSVINGQPVCDCRNTGHGGSLCEQPICPDGYCANGGRCVVQNGRPYCDCTGTDYRGDRCTHPICLPNFCLNGGYCYVYEGSPHCNCTADFRGDRCQSPVCPAGYCENNGRCYMSGSTPMCDCTGTGHTGDRC-TNPICPDGYCQNGGVCHVLPSGQPFCDCSYTLYTGDQCENPI-CQPNYCSGRGTCRVEQGRPVCDCQLEYWGPQCQ-LQVCPPGFCRHGGTC 1727          

HSP 4 Score: 271.937 bits (694), Expect = 6.489e-69
Identity = 146/357 (40.90%), Postives = 194/357 (54.34%), Query Frame = 2
Query: 3416 DCGG-------CRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSE-GFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQC-TPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQ-EGFQGSRCQERKECPPNFCKNDGICSVINNGFT-CDCTHTGYFGISCSEKV 4450
            DC G       C  P+ C   YC+N G C       + C+CS  G +G  CE     C  D+CRNGGRC + + +P CDC GTG+ G +CE + C   +C N G+CSI NG PVCDC NT + G++CE+PIC   FC N GRC V N QP+CDC  TG++G  CE+ IC S++C NGG+C   + QP C C      G  C +  C   +C N G C + N RP C CT  ++ G RC     C  +FC  GG C +  G P+C+C   ++ G RC  P  CP  +C N G C +      C+C   G  G RC     CP  +C+N G+C V+ +G   CDC++T Y G  C   +
Sbjct: 1331 DCSGTGHSGLYCDQPV-CSPHYCRNGGRCIIQGGQPI-CDCSSTGHSGRFCEIP--ICRPDYCRNGGRCMVQNDRPVCDCRGTGYEGLHCENAICRSGYCMNGGVCSIVNGRPVCDCTNTGYGGQLCEQPICRPGFCLNGGRCIVQNGQPVCDCRDTGYVGPHCEQGICRSDYCMNGGVCSVINGQPVCDCRNTGHGGSLCEQPICPDGYCANGGRCVVQNGRPYCDCTGTDYRGDRC-THPICLPNFCLNGGYCYVYEGSPHCNC-TADFRGDRCQSPV-CPAGYCENNGRCYMSGSTPMCDCTGTGHTGDRCTN-PICPDGYCQNGGVCHVLPSGQPFCDCSYTLYTGDQCENPI 1679          
BLAST of Cell polarity protein vs. Ensembl Cavefish
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:103042618])

HSP 1 Score: 132.494 bits (332), Expect = 5.790e-30
Identity = 111/331 (33.53%), Postives = 147/331 (44.41%), Query Frame = 2
Query: 3800 CNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQ-IRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC-SEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDING--------NKYQTQSNVNDGQYYVVSIKKEGERGIFKL 4741
            C N+G C       +C C   GF G KCE +I  C S  C+NGGLC        CQC P F G  C     +CSS+ C NDG C     R  CSCT  F G RCE+E   C S  C  GG C+ +  GY  C C    + G  C I    C    C NGG C      + CEC +G++G  CQ +  EC PN C N   C      +TC C   G+ G  C +E  +    E+E  G   + +   +     Q+T  F  +MK+   Y + T          DN  L+ID NG         +      VNDGQ++ + +    E G +++
Sbjct: 1204 CQNQGTCEEVGVGYVCTCLP-GFTGAKCESDIDECDSTPCQNGGLCRDGMGGFQCQCQPGFVGSLCEAEVNECSSSPCLNDGVCVDEVNRFTCSCTDGFTGPRCELEIDECESSPCQNGGECKDLEAGY-SCSCSQ-GFTGDSCEINIDECYSAPCLNGGTCVDDINDFRCECVQGYRGKLCQVDEDECEPNPCVNGATCEDGVGSYTCRCP-PGFNGTRCETEMSSSFDLEFEVSGIHSFVMMDGLMPALTQITCTF--WMKSYDTYNYGTPISYAVDGGSDNAFLLIDYNGWVLYVNGKERITDCPAVNDGQWHHIGVSWRSEDGDWRV 1528          

HSP 2 Score: 99.7525 bits (247), Expect = 5.140e-20
Identity = 83/230 (36.09%), Postives = 102/230 (44.35%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE 4108
            +C +  CQN+G C ++ +  + C C  GFTG KCE     C    C+NGG C       +C C   GF G+ CE     CS S C N+G+C  E     C C +    G  CE  I  C  S C N G C        C C+  GF G  CE  I  C S  C NGG CV   +   C+C   + G  C  +E +C  N C N  TC        C C   F G RCE E
Sbjct: 1198 ECFLNPCQNQGTCEEVGVGYV-CTCLPGFTGAKCESDIDECDSTPCQNGGLCRDGMGGFQCQCQ-PGFVGSLCEAEVNECSSSPCLNDGVCVDEVNRFTCSCTDG-FTGPRCELEIDECESSPCQNGGECKDLEAGYSCSCS-QGFTGDSCEINIDECYSAPCLNGGTCVDDINDFRCECVQGYRGKLCQVDEDECEPNPCVNGATCEDGVGSYTCRCPPGFNGTRCETE 1423          
BLAST of Cell polarity protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 130.183 bits (326), Expect = 2.762e-29
Identity = 115/357 (32.21%), Postives = 158/357 (44.26%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +    +   C C EG+ G+ CE     C ++ CRNG  C       +C C  +G+ G NCE     C  + C N G C     +  C C     +G  CE+ I  C  + C N   C        C C   GF G  CE     CT + C NGG CV   +  +C C   FTG  C     +C S  C N GTC  S    +C+C   + G  C E+   C    C  GG C+       C CQ T + G  C++P   C +            C N G C      +YC+CQ G+ GS C+E+  EC PN C+N   C+    G++C+C   GY G++CS ++
Sbjct:  806 CNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSCK-SGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCL-PGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPP-GFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQ-TGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECV-PGYHGVNCSSEI 1157          

HSP 2 Score: 121.324 bits (303), Expect = 1.286e-26
Identity = 118/354 (33.33%), Postives = 150/354 (42.37%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEK--PICSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C N G C   ++    C C  G+TG+ C++ +  C  + C NGG+C  +D    C C+   F G  C+Q       S   C N G+C  E G   C+C  T++ GK CE     CS S C + G C    E    C C   GF GQ CE  I  C  + C NGG CV   +   CQC PE+TG  C    NE     N C N GTC  +     C C   + G+ C      C    C  G  C  R    +C+C      G  C++   C    C  G NC     NG+  C C  G+ GS C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   79 CRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQAD-PCASNPCANGGQCSPFDSHYICTCT-PFFSGETCKQDVNECALSPFPCNNGGVCVNEVGSYRCNCP-TEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLP-GFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHDRVASFFCECP-PGRTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKC-QQGYVGPRCELDV 426          

HSP 3 Score: 116.316 bits (290), Expect = 4.031e-25
Identity = 111/344 (32.27%), Postives = 146/344 (42.44%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQ-HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +CE   C N G C  +    + C+C  GF+G  C+     C  + C N G C       KC+C    + G NCE     C+   C+NNG+C          C   +  +G+ CE  I  C ++ C N   C        C C  +G+ G+ CE +I  C  N C NGG C       +C C P F G +C E   +C SN C N   C        C+C   F G  CE     C    C+ GG C        C C    + G+ C      C  + C NGG CQ   G Y C C  G++G  CQE    C P+ CKN G C      +TC C  TG+ G+ C
Sbjct:  729 ECESNPCMNGGTCKDMTSGYV-CSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCL-LPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSC-KSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCL-AGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQC-QTGWTGLYC 1067          

HSP 4 Score: 106.686 bits (265), Expect = 3.155e-22
Identity = 115/369 (31.17%), Postives = 149/369 (40.38%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ--SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS------------ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDF---------CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGG--NCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINN---GFTCDCTHTGYFGISC 4438
            N   C    C N G C    I+   C C  GFTG  C+     C    C NGG C       KC C   G+RG NC++  ++C  S C+N G C        C C+ T   G  C+ P  S               C N G C        C C A G+ G  CE ++  C  N C+NG  C       +C+C P + G  C+    +C S  C N GTC       +CSC +  +G  CEI     + F         C+  G C  R G  +C C    Y G RC      C    C   G  +C      Y CEC+ G+ G RC    + C    C+N G C+V +N   GF C C   G+ G +C
Sbjct:  956 NTPDCTESSCFNGGTCVD-GINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCP-HGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQ-TGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHYCQCQA-GYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCP-PGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCP-PGFTGSTC 1318          

HSP 5 Score: 104.76 bits (260), Expect = 1.455e-21
Identity = 111/351 (31.62%), Postives = 152/351 (43.30%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY----MYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C + G C Q       C+C  GF+G+ CE+    CP   C NGG C      Y+ Q K + +G  F   +  +     + CQN G C    G   C C N    G+ C K I  C+++ CN    C+       C+C   G  G  C   + C SN C+ G  C   P + +  C C   + G  C++   +CS  +N C + G C  +    QC C + + G RCE++   C S+ C     C  + G  +C C    YEG  C I    C    C N G C  +   Y CEC  GF G++CQ +  EC    CKN   C    N +TC CT  GY G  C   +
Sbjct:  195 CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQ-FCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGW-TGEDCSKNIDDCADAACNVGATCHDRVASFFCEC-PPGRTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICM-AGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTE-GYTGQHCETDI 540          

HSP 6 Score: 94.3597 bits (233), Expect = 1.964e-18
Identity = 116/371 (31.27%), Postives = 161/371 (43.40%), Query Frame = 2
Query: 3368 SNKLSG-AINTYPLNSLDCGGCRNPLKCEMGY--CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +N ++G AI T PL        ++  +C +G   C++ G C         C C +G+ G +CE     C  + C+N   C        C C   G+ G  CE     C+   C NNG C  +     C+C  T   G  C+     C+ + C N  +C        C CT  G+ GQ CE +I  C SN C  G LC    +  TC C   +TG  C  N  +C S+ C N GTC        C C +   G  CEI    C S+ C +G      NGY  C C+   Y G  C+I    C +  C NGG C      + C+C++G+    CQ +  EC  N C + G C    NG+ C C  +G+ G +C
Sbjct:  362 TNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTK-GSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICM-AGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECP-TGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTE-GYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFGKCIDKINGY-ECACE-PGYTGKLCSINIDECAINPCHNGGTCIDGVNGFMCQCRDGYHDPTCQSQLNECLSNPCIH-GHCEDRVNGYNCICD-SGWSGNNC 723          

HSP 7 Score: 81.6481 bits (200), Expect = 1.221e-14
Identity = 102/326 (31.29%), Postives = 138/326 (42.33%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-GTGFRGNNCEQSFCSDSF----CQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCS 4441
            C C  G TG  C  +   C  + C+ G  C       K  C+   G+ G+ C+Q     S     C++ G C    G   C C+   + G  CE  +  C  + C N   C        C C A G+ G+ CE   + C S  C N G C+ + +   C+C   F+G QC  +  +C+S  C N   C        C CT+ + GQ CE +   C S+ C+YG +C+       C C+   Y G  C  NI   C    C NGG CQ R   Y C C  G  G  C+    +C  N C + G C    NG+ C C   GY G  CS
Sbjct:  332 CECPPGRTGLLCH-LNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQG-YVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICMA-GYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTEGYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCR-AGYTGRLCEANI-NECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPC-DFGKCIDKINGYECAC-EPGYTGKLCS 649          

HSP 8 Score: 61.2326 bits (147), Expect = 2.191e-8
Identity = 46/137 (33.58%), Postives = 65/137 (47.45%), Query Frame = 2
Query: 4058 PQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQ--IRNGYPYCDCQ-NTNYEGTRCNIPKRCPLEF--CSNGGNCQVRNGQYY-CECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P   C + F G  C+    C  + C+ GGVCQ  IR+      CQ +  Y   RC  P   P     C NGG C++ + + Y C+C  G+ G  CQ+   C  N C N G CS  ++ + C CT   + G +C + V
Sbjct:   17 PSFRCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCASNPCANGGQCSPFDSHYICTCTPF-FSGETCKQDV 152          

HSP 9 Score: 53.9138 bits (128), Expect = 3.236e-6
Identity = 94/382 (24.61%), Postives = 138/382 (36.13%), Query Frame = 2
Query: 3443 KCEMGYCQNRGL--CYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK---CDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE---ICTSNFCKNGGLCVPRDSQP--TCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDC----QNTNYEGTRCNIPKRCPLEFCSNGGNCQ--VRNGQYYCECQEG---FQGSRCQER-KECPP---NFCKN---DGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPP 4510
            +C    C  RG   C QL  +   C C  G+TG++C+ +   C    CRNGG C +    P    C C   GF G+ CE                                    +   C    C N G C   ++ P C C+ + F G +C+      C SN C NGG C P    P   C C  +F G  C+      ++ F  G        P+   +       CEI +            C+ + G   CD        +++G  C++  R P + CS+   C     NG+   +C      + G  CQ    EC P    +CK+   DG C    N   C+     + G+ C++ V     E    G ++  V  P
Sbjct: 1243 ECLSNPCDPRGTHSCIQL-TNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCP-PGFTGSTCEY-----------------------------------DAQACGSLQCKNGGTCVSGHKNPRCLCSPS-FTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHIL----DYGFTGGFGRDITPPPEVEAS-------CEIPE------------CEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNCSDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECE-----WDGLDCADNVP----EKRATGLLVLVVHLP 1554          
BLAST of Cell polarity protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 129.798 bits (325), Expect = 3.527e-29
Identity = 115/357 (32.21%), Postives = 158/357 (44.26%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +    +   C C EG+ G+ CE     C ++ CRNG  C       +C C  +G+ G NCE     C  + C N G C     +  C C     +G  CE+ I  C  + C N   C        C C   GF G  CE     CT + C NGG CV   +  +C C   FTG  C     +C S  C N GTC  S    +C+C   + G  C E+   C    C  GG C+       C CQ T + G  C++P   C +            C N G C      +YC+CQ G+ GS C+E+  EC PN C+N   C+    G++C+C   GY G++CS ++
Sbjct:  832 CNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSCK-SGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCL-PGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPP-GFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQ-TGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECV-PGYHGVNCSSEI 1183          

HSP 2 Score: 120.939 bits (302), Expect = 1.547e-26
Identity = 118/354 (33.33%), Postives = 150/354 (42.37%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEK--PICSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C N G C   ++    C C  G+TG+ C++ +  C  + C NGG+C  +D    C C+   F G  C+Q       S   C N G+C  E G   C+C  T++ GK CE     CS S C + G C    E    C C   GF GQ CE  I  C  + C NGG CV   +   CQC PE+TG  C    NE     N C N GTC  +     C C   + G+ C      C    C  G  C  R    +C+C      G  C++   C    C  G NC     NG+  C C  G+ GS C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:  105 CRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQAD-PCASNPCANGGQCSPFDSHYICTCT-PFFSGETCKQDVNECALSPFPCNNGGVCVNEVGSYRCNCP-TEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLP-GFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHDRVASFFCECP-PGRTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKC-QQGYVGPRCELDV 452          

HSP 3 Score: 115.931 bits (289), Expect = 5.097e-25
Identity = 111/344 (32.27%), Postives = 146/344 (42.44%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQ-HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +CE   C N G C  +    + C+C  GF+G  C+     C  + C N G C       KC+C    + G NCE     C+   C+NNG+C          C   +  +G+ CE  I  C ++ C N   C        C C  +G+ G+ CE +I  C  N C NGG C       +C C P F G +C E   +C SN C N   C        C+C   F G  CE     C    C+ GG C        C C    + G+ C      C  + C NGG CQ   G Y C C  G++G  CQE    C P+ CKN G C      +TC C  TG+ G+ C
Sbjct:  755 ECESNPCMNGGTCKDMTSGYV-CSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCL-LPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSC-KSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCL-AGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQC-QTGWTGLYC 1093          

HSP 4 Score: 106.301 bits (264), Expect = 3.986e-22
Identity = 115/369 (31.17%), Postives = 149/369 (40.38%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ--SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS------------ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDF---------CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGG--NCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINN---GFTCDCTHTGYFGISC 4438
            N   C    C N G C    I+   C C  GFTG  C+     C    C NGG C       KC C   G+RG NC++  ++C  S C+N G C        C C+ T   G  C+ P  S               C N G C        C C A G+ G  CE ++  C  N C+NG  C       +C+C P + G  C+    +C S  C N GTC       +CSC +  +G  CEI     + F         C+  G C  R G  +C C    Y G RC      C    C   G  +C      Y CEC+ G+ G RC    + C    C+N G C+V +N   GF C C   G+ G +C
Sbjct:  982 NTPDCTESSCFNGGTCVD-GINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCP-HGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQ-TGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHYCQCQA-GYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCP-PGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCP-PGFTGSTC 1344          

HSP 5 Score: 104.375 bits (259), Expect = 1.778e-21
Identity = 111/351 (31.62%), Postives = 152/351 (43.30%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY----MYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C + G C Q       C+C  GF+G+ CE+    CP   C NGG C      Y+ Q K + +G  F   +  +     + CQN G C    G   C C N    G+ C K I  C+++ CN    C+       C+C   G  G  C   + C SN C+ G  C   P + +  C C   + G  C++   +CS  +N C + G C  +    QC C + + G RCE++   C S+ C     C  + G  +C C    YEG  C I    C    C N G C  +   Y CEC  GF G++CQ +  EC    CKN   C    N +TC CT  GY G  C   +
Sbjct:  221 CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQ-FCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGW-TGEDCSKNIDDCADAACNVGATCHDRVASFFCEC-PPGRTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICM-AGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTE-GYTGQHCETDI 566          

HSP 6 Score: 93.9745 bits (232), Expect = 2.542e-18
Identity = 116/371 (31.27%), Postives = 161/371 (43.40%), Query Frame = 2
Query: 3368 SNKLSG-AINTYPLNSLDCGGCRNPLKCEMGY--CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +N ++G AI T PL        ++  +C +G   C++ G C         C C +G+ G +CE     C  + C+N   C        C C   G+ G  CE     C+   C NNG C  +     C+C  T   G  C+     C+ + C N  +C        C CT  G+ GQ CE +I  C SN C  G LC    +  TC C   +TG  C  N  +C S+ C N GTC        C C +   G  CEI    C S+ C +G      NGY  C C+   Y G  C+I    C +  C NGG C      + C+C++G+    CQ +  EC  N C + G C    NG+ C C  +G+ G +C
Sbjct:  388 TNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTK-GSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICM-AGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECP-TGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTE-GYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFGKCIDKINGY-ECACE-PGYTGKLCSINIDECAINPCHNGGTCIDGVNGFMCQCRDGYHDPTCQSQLNECLSNPCIH-GHCEDRVNGYNCICD-SGWSGNNC 749          

HSP 7 Score: 89.7373 bits (221), Expect = 5.359e-17
Identity = 103/314 (32.80%), Postives = 140/314 (44.59%), Query Frame = 2
Query: 3578 CRNGGRCYMYD--KQPKCDCSGTGFRGNNCEQS-FCSDSFCQNNGICSI---ENGLP-VCDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C+NGG C      +  +C C    F G+ C+ S  C  + C N G+C     +N +  VC C    +    C  P    C  S C N G C + + +   C C   G+ G+ C++ + C SN C NGG C P DS   C CTP F+G  C    NE   S   C N G C       +C+C   + G+ CE + + C    C +GG C  +    Y C C    + G  C  NI   CP   C NGG C      Y C+C+  + G  C E   EC   PN C+N G C     G+ C C + G+ G  CS+ +
Sbjct:   28 CQNGGTCVPTPDGRGGECKCP-EKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCH-LGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPP-GWTGKNCQQADPCASNPCANGGQCSPFDSHYICTCTPFFSGETCKQDVNECALSPFPCNNGGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCL-PGFSGQNCEENI-DDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVN-GWTGEDCSKNI 335          

HSP 8 Score: 81.6481 bits (200), Expect = 1.439e-14
Identity = 102/326 (31.29%), Postives = 138/326 (42.33%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-GTGFRGNNCEQSFCSDSF----CQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCS 4441
            C C  G TG  C  +   C  + C+ G  C       K  C+   G+ G+ C+Q     S     C++ G C    G   C C+   + G  CE  +  C  + C N   C        C C A G+ G+ CE   + C S  C N G C+ + +   C+C   F+G QC  +  +C+S  C N   C        C CT+ + GQ CE +   C S+ C+YG +C+       C C+   Y G  C  NI   C    C NGG CQ R   Y C C  G  G  C+    +C  N C + G C    NG+ C C   GY G  CS
Sbjct:  358 CECPPGRTGLLCH-LNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQG-YVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICMA-GYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTEGYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCR-AGYTGRLCEANI-NECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPC-DFGKCIDKINGYECAC-EPGYTGKLCS 675          

HSP 9 Score: 67.0106 bits (162), Expect = 4.076e-10
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 2
Query: 3980 GFQCNERKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQ--IRNGYPYCDCQ-NTNYEGTRCNIPKRCPLEF--CSNGGNCQVRNGQYY-CECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            G +C+E+      C N GTC  + +    +C C + F G  C+    C  + C+ GGVCQ  IR+      CQ +  Y   RC  P   P     C NGG C++ + + Y C+C  G+ G  CQ+   C  N C N G CS  ++ + C CT   + G +C + V
Sbjct:   21 GLKCSEK------CQNGGTCVPTPDGRGGECKCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCASNPCANGGQCSPFDSHYICTCTPF-FSGETCKQDV 178          

HSP 10 Score: 53.9138 bits (128), Expect = 3.559e-6
Identity = 94/382 (24.61%), Postives = 138/382 (36.13%), Query Frame = 2
Query: 3443 KCEMGYCQNRGL--CYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK---CDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE---ICTSNFCKNGGLCVPRDSQP--TCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDC----QNTNYEGTRCNIPKRCPLEFCSNGGNCQ--VRNGQYYCECQEG---FQGSRCQER-KECPP---NFCKN---DGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPP 4510
            +C    C  RG   C QL  +   C C  G+TG++C+ +   C    CRNGG C +    P    C C   GF G+ CE                                    +   C    C N G C   ++ P C C+ + F G +C+      C SN C NGG C P    P   C C  +F G  C+      ++ F  G        P+   +       CEI +            C+ + G   CD        +++G  C++  R P + CS+   C     NG+   +C      + G  CQ    EC P    +CK+   DG C    N   C+     + G+ C++ V     E    G ++  V  P
Sbjct: 1269 ECLSNPCDPRGTHSCIQL-TNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCP-PGFTGSTCEY-----------------------------------DAQACGSLQCKNGGTCVSGHKNPRCLCSPS-FTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHIL----DYGFTGGFGRDITPPPEVEAS-------CEIPE------------CEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNCSDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECE-----WDGLDCADNVP----EKRATGLLVLVVHLP 1580          
BLAST of Cell polarity protein vs. Ensembl Cavefish
Match: notch1b (neurogenic locus notch homolog protein 1-like [Source:NCBI gene;Acc:103025197])

HSP 1 Score: 129.798 bits (325), Expect = 3.527e-29
Identity = 115/357 (32.21%), Postives = 158/357 (44.26%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +    +   C C EG+ G+ CE     C ++ CRNG  C       +C C  +G+ G NCE     C  + C N G C     +  C C     +G  CE+ I  C  + C N   C        C C   GF G  CE     CT + C NGG CV   +  +C C   FTG  C     +C S  C N GTC  S    +C+C   + G  C E+   C    C  GG C+       C CQ T + G  C++P   C +            C N G C      +YC+CQ G+ GS C+E+  EC PN C+N   C+    G++C+C   GY G++CS ++
Sbjct:  832 CNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSCK-SGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCL-PGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPP-GFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQ-TGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHYCQCQAGYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECV-PGYHGVNCSSEI 1183          

HSP 2 Score: 120.939 bits (302), Expect = 1.547e-26
Identity = 118/354 (33.33%), Postives = 150/354 (42.37%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEK--PICSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C N G C   ++    C C  G+TG+ C++ +  C  + C NGG+C  +D    C C+   F G  C+Q       S   C N G+C  E G   C+C  T++ GK CE     CS S C + G C    E    C C   GF GQ CE  I  C  + C NGG CV   +   CQC PE+TG  C    NE     N C N GTC  +     C C   + G+ C      C    C  G  C  R    +C+C      G  C++   C    C  G NC     NG+  C C  G+ GS C Q+  EC    N C++ G C      F C C   GY G  C   V
Sbjct:  105 CRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQAD-PCASNPCANGGQCSPFDSHYICTCT-PFFSGETCKQDVNECALSPFPCNNGGVCVNEVGSYRCNCP-TEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCLP-GFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGWTGEDCSKNIDDCADAACNVGATCHDRVASFFCECP-PGRTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKC-QQGYVGPRCELDV 452          

HSP 3 Score: 115.931 bits (289), Expect = 5.097e-25
Identity = 111/344 (32.27%), Postives = 146/344 (42.44%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQ-HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +CE   C N G C  +    + C+C  GF+G  C+     C  + C N G C       KC+C    + G NCE     C+   C+NNG+C          C   +  +G+ CE  I  C ++ C N   C        C C  +G+ G+ CE +I  C  N C NGG C       +C C P F G +C E   +C SN C N   C        C+C   F G  CE     C    C+ GG C        C C    + G+ C      C  + C NGG CQ   G Y C C  G++G  CQE    C P+ CKN G C      +TC C  TG+ G+ C
Sbjct:  755 ECESNPCMNGGTCKDMTSGYV-CSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCL-LPYTGENCETLLDPCNPKPCKNNGVCKESEDYESFSCVCPEGWQGQTCEIDINECVKNPCRNGATCQNSIGSYRCSC-KSGYTGRNCETDIDDCKPNPCSNGGFCKDGVDVFSCTCLPGFRGLRCEEDINECDSNPCKNGANCTDCVNSYTCTCPPGFSGINCENNTPDCTESSCFNGGTCVDGINTFSCLCL-AGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCPHGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQC-QTGWTGLYC 1093          

HSP 4 Score: 106.301 bits (264), Expect = 3.986e-22
Identity = 115/369 (31.17%), Postives = 149/369 (40.38%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ--SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICS------------ESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDF---------CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGG--NCQVRNGQYYCECQEGFQGSRCQERKE-CPPNFCKNDGICSVINN---GFTCDCTHTGYFGISC 4438
            N   C    C N G C    I+   C C  GFTG  C+     C    C NGG C       KC C   G+RG NC++  ++C  S C+N G C        C C+ T   G  C+ P  S               C N G C        C C A G+ G  CE ++  C  N C+NG  C       +C+C P + G  C+    +C S  C N GTC       +CSC +  +G  CEI     + F         C+  G C  R G  +C C    Y G RC      C    C   G  +C      Y CEC+ G+ G RC    + C    C+N G C+V +N   GF C C   G+ G +C
Sbjct:  982 NTPDCTESSCFNGGTCVD-GINTFSCLCLAGFTGSYCQHDINECDSKPCMNGGTCQDSYGTYKCTCP-HGYRGFNCQELVNWCKPSPCKNGGTCRQSGTTYTCQCQ-TGWTGLYCDVPSVSCEVAAKQQGVEVARLCRNSGLCLDAGNTHYCQCQA-GYTGSYCEEQVDECIPNPCQNGATCTDYLGGYSCECVPGYHGVNCSSEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEINLDDCTPFTDPVTKEPKCFNQGRCVDRVGGYHCVCP-PGYVGERCEGDVNECLSNPCDPRGTHSCIQLTNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCP-PGFTGSTC 1344          

HSP 5 Score: 104.375 bits (259), Expect = 1.778e-21
Identity = 111/351 (31.62%), Postives = 152/351 (43.30%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY----MYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C + G C Q       C+C  GF+G+ CE+    CP   C NGG C      Y+ Q K + +G  F   +  +     + CQN G C    G   C C N    G+ C K I  C+++ CN    C+       C+C   G  G  C   + C SN C+ G  C   P + +  C C   + G  C++   +CS  +N C + G C  +    QC C + + G RCE++   C S+ C     C  + G  +C C    YEG  C I    C    C N G C  +   Y CEC  GF G++CQ +  EC    CKN   C    N +TC CT  GY G  C   +
Sbjct:  221 CSPSPCLHGGTCVQKGETSYECSCLPGFSGQNCEENIDDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQ-FCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVNGW-TGEDCSKNIDDCADAACNVGATCHDRVASFFCEC-PPGRTGLLCHLNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICM-AGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTE-GYTGQHCETDI 566          

HSP 6 Score: 93.9745 bits (232), Expect = 2.542e-18
Identity = 116/371 (31.27%), Postives = 161/371 (43.40%), Query Frame = 2
Query: 3368 SNKLSG-AINTYPLNSLDCGGCRNPLKCEMGY--CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +N ++G AI T PL        ++  +C +G   C++ G C         C C +G+ G +CE     C  + C+N   C        C C   G+ G  CE     C+   C NNG C  +     C+C  T   G  C+     C+ + C N  +C        C CT  G+ GQ CE +I  C SN C  G LC    +  TC C   +TG  C  N  +C S+ C N GTC        C C +   G  CEI    C S+ C +G      NGY  C C+   Y G  C+I    C +  C NGG C      + C+C++G+    CQ +  EC  N C + G C    NG+ C C  +G+ G +C
Sbjct:  388 TNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTK-GSFQCKCQQGYVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICM-AGYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECP-TGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTE-GYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCRAGYTGRLCEANINECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPCDFGKCIDKINGY-ECACE-PGYTGKLCSINIDECAINPCHNGGTCIDGVNGFMCQCRDGYHDPTCQSQLNECLSNPCIH-GHCEDRVNGYNCICD-SGWSGNNC 749          

HSP 7 Score: 89.7373 bits (221), Expect = 5.359e-17
Identity = 103/314 (32.80%), Postives = 140/314 (44.59%), Query Frame = 2
Query: 3578 CRNGGRCYMYD--KQPKCDCSGTGFRGNNCEQS-FCSDSFCQNNGICSI---ENGLP-VCDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C+NGG C      +  +C C    F G+ C+ S  C  + C N G+C     +N +  VC C    +    C  P    C  S C N G C + + +   C C   G+ G+ C++ + C SN C NGG C P DS   C CTP F+G  C    NE   S   C N G C       +C+C   + G+ CE + + C    C +GG C  +    Y C C    + G  C  NI   CP   C NGG C      Y C+C+  + G  C E   EC   PN C+N G C     G+ C C + G+ G  CS+ +
Sbjct:   28 CQNGGTCVPTPDGRGGECKCP-EKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCH-LGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPP-GWTGKNCQQADPCASNPCANGGQCSPFDSHYICTCTPFFSGETCKQDVNECALSPFPCNNGGVCVNEVGSYRCNCPTEYTGKHCETLYQPCSPSPCLHGGTCVQKGETSYECSCL-PGFSGQNCEENI-DDCPDHRCLNGGTCVDGVNTYNCQCKPEWTGQFCTEDVNECDLMPNSCQNGGTCLNTQGGYNCVCVN-GWTGEDCSKNI 335          

HSP 8 Score: 81.6481 bits (200), Expect = 1.439e-14
Identity = 102/326 (31.29%), Postives = 138/326 (42.33%), Query Frame = 2
Query: 3509 CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-GTGFRGNNCEQSFCSDSF----CQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCS 4441
            C C  G TG  C  +   C  + C+ G  C       K  C+   G+ G+ C+Q     S     C++ G C    G   C C+   + G  CE  +  C  + C N   C        C C A G+ G+ CE   + C S  C N G C+ + +   C+C   F+G QC  +  +C+S  C N   C        C CT+ + GQ CE +   C S+ C+YG +C+       C C+   Y G  C  NI   C    C NGG CQ R   Y C C  G  G  C+    +C  N C + G C    NG+ C C   GY G  CS
Sbjct:  358 CECPPGRTGLLCH-LNDACISNPCQKGSNCDTNPVNGKAICTCPLGYFGSACDQDVDECSLGANPCEHAGKCLNTKGSFQCKCQQG-YVGPRCELDVNECLSNPCQNDATCLDQIGGFHCICMA-GYEGKFCEINTDECASMPCLNNGKCIDKINNYQCECPTGFSGNQCQFDNDECASTPCKNGAKCIDGPNMYTCQCTEGYTGQHCETDIDECLSNPCHYG-LCKDSLAGFTCHCR-AGYTGRLCEANI-NECLSHPCQNGGTCQDRENAYLCVCPRGTSGVNCEINLDDCQSNPC-DFGKCIDKINGYECAC-EPGYTGKLCS 675          

HSP 9 Score: 67.0106 bits (162), Expect = 4.076e-10
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 2
Query: 3980 GFQCNERKCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQ--IRNGYPYCDCQ-NTNYEGTRCNIPKRCPLEF--CSNGGNCQVRNGQYY-CECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            G +C+E+      C N GTC  + +    +C C + F G  C+    C  + C+ GGVCQ  IR+      CQ +  Y   RC  P   P     C NGG C++ + + Y C+C  G+ G  CQ+   C  N C N G CS  ++ + C CT   + G +C + V
Sbjct:   21 GLKCSEK------CQNGGTCVPTPDGRGGECKCPEKFWGSACQFSNPCLPNPCWNGGVCQPVIRDNKVDFVCQCHLGYMDPRCLTPTDNPCRSSPCGNGGTCELTSVRTYKCKCPPGWTGKNCQQADPCASNPCANGGQCSPFDSHYICTCTPF-FSGETCKQDV 178          

HSP 10 Score: 53.9138 bits (128), Expect = 3.559e-6
Identity = 94/382 (24.61%), Postives = 138/382 (36.13%), Query Frame = 2
Query: 3443 KCEMGYCQNRGL--CYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK---CDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCERE---ICTSNFCKNGGLCVPRDSQP--TCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDC----QNTNYEGTRCNIPKRCPLEFCSNGGNCQ--VRNGQYYCECQEG---FQGSRCQER-KECPP---NFCKN---DGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPP 4510
            +C    C  RG   C QL  +   C C  G+TG++C+ +   C    CRNGG C +    P    C C   GF G+ CE                                    +   C    C N G C   ++ P C C+ + F G +C+      C SN C NGG C P    P   C C  +F G  C+      ++ F  G        P+   +       CEI +            C+ + G   CD        +++G  C++  R P + CS+   C     NG+   +C      + G  CQ    EC P    +CK+   DG C    N   C+     + G+ C++ V     E    G ++  V  P
Sbjct: 1269 ECLSNPCDPRGTHSCIQL-TNNYRCECRTGYTGQRCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCP-PGFTGSTCEY-----------------------------------DAQACGSLQCKNGGTCVSGHKNPRCLCSPS-FTGPECQYPSDGPCLSNPCYNGGTCEPSTESPYFHCVCPADFNGLLCHIL----DYGFTGGFGRDITPPPEVEAS-------CEIPE------------CEAKKGNKECDAACNSHECDWDGGDCSLNFRDPWQNCSDALQCWRYFNNGKCDEQCHSAGCLYDGFDCQRSGGECNPLYDQYCKDHYADGHCDQGCNNAECE-----WDGLDCADNVP----EKRATGLLVLVVHLP 1580          
BLAST of Cell polarity protein vs. Ensembl Cavefish
Match: notch1a (neurogenic locus notch homolog protein 1 [Source:NCBI gene;Acc:103034623])

HSP 1 Score: 129.028 bits (323), Expect = 6.329e-29
Identity = 116/360 (32.22%), Postives = 155/360 (43.06%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQP-ICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRC-QERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKN 4465
             C    C+N G C  + +    C C  G++G+ C++ +  C  + C NGG+C  ++    C C    F G  C Q       S S C+N G+C  E G   C C   +  G  CE+P   C  S C N G C   ++    C C   GF GQ CE  I  C  + C+NGG C+   +   C C   +TG  C E     + S N C N GTC+ +     C C   + G  C E    C S  CY+G  C  R    YC+C +    G  C++   C    C  G NC     NG+  C C  G+ GS C Q+  EC    N C++ G C      F C C   GY G  C   V   K+
Sbjct:   77 ACMNSPCRNGGSCSLITLATFSCRCPPGWSGKTCQQAD-PCASNPCANGGQCSAFESHFICTCP-PNFHGQTCRQDVNECALSPSPCRNGGVCVNEVGSYRCRCP-AEFAGTHCERPFHPCHPSPCTNGGTCVQTSDTGYTCSCLP-GFNGQDCEHNIDDCVQHACENGGKCMDGVNTYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTVGGFHCVCVNGWSGDDCSENIDDCASAACYHGATCHDRVASFYCECPH-GRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNQDIDECSLGANPCEHGGRCLNTKGSFQCKCL-KGYEGPRCEMDVNECKS 430          

HSP 2 Score: 125.176 bits (313), Expect = 8.354e-28
Identity = 122/396 (30.81%), Postives = 164/396 (41.41%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCS-GTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQ----------------------------------------VRNG--------QYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C    C N+G C    +    CNC   +TG+ CE +   C    C+NGG C   +      C+   G++G  CE     C  S C N G+C    G   C C N    G +CE     C+ + C+N G C        C C A GF G++C  +I  C S  C+NGG C    +  TC C   F+G  C  N   C+ + CFN GTC        C C   F G  C+ +   C S  C  GG CQ   G   C C +  Y G  C ++ + C    C NGG+C                                          RNG         + C CQ G+ GS CQE+  EC PN C N   C+    G+TC+C   GY G++CS+++
Sbjct:  766 ECASNPCLNQGTCID-DVAGYKCNCLLPYTGDLCESVLAPCSSRPCKNGGVCRESEDYQSFSCACPAGWQGQTCEVDINECVKSPCLNGGVCLNSVGGFQCHC-NPGFTGDLCETDTDDCTPNPCSNGGVCVDRVNGFTCVCVA-GFRGERCTEDIDECVSAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGINSFSCVCLPGFTGSYCQHDVNECDSRPCLNGGTCQDGFGTYKCTCPH-GYTGANCQSLVRWCDSSPCKNGGSCWQKGSSFTCQCASGWTGLYCDVPSVSCEVAAQQQGVPVATLCRNGGQCVDVGSTHLCRCQAGYTGSYCQEQVDECVPNPCHNGATCTDYLGGYTCECV-AGYHGVNCSKEI 1156          

HSP 3 Score: 117.857 bits (294), Expect = 1.418e-25
Identity = 117/369 (31.71%), Postives = 158/369 (42.82%), Query Frame = 2
Query: 3428 CRNPLK-CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCNE--RKCS--SNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            C  P   C    C N G C Q +     C+C  GF G+ CE     C +  C NGG+C        C C    + G  C +       S + CQN G C    G   C C N    G  C + I  C+ + C +   C+       C+C   G  G  C   + C SN C+ G  C   P + +  C C P +TG  CN+   +CS  +N C + G C  +    QC C K +EG RCE++   C S+ C     C  + G  +C C    YEG  C I    C  + C N G C  +   +YCEC +GF GS CQ +  EC    C+N   C+   N FTC+C   G+ G  C   +    +    YG
Sbjct:  187 CERPFHPCHPSPCTNGGTCVQTSDTGYTCSCLPGFNGQDCEHNIDDCVQHACENGGKCMDGVNTYNCHCD-KHWTGQYCTEDVDECELSPNACQNGGTCHNTVGGFHCVCVNGW-SGDDCSENIDDCASAACYHGATCHDRVASFYCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNQDIDECSLGANPCEHGGRCLNTKGSFQCKCLKGYEGPRCEMDVNECKSNPCQNDATCLDQIGGFHCICM-PGYEGEFCQINTDDCASQPCLNNGKCIDKINSFYCECPKGFSGSLCQVDVDECASTPCQNGAKCTDGPNKFTCECKE-GFTGSLCEIDINECASNPCHYG 550          

HSP 4 Score: 103.605 bits (257), Expect = 3.226e-21
Identity = 108/350 (30.86%), Postives = 151/350 (43.14%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTC---PRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGK-VCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C    C+N G C     +   C C +G TG  CE     C   P DF    G+C       +C C   G+ G  C  +   C+ + C+N G C        C C +  H    + ++  C+ + C + G C       +C C   G+ G+ C+  +  C SN C NGG C    +   C C   F+G  C  N  +C+SN C N GTC       +C+C   + G  CE +   C S  C  GGVC+    Y    C     ++G  C +    C    C NGG C    G + C C  GF G  C+ +  +C PN C N G+C    NGFTC C   G+ G  C+E +
Sbjct:  578 ECLSQPCRNGGTCLDRE-NSYTCTCPKGTTGRNCEINVDDCKSKPCDF----GKCIDKINGYECLCD-PGYTGATCNINIDDCALNPCRNGGTCVDGVNSFTCLCPDGYHDSTCLSQRNECASNPCIH-GNCQDQANSYLCVCEP-GWTGRNCDLNLNECLSNPCVNGGTCRDMTNGYICSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGDLCESVLAPCSSRPCKNGGVCRESEDYQSFSCACPAGWQGQTCEVDINECVKSPCLNGGVCLNSVGGFQCHCNPGFTGDLCETDTDDCTPNPCSNGGVCVDRVNGFTCVCV-AGFRGERCTEDI 918          

HSP 5 Score: 96.6709 bits (239), Expect = 3.974e-19
Identity = 103/336 (30.65%), Postives = 139/336 (41.37%), Query Frame = 2
Query: 3434 NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK-RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDC 4408
            N   C    C N G C    I+   C C +GF+G  C+     C    C+NG +C     +  C+C   GF G+ CE     C+ + C   G+C        C CR   + G++CE  I  C    C N G C        C C   G  G+ CE  +  C S  C + G C+ + +   C C P +TG  CN     C+ N C N GTC        C C   +    C  ++  C S+ C +G      N Y  C C+   + G  C++    C    C NGG C+     Y C C+ GF G  CQ    EC  N C N G C     G+ C+C
Sbjct:  462 NTDDCASQPCLNNGKCID-KINSFYCECPKGFSGSLCQVDVDECASTPCQNGAKCTDGPNKFTCECK-EGFTGSLCEIDINECASNPCHY-GVCKDGLASFTCACR-PGYAGRLCEININECLSQPCRNGGTCLDRENSYTCTC-PKGTTGRNCEINVDDCKSKPC-DFGKCIDKINGYECLCDPGYTGATCNINIDDCALNPCRNGGTCVDGVNSFTCLCPDGYHDSTCLSQRNECASNPCIHGNCQDQANSY-LCVCE-PGWTGRNCDLNLNECLSNPCVNGGTCRDMTNGYICSCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNC 789          

HSP 6 Score: 83.5741 bits (205), Expect = 3.074e-15
Identity = 94/289 (32.53%), Postives = 118/289 (40.83%), Query Frame = 2
Query: 3644 FRGNNCE-QSFCSDSFCQNNGICSIEN-GLPV---CDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERK---ECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            F G  C+  + CS S C+N G+C     G  V   C+C      G +C  P+   C  S C N G C +            G+ G+ C++ + C SN C NGG C   +S   C C P F G  C    NE   S + C N G C       +C C   F G  CE     C    C  GG C   +   Y C C    + G  C  NI   C    C NGG C      Y C C + + G  C E     E  PN C+N G C     GF C C + G+ G  CSE +
Sbjct:   24 FVGPQCQIPNPCSPSPCRNGGVCRPRTQGNDVDFTCECM-LGFSGPLCLTPVNHACMNSPCRNGGSCSLITLATFSCRCPPGWSGKTCQQADPCASNPCANGGQCSAFESHFICTCPPNFHGQTCRQDVNECALSPSPCRNGGVCVNEVGSYRCRCPAEFAGTHCERPFHPCHPSPCTNGGTCVQTSDTGYTCSCL-PGFNGQDCEHNI-DDCVQHACENGGKCMDGVNTYNCHCDKHWTGQYCTEDVDECELSPNACQNGGTCHNTVGGFHCVCVN-GWSGDDCSENI 308          

HSP 7 Score: 75.0998 bits (183), Expect = 1.246e-12
Identity = 137/591 (23.18%), Postives = 209/591 (35.36%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDC-RNTQHKGKVCE----------KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGL--CVPRDSQPTCQCTPEFTGF----------------------------------------QCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE--IEKRCPSDFCYYGGVCQIRNGYPY--CDCQNTNYEGTRCNIPKRCPLEFCSNGG------------------NCQVRNGQYYCECQ-----EGFQGSRCQ------ERKECPP---NFCKN---DGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYV--VSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGA-----SNEERDIFKGAIGGF-NWNGKYIFEQIKT 4921
            C+N G C  +    L C C  G+TG  C++    C  + C NG  C  Y     C+C   G+ G NC +    C    CQN G C        C C R TQ  G  CE           P+  E  C N GRC        C C+  G++G++CE ++  C S+ C   G   CV   +   C+C   +TG                                         + N + C S  C N  TC   +  P+C C   F G  C+  ++  C S+ CY GG CQ  +  P+  C C + N+ G  C+I     L++  NGG                   C+ R G   C+ Q      G+ G  C          +C P    +CK+   DG C    N   C+     + G+ C+E V   K        V++     +   S          + T  ++  R  +G           L+    GN+++   +      +     + +   R +   +  +    L   +   S V  EI  ++    +     S  +   F GA+    N N  YI E + +
Sbjct: 1088 CRNGGQCVDVGSTHL-CRCQAGYTGSYCQEQVDECVPNPCHNGATCTDYLGGYTCECV-AGYHGVNCSKEINECVSQPCQNGGTCIDLVNSYKCSCPRGTQ--GVHCEIDVDDCSPDTDPLTGEPRCFNGGRCVDRVGGYGCVCSP-GYVGERCEGDVNECLSDPCDPNGSYNCVQLVNSYRCECRTGYTGMYTYTNMCNISLWPYFTGGKYCTLLKLQKNRKSIGFSGSSCEYNSQSCGSLRCRNGATCVSGHLSPRCLCPPGFSGHECQNRLDSPCLSNPCYNGGTCQPISDAPFFRCLCPH-NFNGLLCHI-----LDYSFNGGQGKDIAPPPELEIRCEVAQCEGRGGNAICDAQCNNHACGWDGGDCSLNFDDPLEGQCNPLYDQYCKDHYSDGHCDQGCNNVECE-----WDGLDCAEDVP-QKLAVGSLVLVVHITPTELQNRSSSFLRELSGLLHTNVVFR-RNANGE---------PLIFPYYGNEHELSKHKRSAHDWSDPAQLLQRARRSLSAFVHTRLRRELDQMEIKGSIVYLEIDNRQCFQQSDECFQSATDVAAFLGALASSGNLNVPYIIEAVTS 1651          

HSP 8 Score: 67.3958 bits (163), Expect = 2.492e-10
Identity = 99/340 (29.12%), Postives = 131/340 (38.53%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDF--------CRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGI--CSIENGLPVCDCRNTQHKGKVCEKPICSES---FCNNRGRCYVHNEQPICDCTATGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER---KCSSNFCFNDGTCYISNERP--QCSCTKNFEGQRCEIEKRCPSDFCYYGG------------------VCQIRNGYPYCDCQNTN----YEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQE 4330
            +C    CQN G C  L ++   C+C  G  G  CE     C  D         C NGGRC        C CS  G+ G  CE     C    C  NG   C        C+CR T + G      +C+ S   +      C +   Q   +  + GF G  CE   + C S  C+NG  CV     P C C P F+G +C  R    C SN C+N GTC   ++ P  +C C  NF G  C I      D+ + GG                   C+ R G   CD Q  N    ++G  C++    PLE     G C     QY   C++ +    C +
Sbjct: 1158 ECVSQPCQNGGTCIDL-VNSYKCSCPRGTQGVHCEIDVDDCSPDTDPLTGEPRCFNGGRCVDRVGGYGCVCS-PGYVGERCEGDVNECLSDPCDPNGSYNCVQLVNSYRCECR-TGYTGMYTYTNMCNISLWPYFTGGKYCTLLKLQK--NRKSIGFSGSSCEYNSQSCGSLRCRNGATCVSGHLSPRCLCPPGFSGHECQNRLDSPCLSNPCYNGGTCQPISDAPFFRCLCPHNFNGLLCHI-----LDYSFNGGQGKDIAPPPELEIRCEVAQCEGRGGNAICDAQCNNHACGWDGGDCSLNFDDPLE-----GQCNPLYDQY---CKDHYSDGHCDQ 1479          

HSP 9 Score: 60.077 bits (144), Expect = 4.859e-8
Identity = 47/150 (31.33%), Postives = 65/150 (43.33%), Query Frame = 2
Query: 4031 GTCYISNERP---QCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIR---NGYPY-CDCQNTNYEGTRCNIP--KRCPLEFCSNGGNCQ-VRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            G C +    P   + SC  +F G +C+I   C    C  GGVC+ R   N   + C+C    + G  C  P    C    C NGG+C  +    + C C  G+ G  CQ+   C  N C N G CS   + F C C    + G +C + V
Sbjct:    4 GVCSLGGSAPVTSRHSCPADFVGPQCQIPNPCSPSPCRNGGVCRPRTQGNDVDFTCECM-LGFSGPLCLTPVNHACMNSPCRNGGSCSLITLATFSCRCPPGWSGKTCQQADPCASNPCANGGQCSAFESHFICTCP-PNFHGQTCRQDV 151          
BLAST of Cell polarity protein vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 100.138 bits (248), Expect = 6.655e-21
Identity = 79/221 (35.75%), Postives = 109/221 (49.32%), Query Frame = 2
Query: 3689 CQNNGICSI-ENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVH-NEQPICDCTATGFIGQKCEREICTSNFCKNGGLC-VPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNE-RPQCSCTKNFEGQRCEIEK--RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNC--QVRNGQYYCECQEGFQGSRCQ 4327
            C N G C + E GL  C C+  +  G+ CE   C E +C N G C    +  P C C    F G +CER++C   +C NGG C V   +QP C+CT  + G +C    C  N+C N G C  + +  P C+C   F G RC+ ++   CP      GG C++  G     C  T    +RC       LEFC NGG C      G+  C+CQ G++GS+C+
Sbjct: 4172 CLNGGSCFLNERGLAKCKCQ-PRFSGERCELDQCKE-YCQNGGTCMASPSGMPTCRC-PNRFTGAQCERKVC-DGYCLNGGACSVNAGNQPVCRCTDAYKGDRCQSTLC-DNYCMNGGVCSFAKDGSPLCACHPRFLGTRCDTDRCGHCP------GGQCELGPGAGDVRCNCTGPACSRC-------LEFCYNGGLCFWDSVAGRPACQCQPGWEGSQCE 4374          

HSP 2 Score: 95.1301 bits (235), Expect = 2.252e-19
Identity = 68/209 (32.54%), Postives = 99/209 (47.37%), Query Frame = 2
Query: 3578 CRNGGRCYMYDK-QPKCDCSGTGFRGNNCEQSFCSDSFCQNNGIC-SIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVH-NEQPICDCTATGFIGQKCEREICTSNFCKNGGLC-VPRDSQPTCQCTPEFTGFQCNERKCSS----------------------------NFCFNDGTCYISNE--RPQCSCTKNFEGQRCE 4102
            C NGG C++ ++   KC C    F G  CE   C + +CQN G C +  +G+P C C N +  G  CE+ +C + +C N G C V+   QP+C CT   + G +C+  +C  N+C NGG+C   +D  P C C P F G +C+  +C                               FC+N G C+  +   RP C C   +EG +CE
Sbjct: 4172 CLNGGSCFLNERGLAKCKCQPR-FSGERCELDQCKE-YCQNGGTCMASPSGMPTCRCPN-RFTGAQCERKVC-DGYCLNGGACSVNAGNQPVCRCT-DAYKGDRCQSTLC-DNYCMNGGVCSFAKDGSPLCACHPRFLGTRCDTDRCGHCPGGQCELGPGAGDVRCNCTGPACSRCLEFCYNGGLCFWDSVAGRPACQCQPGWEGSQCE 4374          

HSP 3 Score: 72.4034 bits (176), Expect = 1.603e-12
Identity = 63/192 (32.81%), Postives = 89/192 (46.35%), Query Frame = 2
Query: 3443 KCEMG----YCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYM-YDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSI-ENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDS---QPTCQCTPEFTGFQC 3991
            +CE+     YCQN G C         C C   FTG +CE+        +C NGG C +    QP C C+   ++G+ C+ + C D++C N G+CS  ++G P+C C + +  G  C+   C        G+C +        C  TG    +C        FC NGGLC   DS   +P CQC P + G QC
Sbjct: 4198 RCELDQCKEYCQNGGTCMASPSGMPTCRCPNRFTGAQCER---KVCDGYCLNGGACSVNAGNQPVCRCT-DAYKGDRCQSTLC-DNYCMNGGVCSFAKDGSPLCAC-HPRFLGTRCDTDRCGHC---PGGQCELGPGAGDVRCNCTGPACSRCLE------FCYNGGLCF-WDSVAGRPACQCQPGWEGSQC 4373          

HSP 4 Score: 70.8626 bits (172), Expect = 4.970e-12
Identity = 50/150 (33.33%), Postives = 73/150 (48.67%), Query Frame = 2
Query: 4019 CFNDGTCYISNER--PQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNG-QYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTG 4456
            C N G+C++ NER   +C C   F G+RCE+++    ++C  GG C    +G P C C N  + G +C   ++    +C NGG C V  G Q  C C + ++G RCQ       N+C N G+CS   +G      H  + G  C     G
Sbjct: 4172 CLNGGSCFL-NERGLAKCKCQPRFSGERCELDQ--CKEYCQNGGTCMASPSGMPTCRCPN-RFTGAQCE--RKVCDGYCLNGGACSVNAGNQPVCRCTDAYKGDRCQ--STLCDNYCMNGGVCSFAKDGSPLCACHPRFLGTRCDTDRCG 4313          

HSP 5 Score: 68.5514 bits (166), Expect = 2.989e-11
Identity = 53/156 (33.97%), Postives = 73/156 (46.79%), Query Frame = 2
Query: 3911 CKNGGLC-VPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYIS-NERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNG-YPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQ-VRNGQYYCECQEGFQGSRCQERK--ECPPNFCK 4360
            C NGG C +       C+C P F+G +C   +C   +C N GTC  S +  P C C   F G +C  E++    +C  GG C +  G  P C C +  Y+G RC     C   +C NGG C   ++G   C C   F G+RC   +   CP   C+
Sbjct: 4172 CLNGGSCFLNERGLAKCKCQPRFSGERCELDQCKE-YCQNGGTCMASPSGMPTCRCPNRFTGAQC--ERKVCDGYCLNGGACSVNAGNQPVCRCTDA-YKGDRCQ-STLCD-NYCMNGGVCSFAKDGSPLCACHPRFLGTRCDTDRCGHCPGGQCE 4321          
BLAST of Cell polarity protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002643.1 (pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 gene:ENSPMAG00000002413.1 transcript:ENSPMAT00000002643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 9.089e-21
Identity = 64/191 (33.51%), Postives = 94/191 (49.21%), Query Frame = 2
Query: 3896 CTSNFCKNGGLCVPR-DSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C S  C +GG C+P  D   +C+C P ++G  C      C+S  C ND  C       +C C   F+G+ CEI+   C S+ C +GG C        C C +  + G RC +    C  + C NG  C   +G++ C C  G+ G+ C+ E  EC    C+N G+C  + + +TCDC  TGY G  C  ++
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPD-GFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEI 190          

HSP 2 Score: 71.2478 bits (173), Expect = 5.434e-13
Identity = 71/227 (31.28%), Postives = 92/227 (40.53%), Query Frame = 2
Query: 3497 DKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQP---------------------TCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEG 4090
            D+  C C +GF GE+C+     C    C NG  C   D + +C C   G+ G  CE     C    CQN G+C        CDC  T ++GK CE  I  C+ + C +   C        C C   GF G  CE ++  C    C NGG C+   S+P                     TC+C P  TG  C  N  +C S  C N G+C  +     C C   F G
Sbjct:   94 DRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCP-RGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWP-GFAGDACEEDVNECGDEPCMNGGQCIEL-SKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 3 Score: 70.4774 bits (171), Expect = 9.388e-13
Identity = 82/281 (29.18%), Postives = 107/281 (38.08%), Query Frame = 2
Query: 3563 CPRDFCRNGGRCY-MYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGIC 4375
            C    C +GG C    D    C C+  G+ G+NCE S   C+   C N+ +C  E G   C C                                        GF G+ CE +I  C S  C +GG C     + +C C   F G +C  +  +C+S  C N  TC   + + +C C + + G  CE E   C S  C  GGVC        CDC  T YEG  C +    C    C +   C      + C C  GF G  C+E   EC    C N G C
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCA-PGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYC--------------------------------------VPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQC 242          

HSP 4 Score: 70.4774 bits (171), Expect = 1.038e-12
Identity = 96/339 (28.32%), Postives = 123/339 (36.28%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE------------------------QSFCSDSF----------------CQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYY---GGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQG 4315
            C  G C + G C   A     C C+ G++G+ CE     C    C N   C       KC C   GF+G +CE                           C D F                C N   C   +G   C C    + G +CE  +  C    C N G C    +   CDC  TG+ G+ CE EI  C SN C++   C+      TC C P F G  C E   +C    C N G C I   +P      +F G+  E+    P  F Y    G  C+   G        T  E    N+   C  + C NGG+C    G + CEC  GF G
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCV-PGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPR-GYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQC-IELSKP------DFYGKLSEL----PGTFHYANASGFTCRCLPG--------TTGENCSVNL-DECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 5 Score: 55.4546 bits (132), Expect = 8.408e-8
Identity = 63/208 (30.29%), Postives = 82/208 (39.42%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLP-VCDCRNTQHKGKVCEKPI--CSESFCNNRGRC--------------------YVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGF 3985
            +C    C N   C  L   K  C C  G+TG  CE     C    C+NGG C        CDC  TG+ G +CE     C+ + C++N  C IE  L   C C      G  CE+ +  C +  C N G+C                    Y +     C C   G  G+ C   +  C S  C NGG C+      +C+C P FTG 
Sbjct:  115 ECASQPCHNGATCVDLD-GKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTC-IEGILNFTCICW-PGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLP-GTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTGL 318          
BLAST of Cell polarity protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001302.1 (pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 gene:ENSPMAG00000001162.1 transcript:ENSPMAT00000001302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 3.436e-20
Identity = 89/317 (28.08%), Postives = 139/317 (43.85%), Query Frame = 2
Query: 3422 GGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI--------PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE 4339
            GGC        G C   G+C         C+C++GF    C +   +CP   C   G+ Y+   + +C C  +G++G  C+     C++  C  +G C    G+ VC   N+ + G+ CE+ +C    C+ +G C VH     C C  +G+ G  CE R+   +  C   GL +   +  TC C   FTG  C+   C  + C   G C   +    C C + + G+ C+ +K C    C   G C  R+G   C+C +  + G  C++         K CP   CS  G C++  G + C C  G++G  C    E
Sbjct:  134 GGCP-------GGCHGNGVCLAGI-----CHCNQGFLPPHCSRA--SCPV-LCSGHGQ-YV---RGRCLCH-SGWKGAECDIPAWQCTNPACGGHGSCI--TGVCVC---NSGYTGESCEEVMCPHPTCSGKGVC-VHG---TCICL-SGWGGPSCETRKPMCAEQCSGHGLYLSELN--TCSCDARFTGADCSTELCPVD-CGAHGVCIGGS----CHCQEGWGGETCD-QKAC-HRHCAEHGAC--RDGK--CEC-SQGWNGEHCSVGKVTANCCQKGCP-AMCSGNGECRLAQGSWLCVCVPGWRGPGCDTSME 405          

HSP 2 Score: 68.9366 bits (167), Expect = 2.002e-11
Identity = 77/306 (25.16%), Postives = 105/306 (34.31%), Query Frame = 2
Query: 3623 CDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK--CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNG----------------------QYYCECQEGFQGSRCQE--------RKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C C+  GF   +C ++ C    C  +G      G  +C   ++  KG  C+ P   C+   C   G C       +C C  +G+ G+ CE  +C    C   G+CV      TC C   + G  C  RK  C+   C   G  Y+S E   CSC   F G  C  E  CP D C   GVC                                  GG+C  + G                         CEC +G+ G  C          +K CP   C  +G C +    + C C   G+ G  C
Sbjct:  151 CHCN-QGFLPPHCSRASCP-VLCSGHG--QYVRGRCLC---HSGWKGAECDIPAWQCTNPACGGHGSCITG----VCVCN-SGYTGESCEEVMCPHPTCSGKGVCV----HGTCICLSGWGGPSCETRKPMCAEQ-CSGHGL-YLS-ELNTCSCDARFTGADCSTE-LCPVD-CGAHGVCI---------------------------------GGSCHCQEGWGGETCDQKACHRHCAEHGACRDGKCECSQGWNGEHCSVGKVTANCCQKGCPA-MCSGNGECRLAQGSWLCVCV-PGWRGPGC 400          

HSP 3 Score: 52.373 bits (124), Expect = 2.016e-6
Identity = 47/171 (27.49%), Postives = 62/171 (36.26%), Query Frame = 2
Query: 3911 CKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK-RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTG 4420
            C   G+C+       C C   F    C+   C    C   G  Y+   R +C C   ++G  C+I   +C +  C   G C        C C N+ Y G  C     CP   CS  G C        C C  G+ G  C+ RK      C   G+     N  +CD   TG
Sbjct:  140 CHGNGVCL----AGICHCNQGFLPPHCSRASCPV-LCSGHGQ-YV---RGRCLCHSGWKGAECDIPAWQCTNPACGGHGSCIT----GVCVC-NSGYTGESCE-EVMCPHPTCSGKGVCV----HGTCICLSGWGGPSCETRKPMCAEQCSGHGLYLSELNTCSCDARFTG 291          
BLAST of Cell polarity protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002014.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 4.660e-20
Identity = 69/187 (36.90%), Postives = 90/187 (48.13%), Query Frame = 2
Query: 3785 CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ 4327
            CS + C N GRC        CDC A GF G++CE +I  CTS+ C+NGG CV      TC C   +TG  C+    +C+S+ C N G C        CSC   + G  C+ +   C S  C  GG C+       C+C    + GTRC      C    C NGG C+     + CEC  GF G+RC+
Sbjct:   15 CSPNPCQNGGRCIDGAASYTCDC-AQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECA-PGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCE 199          

HSP 2 Score: 84.3445 bits (207), Expect = 2.988e-18
Identity = 68/189 (35.98%), Postives = 92/189 (48.68%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC 3991
            +C    CQN G C   A     C+C++GFTG++CE     C  D C+NGG+C        C C   G+ G  C+     C+   CQN G C    G   C C    + G +C+  +  C+ S C N GRC        C+C A GF G +CE ++  C S+ C NGG C    +  TC+C P FTG +C
Sbjct:   14 ECSPNPCQNGGRCIDGAASYT-CDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCL-AGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCL-AGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCEC-APGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRC 198          

HSP 3 Score: 80.1073 bits (196), Expect = 1.023e-16
Identity = 66/186 (35.48%), Postives = 86/186 (46.24%), Query Frame = 2
Query: 3896 CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C+ N C+NGG C+   +  TC C   FTG +C     +C+S+ C N G C        CSC   + G  C+ +   C SD C  GG C    G   C C    Y GT C+     C    C NGG C+     + CEC  GF G+RC+ +  EC  + C N G C      FTC+C   G+ G  C
Sbjct:   15 CSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCL-AGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAP-GFTGTRC 198          

HSP 4 Score: 66.2402 bits (160), Expect = 5.821e-12
Identity = 54/153 (35.29%), Postives = 67/153 (43.79%), Query Frame = 2
Query: 4001 KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +CS N C N G C        C C + F G+RCE +   C SD C  GG C    G   C C    Y GT C+     C  + C NGG C    G + C C  G+ G+ C  +  EC  + C N G C      FTC+C   G+ G  C   V
Sbjct:   14 ECSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCL-AGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAP-GFTGTRCETDV 164          
BLAST of Cell polarity protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000962.1 (pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 gene:ENSPMAG00000000874.1 transcript:ENSPMAT00000000962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 6.142e-19
Identity = 124/449 (27.62%), Postives = 170/449 (37.86%), Query Frame = 2
Query: 3455 GYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ--SFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEK--------------------PICSES-----------FCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI-EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK--RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNV 4678
            G CQN G C  L ++   C C  G+TG  C++    C    C N G+C       +C C   GF G+ C+    +C  + CQN   C   N    C C +  ++GK C +                     + S S            C   GRC              GF G  C   I  CT N CKNGG C+       C C   + G  C  +   CS N C N G C        C C   ++G+ C   E++C    C  G  C  R     C C    +EG  C+I +   C    C N   C      + C C+EG++G  C E   +C P+ C N G C    N + CDC   G+ G  C   V   ++    +G           T  D++  GF+     G    FR  D  Y      NGKL    +G K++ + N+
Sbjct:  215 GQCQNGGTCTDL-VNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCP-AGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSC-SEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCP-MGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCA-PGFAGPDCRINVNECQSNPCAFG----------ATCVDEIN-GFRCLCPHGR-SGFRCQD-VYAKPCPWNGKLY--ASGAKWEDECNL 643          

HSP 2 Score: 80.4925 bits (197), Expect = 4.206e-15
Identity = 106/349 (30.37%), Postives = 142/349 (40.69%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQS---FCSDSFCQNNGICSIENGLP-VCDCRNTQHKGKVCEKPI--CSESFCNNRGRCY--VHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN--ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK--RCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSE 4444
            CE   CQN   C+ L +D   C+CSE + G+ C ++     RD CR       + +     C  T    +N  QS   + S   C  +G C  + G    C C +    G  C + I  C+ + C N G C   V + Q IC     G+ G  CE +   C+ N C+N G C    +   C+C   + G  C+  ER+C    C N  TCY   +   C C   +EG  C I +   C S  C     C        C C+   +EG  C+     C    C NGG C      Y C+C  GF G  C+    EC  N C     C    NGF C C H G  G  C +
Sbjct:  288 CEPNPCQNGAPCFNLNMDYF-CSCSEDYEGKNCSRL-----RDHCRTS----TWPRAVIDSC--TVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSC-DEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICH---EGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKE-GWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPH-GRSGFRCQD 618          

HSP 3 Score: 71.633 bits (174), Expect = 1.910e-12
Identity = 100/376 (26.60%), Postives = 149/376 (39.63%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSD-------SFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESF--CNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRC-EIEKRC-----------------------------PSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEK 4447
            C N G C++       C C+ G+TG  C      C  D C NGG C       +C C    + G  C+    +        + C++  IC +        CR ++        P  ++    C N G C        C C   G+ G+ C++E+  C S+ C N G C  + +   C C   F+G  C  +   C  N C N   C+  N    CSC++++EG+ C  +   C                              S  C   G C  + G  + C C +  + GT C  NI   C +  C NGG C      Y C C EG++G  C+ +  +C PN C+N G C  + N F C+C   G+ G +C  +
Sbjct:   97 CANDGSCHETP-SGFECVCALGWTGLTCAYDIDDCASDPCGNGGTCRDRLNDFECRCPPQ-WMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQCQNGGTCTDLVNGYHCTC-PPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSC-DEGFTGTYCHENI-NDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCEC-RNGWKGKTCHSR 466          

HSP 4 Score: 51.9878 bits (123), Expect = 2.305e-6
Identity = 68/236 (28.81%), Postives = 94/236 (39.83%), Query Frame = 2
Query: 3782 ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN--------ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDF--CYYGGVC-QIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSE 4444
             C    C N G C+       C C A G+ G  C  +I  C S+ C NGG C  R +   C+C P++ G  C         E +  +  C +   C +   +    C  +   Q  ++          C  GG C  + NGY +C C    Y G  C      C    C N G CQ +   + C C  GF G  CQ +   C PN C+N   C  +N  + C C+   Y G +CS 
Sbjct:   91 ACLSDPCANDGSCHETPSGFECVC-ALGWTGLTCAYDIDDCASDPCGNGGTCRDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAP-CESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQCQNGGTCTDLVNGY-HCTCP-PGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSED-YEGKNCSR 321          
BLAST of Cell polarity protein vs. Ensembl Yeast
Match: MDV1 (Peripheral protein of cytosolic face of mitochondrial outer membrane; required for mitochondrial fission; interacts with Fis1p and with the self-assembled oligomeric form of the dynamin-related GTPase Dnm1p; contains WD repeats; MDV1 has a paralog, CAF4, that arose from the whole genome duplication [Source:SGD;Acc:S000003648])

HSP 1 Score: 60.8474 bits (146), Expect = 2.316e-9
Identity = 63/295 (21.36%), Postives = 122/295 (41.36%), Query Frame = 2
Query: 6725 DFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEI--HYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMA---------SYPNGIMVQPLISSFNAKTCATEIIGADEA--ITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAI--------NCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGE 7546
            DF T      P   +C+A  + H+                +  WDL     + E+  H  T        I  ++I+ +   +V G  G D        +L           + P   +  P + +F A T     +  D +  ++G++   +  W+LR+ K ++ I +S      T T ++  K  +        +  A+      L TG+ D  V ++ +   +++ TL+GH D + S  +  D+  +V+GS+D ++R+W+L +G    +   +  +LS+ L  +  A+V   E
Sbjct:  399 DFLTCLDFDAPFGTLCTAGYLDHT----------------VKIWDLSKQNKIGELAGHLAT--------INCMQINRDYGTLVTG--GRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITS--LKFDSACLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQENAAVVVADE 665          
BLAST of Cell polarity protein vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 56.9954 bits (136), Expect = 4.188e-8
Identity = 30/96 (31.25%), Postives = 54/96 (56.25%), Query Frame = 2
Query: 7208 NTQTKLNPHKD-AINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIE 7492
            N  T  +P  D  I  +  S +G+FL TG+ D+ + ++ + + +++  L+GH  D+ S       + +VSGS D ++R+W+L +G   C  T +IE
Sbjct:  433 NLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTG--QCSLTLSIE 526          

HSP 2 Score: 55.4546 bits (132), Expect = 9.705e-8
Identity = 37/127 (29.13%), Postives = 66/127 (51.97%), Query Frame = 2
Query: 7106 DEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSK-NGEFLVTGSADQTVNVYTMADERLMHTLE-------GHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGS 7462
            D+ ++G+    + IW+LRT     Q  ++ ++E           D +  +AVS  +G+++  GS D+ V V+      L+  L+       GH D V S V + D + +VSGS D S+++WNL++ +
Sbjct:  498 DKLVSGSGDRTVRIWDLRTG----QCSLTLSIE-----------DGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNAN 609          
BLAST of Cell polarity protein vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 55.0694 bits (131), Expect = 1.690e-7
Identity = 31/110 (28.18%), Postives = 56/110 (50.91%), Query Frame = 2
Query: 7178 QILISATLEG-----------NTQTKLNPHKDAINCIAVSKNGEFLVTGSADQ-TVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMC 7471
            Q++ S++L+G           N +T     +   NC+AV  +GE +  GS D   ++V+++   +L+  L GH   V     S +N ++ S SWD ++R+W++   SQ  
Sbjct:  400 QVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQV 509          

HSP 2 Score: 50.447 bits (119), Expect = 3.694e-6
Identity = 38/166 (22.89%), Postives = 72/166 (43.37%), Query Frame = 2
Query: 6956 RMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFN-AKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNL 7450
            R++  GFT       + ++DL    P+  ++Q L    N   T +    G   A   ++ G+L+++  ++   +               K   H D+ N +A S +G  +VT S D  + V+ +     + T E H   V +   +   +++ S S DG++R W+L
Sbjct:  273 RLLAVGFTS----GEFRLYDL----PDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYI--------------LKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDL 416          
BLAST of Cell polarity protein vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 54.6842 bits (130), Expect = 1.833e-7
Identity = 35/114 (30.70%), Postives = 58/114 (50.88%), Query Frame = 2
Query: 7115 ITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLES 7456
             TG+    + IW+L T K +R              +L+ H D +  +    +   L+TGS D+T+ V+       + T  GH+D VLS  +    ++IVSGS D +++VW++ES
Sbjct:  316 FTGSYDSTIGIWDLFTGKLIR--------------RLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQKVIVSGSADKTVKVWHVES 411          
BLAST of Cell polarity protein vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 53.1434 bits (126), Expect = 4.714e-7
Identity = 29/128 (22.66%), Postives = 60/128 (46.88%), Query Frame = 2
Query: 7076 KTCATEIIGADEAITGTRKGELIIWN-LRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLES 7456
            K C       +  +T +    + +WN L++ KP+               ++  H+  +N +A S +G ++V+ S D ++ ++   D + + T  GH   V     S D  ++VS S D +++VW++ +
Sbjct:  362 KICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPI--------------ARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRT 475          

HSP 2 Score: 53.1434 bits (126), Expect = 4.920e-7
Identity = 28/77 (36.36%), Postives = 44/77 (57.14%), Query Frame = 2
Query: 7232 HKDAINCIAVSKN-GEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESG 7459
            H   I C A + +    +VTG+ D T  ++    +  MHTL+GH + VL    S D E+I +GS D ++R+W+ +SG
Sbjct:  142 HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG 218          
BLAST of Cell polarity protein vs. Ensembl Nematostella
Match: EDO48851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH9])

HSP 1 Score: 156.762 bits (395), Expect = 5.847e-38
Identity = 124/346 (35.84%), Postives = 171/346 (49.42%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G C ++      C C  GFTG+ CE+    C ++ C+NGG C        C C   GF G NCEQ    C+ + CQN G+C  E+G   C C+     GK CE+ +  CS++ C N G C   +    C C A GF G+ CE+++  C+ N CKNGG+C       +C C   FTG  C +   +CS N C N G C   +    C+C   F G+ CE +   C  + C  GGVC+  +G   C C+   + G  C      C    C NGG C+  +G Y C C+ GF G  C Q+  EC  N CKN G+C   + G++C C   G+ G +C + V
Sbjct:  992 CSSKPCKNGGTCREVN-GAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCACK-AGFTGKNCEQDMNECSKNPCQNGGVCKNEHGGYSCACKA-GFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKICEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKNCEQDV 1331          

HSP 2 Score: 153.68 bits (387), Expect = 5.384e-37
Identity = 124/350 (35.43%), Postives = 174/350 (49.71%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGL 4459
            +C    CQN G+C +       C C  GFTG+ CE+    C ++ C+NGG C        C C   GF G NCEQ    CS + C+N G+C  E+G   C C+     GK CE+ +  CS++ C N G C   +    C C A GF G+ CE+++  C+ N CKNGG+C       +C C   FTG  C +   +CS N C N G C   +    C+C   F G+ CE +   C  + C  GGVC+  +G   C C+   + G  C      C    C NGG C+  +G Y C C+ GF G  C Q+  EC  N CKN G+C   + G++C C   G+ G + ++ +T +
Sbjct: 1067 ECNKNPCQNGGVC-KNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGGYSCACK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKA-GFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKICEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKTANKMLTNV 1410          

HSP 3 Score: 150.599 bits (379), Expect = 4.404e-36
Identity = 126/351 (35.90%), Postives = 172/351 (49.00%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLK 4462
            +C    C+N G+C +       C C  GFTG+ CE+    C  + C+NGG C        C C   GF G NCEQ    CS + C+N G+C  E+G   C C+     GK CE+ +  CS + C N G C   +    C C A GF G+ CE+++  C+ N CKNGG+C       +C C   FTG  C +   +CS N C N G C   +    C+C   F G+ CE +   C  + C  GGVC+  +G   C C+   + G  C      C    C NGG C+  +G Y C C+ GF G  C Q+  EC  N CKN G+C   + G++C C   G+ G +C +   GLK
Sbjct:  219 ECSKNPCKNGGVC-KNEHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACK-VGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKA-GFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGGYSCACK-AGFMGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQ--DGLK 561          

HSP 4 Score: 137.887 bits (346), Expect = 3.891e-32
Identity = 133/444 (29.95%), Postives = 186/444 (41.89%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC----------------------------------------QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKN--EYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKM 4618
            +C +  C+N G+C +       C C  GFTG+ CE+    C  + C+NGG C        C C   GF G NCEQ    CS + C+N G+C  E+G   C C+     GK CE+ +  CS++ C N G C   +    C C A GF G+ CE+++  C+ N CKNGG+C       +C C   FTG  C +   +CS N C N G C   +    C+C   F G+ CE +   C  + C  GGVC+  +G   C C+   + G  C      C    C NGG C+  +G Y C C+ GF G  C                                        Q+  EC  N CKN G+C   + G++C C   G+ G +C +  +  +    Y+K          P G     V    Q  + T   Y F    G      +
Sbjct:  257 ECSVNPCKNGGVC-KNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACK-VGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKA-GFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGGYSCACKAGFMGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDGLKTIIHLQSIKCGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQAPSKPRECRSYKKLDTADRAAGRPRGN----VLKCDQKEILTKAWYRFEGAAGSAMPTSL 690          

HSP 5 Score: 130.954 bits (328), Expect = 5.135e-30
Identity = 117/363 (32.23%), Postives = 161/363 (44.35%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-------------------------------ERKECPPNFCKNDGICSVINNGFTCDC 4408
            +C    CQN G+C +       C C  GFTG+ CE+    C ++ C+NGG C        C C   GF G NCEQ    CS + CQN G+C  ++G   C C+     GK CE+ +  CS++ C N G C   +    C C A GF G+ CE+++  C+ N CKNGG+C       +C C   FTG  C +   +CS N C N G C   +    C+C   F G+ CE +   C  + C  GGVC+  +G   C C+   + G  C      C    C NGG C+  +G Y C C+ GF G                                   ++ EC  N C N+G C      + C+C
Sbjct: 1105 ECSKNPCQNGGVC-KNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKA-GFTGKICEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNARPDKNECKVNPCLNNGKCINTPGSYKCNC 1462          

HSP 6 Score: 122.094 bits (305), Expect = 2.148e-27
Identity = 97/274 (35.40%), Postives = 134/274 (48.91%), Query Frame = 2
Query: 3656 NCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            N E   CS   C+N G C   NG   C C+ +   GK CE+ +  CS++ C N G C   +    C C A GF G+ CE+++  C  N C+NGG+C       +C C   FTG  C +   +CS N C N G C   +    C+C   F G+ CE +   C  + C  GGVC+  +G   C C+   + G  C      C    C NGG C+ ++G Y C C+ GF G  C Q+  EC  N CKN G+C   + G++C C   G+ G  C + V
Sbjct:  986 NAEFETCSSKPCKNGGTCREVNGAYSCTCK-SGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKA-GFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKICEQDV 1255          

HSP 7 Score: 122.094 bits (305), Expect = 2.376e-27
Identity = 115/359 (32.03%), Postives = 163/359 (45.40%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRC---PSDFCYYGGVCQIRN--GY--------PYCD---CQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C    CQN G+C +       C C  GFTG+ CE+    C ++ C+NGG C        C C   GF G NCEQ    C+ + CQN G+C  E+G   C C+     GK CE+ +  C+++ C N G C   +    C C A GF G+ CE+++  C+ N CKNGG+C       +C C   FTG  C +  C    C      ++    P  +       +     K C       C++    ++RN  G+        P C    C N  +E         C  + C NGG C+  NG Y C C+ GF G  C Q+  EC  N CKN G+C   + G++C C   G+ G +C + V
Sbjct:  729 ECSKNPCQNGGVC-KNEHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCKNEHGGYSCTCK-AGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCK-AGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCKA-GFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKICEQEICE--ICGTHAPGWMEGSHPTVA-------EGIVTRKVCYHWSGKTCHWNNAIRVRNCGGFYVYELNRPPVCHLRYCGNAEFE--------TCSSKPCKNGGTCREVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACK-AGFTGKNCEQDV 1065          

HSP 8 Score: 70.8626 bits (172), Expect = 7.448e-12
Identity = 68/227 (29.96%), Postives = 106/227 (46.70%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEK 4111
            +C    C+N G+C +       C C  GFTG+ CE+    C ++ C+NGG C        C C   GF G NCEQ    CS + C+N G+C  E+G   C C+     GK CE+ +  CS++ C N G C   +    C C A GF G+   + +  +N   +  + +   +    + T      + ++ +C  N C N+G C  +    +C+C   + G+ CE  K
Sbjct: 1257 ECSKNPCKNGGVC-KNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCK-AGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKA-GFTGKTANKML--TNVPASTRVIMAESALTAMEDT--VVNARPDKNECKVNPCLNNGKCINTPGSYKCNCIDEYTGKHCETAK 1475          
BLAST of Cell polarity protein vs. Ensembl Nematostella
Match: EDO46969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ6])

HSP 1 Score: 120.939 bits (302), Expect = 7.783e-29
Identity = 116/350 (33.14%), Postives = 170/350 (48.57%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLG--CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPV---CDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI---CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKC-SSNFCFNDGTCYISNERPQCSCTKNFEGQRCE--IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECP-PNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C    C+N G+C        G  C C  GF+G +C+     C ++ C+NGG C        C+C   G+ G NCE++ CS + C+N G C+ + G      C CR +   G  C+  I  C ++ C N G C   +   +C+C   G+ G+ CE ++    +SN CKNGG+C       +C+C   +TG +C +   +C SSN C N G C  S     C C   + G+ CE  + +   S+ C  GGVC    G   C C  + Y G  C  ++ +      C NGG C    G+Y CEC  G+ G  C+ +  EC   N CKN G+C+    G++C C  +GY G +C
Sbjct:    2 CSPNPCENGGICADDRGQASGYRCVCRSGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCK-LGWTGKNCEKAPCSPNPCENGGKCADDLGQDSGYRCVCR-SGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCK-LGWTGRNCEEDVNECASSNPCKNGGVCTNTPGGFSCKCASGYTGKECKKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCTNSPGGYSCKCA-SGYTGKNCEKDVNECASSNPCKNGGVCANSPGRYSCECASGYTGKNCEIDVNECASSNPCKNGGVCTNSPGGYSCKCA-SGYTGKNC 346          

HSP 2 Score: 111.694 bits (278), Expect = 9.895e-26
Identity = 117/351 (33.33%), Postives = 169/351 (48.15%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY---MYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI---CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKC-SSNFCFNDGTCYISNERPQCSCTKNFEGQRCE--IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C+   CQN G C       L CNC  G+TG+ CEK    C  + C NGG+C      D   +C C  +GF G  C+     C  + CQN G C  ++G  +C+C+     G+ CE+ +    S + C N G C        C C A+G+ G++C++++    +SN CKNGG+C       +C+C   +TG  C +   +C SSN C N G C  S     C C   + G+ CE  + +   S+ C  GGVC    G   C+C  + Y G  C I    C     C NGG C    G Y C+C  G+ G  C+ +  +C  + C+N G C   + G++C+C   GY G  C
Sbjct:   42 ECKKNPCQNGGDCVNKHGSHL-CNCKLGWTGKNCEKA--PCSPNPCENGGKCADDLGQDSGYRCVCR-SGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCK-LGWTGRNCEEDVNECASSNPCKNGGVCTNTPGGFSCKC-ASGYTGKECKKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCANSPGRYSCECA-SGYTGKNCEIDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDEDKCKVSPCQNGGKCINSDGGYSCEC-KGGYSGKHC 384          

HSP 3 Score: 110.538 bits (275), Expect = 2.645e-25
Identity = 107/315 (33.97%), Postives = 151/315 (47.94%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLG------CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF---CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI---CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKC-SSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPS-DFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ 4327
            C    C+N G C     D LG      C C  GF+G +C+     C ++ C+NGG C        C+C   G+ G NCE+      S + C+N G+C+   G   C C  + + GK C+K +    S + C N G C        C C A+G+ G+ CE+++    +SN CKNGG+C       +C+C   +TG  C +   +C SSN C N G C  S  R  C C   + G+ CEI+   C S + C  GGVC    G   C C  + Y G  C   + +C +  C NGG C   +G Y CEC+ G+ G  C+
Sbjct:   79 CSPNPCENGGKC----ADDLGQDSGYRCVCRSGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCK-LGWTGRNCEEDVNECASSNPCKNGGVCTNTPGGFSCKCA-SGYTGKECKKDVNECASSNPCKNGGVCTNSPGGYSCKC-ASGYTGKNCEKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCANSPGRYSCECASGYTGKNCEIDVNECASSNPCKNGGVCTNSPGGYSCKCA-SGYTGKNCEKDEDKCKVSPCQNGGKCINSDGGYSCECKGGYSGKHCE 385          

HSP 4 Score: 81.6481 bits (200), Expect = 7.756e-16
Identity = 68/207 (32.85%), Postives = 101/207 (48.79%), Query Frame = 2
Query: 3860 TGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYIS---NERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP-PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +GF G +C+ +I  C  N C+NGG CV +     C C   +TG  C +  CS N C N G C      +   +C C   F G RC+ +   C  + C  GG C  ++G   C+C+   + G  C  ++ +      C NGG C    G + C+C  G+ G  C++   EC   N CKN G+C+    G++C C  +GY G +C + V
Sbjct:   29 SGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCKLGWTGKNCEKAPCSPNPCENGGKCADDLGQDSGYRCVCRSGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCK-LGWTGRNCEEDVNECASSNPCKNGGVCTNTPGGFSCKCASGYTGKECKKDVNECASSNPCKNGGVCTNSPGGYSCKCA-SGYTGKNCEKDV 233          
BLAST of Cell polarity protein vs. Ensembl Nematostella
Match: EDO33048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC0])

HSP 1 Score: 118.627 bits (296), Expect = 4.881e-28
Identity = 113/337 (33.53%), Postives = 138/337 (40.95%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCE-KIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE-QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTA--TGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER---KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C N G CY     +  C C   + G KCE K       D C NGG C        C C   G+RGN CE + +C  + C N G CS  N   VC C       +      CS + C N G C        C C A  +G I Q  +   C SN C N G CV   +  TC C   +TG +C      K S + C N G+C        C+C   + G RCE    C    C  GG C   N    C C    + G++CN+   C    C NGG C  +   Y C C   F G  CQ+  EC  N C N G C    N +TC C   G+ G  C   V
Sbjct:   21 CMNGGTCYSGPW-RHACKCPGYYIGSKCESKFTREPSGDPCLNGGSCTNGASNYICTCR-PGYRGNRCEARDYCQGNPCLNGGTCSQGNQTFVCACAVGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQ--DSNECFSNPCMNAGTCVDGVNSYTCTCAEGWTGSRCESFDYCKASGDPCLNGGSCTNGASNYICTCRPGYRGNRCEARDYCQGSPCLNGGTCSQGNQTFVCACA-VGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQDSNECFSNPCMNAGTCVDGVNSYTCTCAE-GWTGSRCESSV 351          

HSP 2 Score: 112.849 bits (281), Expect = 4.125e-26
Identity = 108/332 (32.53%), Postives = 147/332 (44.28%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQS-FCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKP-ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER-EIC--TSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK-CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C N G C   A + + C C  G+ G +CE  ++ C  + C NGG C   ++   C C+  G+RG+ C  +  CS + C N G C  +     C C   Q  G +C+    C  + C N G C        C C A G+ G +CE  + C  + + C NGG C    S   C C P + G +C  R  C  + C N GTC   N+   C+C   + G +C +   C    C  GG C  +     C C    + G  C     C    C N G C      Y C C EG+ GSRC E   C  N C+N G C   N G+ C+CT + Y G +C
Sbjct:   60 CLNGGSCTNGASNYI-CTCRPGYRGNRCEARDY-CQGNPCLNGGTCSQGNQTFVCACA-VGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCP-AQFSGVICQDSNECFSNPCMNAGTCVDGVNSYTCTC-AEGWTGSRCESFDYCKASGDPCLNGGSCTNGASNYICTCRPGYRGNRCEARDYCQGSPCLNGGTCSQGNQTFVCACAVGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCP-AQFSGVICQDSNECFSNPCMNAGTCVDGVNSYTCTCAEGWTGSRC-ESSVCLSNPCQNGGTCRQGNGGYYCNCT-SNYGGYNC 383          

HSP 3 Score: 92.0485 bits (227), Expect = 2.954e-19
Identity = 81/229 (35.37%), Postives = 103/229 (44.98%), Query Frame = 2
Query: 3428 CRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFT-CPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE-QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTA--TGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE 4102
            C++  +C    C N G C    ++   C C+EG+TG +CE  ++     D C NGG C        C C   G+RGN CE + +C  S C N G CS  N   VC C       +      CS + C N G C        C C A  +G I Q  +   C SN C N G CV   +  TC C   +TG +C    C SN C N GTC   N    C+CT N+ G  CE
Sbjct:  160 CQDSNECFSNPCMNAGTCVD-GVNSYTCTCAEGWTGSRCESFDYCKASGDPCLNGGSCTNGASNYICTCR-PGYRGNRCEARDYCQGSPCLNGGTCSQGNQTFVCACAVGWRGSQCNVADHCSPTPCLNGGTCVNQGSSYNCTCPAQFSGVICQ--DSNECFSNPCMNAGTCVDGVNSYTCTCAEGWTGSRCESSVCLSNPCQNGGTCRQGNGGYYCNCTSNYGGYNCE 384          
BLAST of Cell polarity protein vs. Ensembl Nematostella
Match: EDO33199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSU4])

HSP 1 Score: 118.242 bits (295), Expect = 7.979e-28
Identity = 115/342 (33.63%), Postives = 156/342 (45.61%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQ--SFCSDSFCQNNGICSIENGLPVCDCRNTQH--KGKVCE-KPICSESFCNNRGRC--YVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE-RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C +  C N G C   A     C C EGF+G  CE +E  C  + CRNGG C+ +     C C   GF G NCE   S C  S C N G C +  G  +  C   QH  KG  CE +  C  + C NRG C   +  +   CDC   G+ G+ C+ +I  C S+ C NG  C    +   C C   F G  C +  KC +  C N GTC  +    +C C + + G  CE E +C  + C  GG+C   +G   C C +  Y G  C     C    C +GG C      Y C C+ G+ G+ C++   C PN C + G+C      + C C +  Y G +C
Sbjct:   74 RCYISPCLNGGTCMSTA-SSFQCLCLEGFSGSSCE-VESKCRNNPCRNGGSCFDHHNSYTCGCL-PGFSGVNCEAIISVCDSSPCLNGGTC-LNQGPNMFRCV-CQHGFKGHNCEMEKKCEPNPCQNRGICREVIDEDDYRCDCIH-GYRGRDCDEQINLCDSSPCGNGATCTMFGATFHCLCPEGFRGLTCLDIDKCHAMPCMNGGTCIATLNNYRCQCPEGYRGSNCEEELKCHPNPCLNGGMCFENSGGFTCKCAD-GYRGINCAEHDHCHPNPCRHGGVCAGDGDDYVCSCRNGWAGTNCEDEDRCSPNPCLHGGVCVAKGYRYECHCPNH-YSGENC 407          

HSP 2 Score: 116.701 bits (291), Expect = 3.141e-27
Identity = 116/343 (33.82%), Postives = 156/343 (45.48%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE-QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE-KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCER--EICTSNFCKNGGLCVPRDSQP-TCQCTPEFTGFQCN-ERKCSSNFCFNDGTC--YISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEK 4447
            C    CQN G C ++  +   C C  GF G+ CE+    C  + CRNGG C   D   +C C    ++G  C+ ++ C  S C N G C        C C      G  CE +  C  + C N G C+ H+    C C   GF G  CE    +C S+ C NGG C+ +      C C   F G  C  E+KC  N C N G C   I  +  +C C   + G+ C+ +   C S  C  G  C +     +C C    + G  C    +C    C NGG C      Y C+C EG++GS C+E  +C PN C N G+C   + GFTC C   GY GI+C+E 
Sbjct:    1 CSNSPCQNGGTCNEVK-EGYECICPHGFKGQDCEERN-KCQPNPCRNGGSCTEVDDGFECACQAE-YKGTTCDVENRCYISPCLNGGTCMSTASSFQCLCLEG-FSGSSCEVESKCRNNPCRNGGSCFDHHNSYTCGCLP-GFSGVNCEAIISVCDSSPCLNGGTCLNQGPNMFRCVCQHGFKGHNCEMEKKCEPNPCQNRGICREVIDEDDYRCDCIHGYRGRDCDEQINLCDSSPCGNGATCTMFGATFHCLCP-EGFRGLTCLDIDKCHAMPCMNGGTCIATLNNYRCQCPEGYRGSNCEEELKCHPNPCLNGGMCFENSGGFTCKCA-DGYRGINCAEH 336          

HSP 3 Score: 100.908 bits (250), Expect = 4.767e-22
Identity = 100/305 (32.79%), Postives = 138/305 (45.25%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQP---KCDCSGTGFRGNNCE-QSFCSDSFCQNNGICS--IENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKC-EREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER-KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ 4327
            KC    C+N G C+    +   C C  GF+G  CE I   C    C NGG C   ++ P   +C C   GF+G+NCE +  C  + CQN GIC   I+     CDC +  ++G+ C++ I  C  S C N   C +      C C   GF G  C + + C +  C NGG C+   +   CQC   + G  C E  KC  N C N G C+ ++    C C   + G  C     C  + C +GGVC        C C+N  + GT C    RC    C +GG C  +  +Y C C   + G  C+
Sbjct:  111 KCRNNPCRNGGSCFDHH-NSYTCGCLPGFSGVNCEAIISVCDSSPCLNGGTCL--NQGPNMFRCVCQ-HGFKGHNCEMEKKCEPNPCQNRGICREVIDEDDYRCDCIHG-YRGRDCDEQINLCDSSPCGNGATCTMFGATFHCLC-PEGFRGLTCLDIDKCHAMPCMNGGTCIATLNNYRCQCPEGYRGSNCEEELKCHPNPCLNGGMCFENSGGFTCKCADGYRGINCAEHDHCHPNPCRHGGVCAGDGDDYVCSCRN-GWAGTNCEDEDRCSPNPCLHGGVCVAKGYRYECHCPNHYSGENCE 408          

HSP 4 Score: 82.4185 bits (202), Expect = 5.189e-16
Identity = 56/151 (37.09%), Postives = 81/151 (53.64%), Query Frame = 2
Query: 4004 CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVC-QIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVT 4453
            CS++ C N GTC    E  +C C   F+GQ CE   +C  + C  GG C ++ +G+  C CQ   Y+GT C++  RC +  C NGG C      + C C EGF GS C+   +C  N C+N G C   +N +TC C   G+ G++C   ++
Sbjct:    1 CSNSPCQNGGTCNEVKEGYECICPHGFKGQDCEERNKCQPNPCRNGGSCTEVDDGFE-CACQ-AEYKGTTCDVENRCYISPCLNGGTCMSTASSFQCLCLEGFSGSSCEVESKCRNNPCRNGGSCFDHHNSYTCGCL-PGFSGVNCEAIIS 148          

HSP 5 Score: 81.2629 bits (199), Expect = 1.193e-15
Identity = 74/227 (32.60%), Postives = 104/227 (45.81%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQ-LAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC-EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI-CSESFCNNRGRCYVHNEQPICDCTATGFIGQKC-EREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC-NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE 4108
            KCE   CQNRG+C + +  D   C+C  G+ G  C++    C    C NG  C M+     C C   GFRG  C +   C    C N G C        C C    ++G  CE+ + C  + C N G C+ ++    C C A G+ G  C E + C  N C++GG+C        C C   + G  C +E +CS N C + G C     R +C C  ++ G+ CE E
Sbjct:  187 KCEPNPCQNRGICREVIDEDDYRCDCIHGYRGRDCDEQINLCDSSPCGNGATCTMFGATFHCLCP-EGFRGLTCLDIDKCHAMPCMNGGTCIATLNNYRCQCPEG-YRGSNCEEELKCHPNPCLNGGMCFENSGGFTCKC-ADGYRGINCAEHDHCHPNPCRHGGVCAGDGDDYVCSCRNGWAGTNCEDEDRCSPNPCLHGGVCVAKGYRYECHCPNHYSGENCECE 410          
BLAST of Cell polarity protein vs. Ensembl Nematostella
Match: EDO29720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2U3])

HSP 1 Score: 120.168 bits (300), Expect = 1.820e-27
Identity = 121/348 (34.77%), Postives = 151/348 (43.39%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            +C    CQN G C    ++   C C  G+TG KCE +   C    C NGG C        C C   GF G NCE +   C+ S C+N G C+       C C++    GK C   I  C+   C N   C        C C   GF G+ C  EI  C S  CKNG  C  R +  TC C P FTG  C     +C+S  C N  TC       +C+C   F G+ C  E   C S+ C  G  C  R NG+  C C+   + G+ C      C    C NG  C  R   + C C+ GF G  C  E  EC  N CKN   C+   NGFTC C   G+ G  C  ++
Sbjct:    4 ECSSNPCQNGGTCTDQ-LNSYSCTCPSGYTGTKCEIVPDQCASAPCINGGTCKSDRYGYHCHCK-VGFTGKNCETNIDECNSSPCKNGGSCTDRINRFTCTCKH-GFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKP-GFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGF-TCTCK-PGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKLGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTC-KPGFTGSDCGTEI 344          

HSP 2 Score: 108.612 bits (270), Expect = 9.547e-24
Identity = 119/359 (33.15%), Postives = 150/359 (41.78%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC--EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            +C    C+N G C    I++  C C  GFTG+ C      C    C+NG  C        C C   GF G +C  E   C+   C+N   C+       C C+     GK C   I  C+   C N   C        C C   GF G+ C  EI  C SN CKNG  C  R +  TC C P FTG  C     +C+S+ C N  TC        C+C   F G+ C  E   C S+ C  G  C  R NG+  C C+   + G+ C      C    C NG  C  R   + C C+ GF GS C  E  EC    CKN   C+   NGF C C   G+ G  C  ++    +E  K G
Sbjct:   80 ECNSSPCKNGGSCTDR-INRFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCK-PGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCK-PGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKP-GFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKLGFTGKDCGTEIDECASNPCKNGATCTDRINGF-TCTCK-PGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKPGFTGSDCGTEIDECASKPCKNGATCTDRINGFACTC-KPGFTGKDCGTEIDECASEPCKNG 431          

HSP 3 Score: 107.071 bits (266), Expect = 2.295e-23
Identity = 128/405 (31.60%), Postives = 169/405 (41.73%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC--EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMD 4621
            +C    C+N   C    I+   C C  GFTG+ C      C    C+NG  C       +C C   GF G +C  E   C+ + C+N   C+       C C+     G  C   I  C+ S C N   C        C C   GF G+ C  EI  C SN CKNG  C  R +  TC C P FTG  C     +C+S+ C N  TC        C+C   F G  C  E   C S  C  G  C  R NG+  C C+   + G  C      C  E C NG NC  +   + C C+EG+ G  C  +  EC  N C N+G C+   NG+ C C   GY G +C  +V   +++  + G          GT  D +   ++ F K G  YT     GR+    +D
Sbjct:  156 ECASKPCKNGATCTDR-INGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCK-PGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCK-PGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTC-KLGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKPGFTGSDCGTEIDECASKPCKNGATCTDRINGF-ACTCK-PGFTGKDCGTEIDECASEPCKNGANCTDKINGFMCTCKEGYTGKDCGTDIDECSSNPCLNEGTCTDQVNGYLCVC-KKGYTGPNCEVEVNECQSDPCQNG----------GTCEDLI-ASYRCFCKAG--YT-----GRHCETDID 535          

HSP 4 Score: 106.301 bits (264), Expect = 3.986e-23
Identity = 121/365 (33.15%), Postives = 150/365 (41.10%), Query Frame = 2
Query: 3437 PLKCEMGYCQNRGLCYQLAIDKLG--CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC--EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYV 4489
            P +C    C N G C     D+ G  C+C  GFTG+ CE     C    C+NGG C     +  C C   GF G +C  E   C+   C+N   C+       C C+     GK C   I  C+   C N   C        C C   GF G+ C  EI  C S  CKNG  C  R +   C C P FTG  C     +C+SN C N  TC        C+C   F G  C  E   C S  C  G  C  R NG+  C C+   + G  C      C    C NG  C  R   + C C+ GF GS C  E  EC  + CKN   C+   NGF C C   G+ G  C  ++    ++  K G  
Sbjct:   40 PDQCASAPCINGGTCKS---DRYGYHCHCKVGFTGKNCETNIDECNSSPCKNGGSCTDRINRFTCTCK-HGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCK-PGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKP-GFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGF-ACTCK-LGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTC-KPGFTGSDCGTEIDECASKPCKNGAT 395          

HSP 5 Score: 94.3597 bits (233), Expect = 2.350e-19
Identity = 108/344 (31.40%), Postives = 143/344 (41.57%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC--EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C    C+N   C    I+   C C  GFTG  C      C    C+NG  C        C C   GF G +C  E   C+ + C+N   C+       C C+     G  C   I  C+ S C N   C        C C   GF G  C  EI  C S  CKNG  C  R +   C C P FTG  C     +C+S  C N   C        C+C + + G+ C  +   C S+ C   G C  + NGY  C C+   Y G  C +    C  + C NGG C+     Y C C+ G+ G  C+ +  EC  + C N G C+ + +   C C+ TGY G +C
Sbjct:  232 ECASNPCKNGATCTDR-INGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCK-LGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCK-PGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKP-GFTGSDCGTEIDECASKPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASEPCKNGANCTDKINGFMCTCKEGYTGKDCGTDIDECSSNPCLNEGTCTDQVNGY-LCVCKK-GYTGPNCEVEVNECQSDPCQNGGTCEDLIASYRCFCKAGYTGRHCETDIDECASSPCANGGTCTDLVDAHKCQCS-TGYTGKNC 568          

HSP 6 Score: 91.2781 bits (225), Expect = 2.124e-18
Identity = 102/322 (31.68%), Postives = 130/322 (40.37%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC--EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGIC 4375
            +C    C+N   C    I+   C C  GFTG+ C      C  + C+NG  C        C C   GF G++C  E   C+ S C+N   C+       C C+     G  C   I  C+   C N   C        C C   GF G+ C  EI  C S  CKNG  C  + +   C C   +TG  C     +CSSN C N+GTC        C C K + G  CE+E   C SD C  GG C+       C C+   Y G  C      C    C+NGG C      + C+C  G+ G  C+    EC    C N   C
Sbjct:  270 ECASSPCKNGATCTDR-INGFACTCKLGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCK-PGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCK-PGFTGSDCGTEIDECASKPCKNGATCTDRINGFACTCKP-GFTGKDCGTEIDECASEPCKNGANCTDKINGFMCTCKEGYTGKDCGTDIDECSSNPCLNEGTCTDQVNGYLCVCKKGYTGPNCEVEVNECQSDPCQNGGTCEDLIASYRCFCK-AGYTGRHCETDIDECASSPCANGGTCTDLVDAHKCQCSTGYTGKNCEVNIDECATKPCLNGATC 586          

HSP 7 Score: 77.0258 bits (188), Expect = 6.708e-14
Identity = 68/207 (32.85%), Postives = 91/207 (43.96%), Query Frame = 2
Query: 3884 EREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCN--ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYV 4489
            E + C+SN C+NGG C  + +  +C C   +TG +C     +C+S  C N GTC        C C   F G+ CE     C S  C  GG C  R     C C++  + G  C      C  + C NG  C  R   + C C+ GF G  C  E  EC    CKN   C+   NGFTC C   G+ G  C  ++    ++  K G  
Sbjct:    1 EIDECSSNPCQNGGTCTDQLNSYSCTCPSGYTGTKCEIVPDQCASAPCINGGTCKSDRYGYHCHCKVGFTGKNCETNIDECNSSPCKNGGSCTDRINRFTCTCKH-GFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTC-KPGFTGKDCGTEIDECASKPCKNGAT 205          
BLAST of Cell polarity protein vs. Ensembl Medaka
Match: ENSORLT00000041634.1 (crumbs cell polarity complex component 2 [Source:NCBI gene;Acc:101175660])

HSP 1 Score: 149.828 bits (377), Expect = 1.905e-35
Identity = 192/800 (24.00%), Postives = 313/800 (39.12%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPE-FTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVC----QIRN----------GYPY-------CDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDC-----THTGYFGISCSEKVTG---------------LKNE---------------------------YEKYGYVIYPVS---PPVGTTSDQVTVGFQTFMKT---GTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSN---VNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEIS------YKEIIIGASNEERDI-------FKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHG-IFPMENSYGGYLVMNIIPPKQTHKDE--TQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAI 5530
            C    CQN G C  +      C C  G+ GE CE+    C  + C+NG  C       +C C   GF+G++CE     C+   CQNNG C  E     C+C     +G  CE  I  C    C N G C  H     C+CTA GF GQ CE  I  C S  C N G C+   +   C C    F G  C  N ++C+S+ C + GTC     + +C C   +EG+ C+++   C    C  GG C     +RN           + Y       C C    + G  C++    C    C +GG CQ     Y+C C +GF G  C+E   EC  N CKN   C    N + C C     +   + G  C  ++ G               LK++                            E Y Y+  P S      G    +  +  Q   +T     +  +R +  R+++L++  G L   +   +    S+   VNDG++Y V++  + ER +  + GP  E        V +  QN +       ++E  +G   +E          F G +     + K +  Q    +  +   +         + P        C   G+C+ M     C+C    F+G+RCE       F  EN+   Y V NI    ++H       FL+++   +  +++F+  D+ +  I + +G +       +  L+ + + + + N +LV       ++ F   G   +  N+ ++ + D + +       + K++  +F+G +
Sbjct:  151 CSTQACQNGGTCVDVPDAGHQCQCVPGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCV-PGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCECA-PGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTA-GFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTCLDGINQYKCVCWPGYEGENCQMDIDECEKGPCDNGGTCFQRSDVRNYKNLPELSVTTFSYGTAAGFICLCM-AGFTGHNCSVNVDECESAPCQHGGRCQDLVNSYHCLCPDGFTGVHCEEDINECASNPCKNGATCEDSVNSYKCHCPKAEGSQEPWGGQDCDVRLVGCLQHQCQHEKSCVPVLKDDGAHSYMCMCLPGWSGELCNTSTTFSFSSEGYIYLRLPGSKNRTKRGADDKRQRLHMQLRFRTTLPDMLLLYRGSMERFFTLELVQGSLQARVKSARVLQVSHPGPVNDGRWYDVTVAMD-ERLVMTVTGPNCEKGC----QVKTLGQNHLIFLHPGFFQEFYVGGVPQEYLTNSLSGKGFIGCMEDLEVDHKLLLPQDLIREDNKDMKLGCYKKEWCQDDP--------CMQRGQCVDMWVRASCRCHRP-FYGERCEGEYPSWTFGHENT-SSYSVFNI---SESHGQNFTLSFLMRSLKHSGLLLQFQREDKPYLSIYLKEGTVALYSPTVYTTLLLEARSITDGNNHLVTIKVHNGHVDFPKAGHHRALGNV-SVEAGDVAFVGGLPAARSMKAWGGHFKGCL 927          

HSP 2 Score: 124.405 bits (311), Expect = 1.158e-27
Identity = 115/349 (32.95%), Postives = 150/349 (42.98%), Query Frame = 2
Query: 3506 GCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY-MYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNC----QVRN-----------------GQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
             C+C  G+ GE C+    TC    C+NGG C  + D   +C C   G++G NCE++   C    CQN  IC        C C     +G  CE  I  C+   C N G C    +   C+C A GF G  CE EI  C  + C+NGG+C+   +  +C+CT  F G  C  N  +C+S  C NDG C       +C C    FEG  CE   + C SD C +GG C        C C    YEG  C +    C    C NGG C     VRN                   + C C  GF G  C     EC    C++ G C  + N + C C   G+ G+ C E +
Sbjct:  132 ACHCPIGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCV-PGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCV-PGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCEC-APGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTCLDGINQYKCVCW-PGYEGENCQMDIDECEKGPCDNGGTCFQRSDVRNYKNLPELSVTTFSYGTAAGFICLCMAGFTGHNCSVNVDECESAPCQHGGRCQDLVNSYHCLCP-DGFTGVHCEEDI 475          

HSP 3 Score: 115.161 bits (287), Expect = 6.752e-25
Identity = 106/314 (33.76%), Postives = 137/314 (43.63%), Query Frame = 2
Query: 3485 QLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYD--KQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGIC-SIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCY--VHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGIC 4375
            Q   D+  C+C +G+TG  CE+    C  + C  G R Y  D      C C   G+ G NC+ S   CS   CQN G C  + +    C C    ++G+ CE+ +  C    C N   C   V+  Q  C     GF G  CE +I  C S  C+N G C+      TC+C P F G  C     +C  + C N G C        C CT  F+GQ CE+    C S  C   G C        CDC  T +EG  C  NI + C  + C +GG C     QY C C  G++G  CQ +  EC    C N G C
Sbjct:   86 QPGTDEFICHCPDGYTGPSCEQEVDECHSNPCM-GVRSYCVDGANSYACHCP-IGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCV-PGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFC---VPGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCECAPGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNI-QECASDPCQHGGTCLDGINQYKCVCWPGYEGENCQMDIDECEKGPCDNGGTC 392          

HSP 4 Score: 114.39 bits (285), Expect = 1.198e-24
Identity = 102/334 (30.54%), Postives = 145/334 (43.41%), Query Frame = 2
Query: 3533 GEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSG--TGFRGNNCEQSF--CSDSFCQNNGICSIENGLP--VCDCRNTQHKGKVCEKPI--CSESFCNN-RGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVP-RDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            G  C      C    C+NG  C  ++ +  C C      + G +CE+ +  CS + C N   C+ + G    +C C +  + G  CE+ +  C  + C   R  C        C C   G+ G+ C+  +  C++  C+NGG CV   D+   CQC P + G  C E   +C S  C N   C       QC C   F+G  CE++ K C S  C   G C     +  C+C    +EG  C +    C L  C NGG C      Y CEC  GFQG  C+    EC    C NDG C    N + CDC  TG+ G  C + +    ++  ++G
Sbjct:   24 GLLCTAAADRCLSSPCKNGATCLYHEGEYVCVCPNFPVKYTGKHCEELYDACSTTSCTN---CTSQPGTDEFICHCPDG-YTGPSCEQEVDECHSNPCMGVRSYCVDGANSYACHC-PIGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCVPGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCVPGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCECA-PGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHG 351          

HSP 5 Score: 77.0258 bits (188), Expect = 2.695e-13
Identity = 98/401 (24.44%), Postives = 154/401 (38.40%), Query Frame = 2
Query: 2849 RYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIML---NKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCG----GCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPIC--SESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERK 4003
            RY+  + + +  + + I +  +   G ++       + G     L L+++ L++   ++      ++   S   + D  WH + + +    + L R  + VD   Q   ++  V  +++                      L  S  +LAEK          GCLGE  +         ++ A        L       GC+    C+   C N+G+C Q   +   C+C  G+ GE CE     C    C   G+C        CDC   G++G NCE+    C +  C N G C    G   C C     KGK C+    P+   + + C N G C   +    C C   GF G +CE EI  C+SN C NG  C  + +   C C P F G  C   K
Sbjct: 1035 RYSAYSSLQSPVNNITIDLRTRDETGTLL-----RSDGGSEVFCLGLLNSSLLV--KLDSGAGAPLLAFTSDRTIADGAWHHIQLSMVEPAQSLSRWSLTVDG--QRAGVSFGVGGNLNF---------------------LNESNIWLAEK--------FTGCLGEVRVGGVYLPLVNITDAPQQSQFTRLGGHEPILGCQGSPVCDSQPCLNQGVC-QDHFNDFNCSCRPGWEGEVCEAQTDECSSSPCLY-GKCKDLLADYHCDCE-PGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCP-PGFKGKRCQWRFPPVACDANTKCFNEGVCVGGDSGGNCSCKP-GFSGARCEAEIDECSSNPCLNGATCQDQLNHFKCVCVPGFHGKFCENNK 1392          

HSP 6 Score: 70.4774 bits (171), Expect = 2.674e-11
Identity = 55/157 (35.03%), Postives = 72/157 (45.86%), Query Frame = 2
Query: 4004 CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCK------NDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C S  C N G C        CSC   +EG+ CE +   C S  C YG    +   Y +CDC+   Y+G  C       LEF C NGG C+   G + C C  GF+G RCQ R   PP  C       N+G+C   ++G  C C   G+ G  C  ++
Sbjct: 1203 CDSQPCLNQGVCQDHFNDFNCSCRPGWEGEVCEAQTDECSSSPCLYGKCKDLLADY-HCDCE-PGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCPPGFKGKRCQWRF--PPVACDANTKCFNEGVCVGGDSGGNCSCK-PGFSGARCEAEI 1354          

HSP 7 Score: 65.4698 bits (158), Expect = 1.050e-9
Identity = 60/197 (30.46%), Postives = 82/197 (41.62%), Query Frame = 2
Query: 3776 KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE---KRCPSDF-CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKE 4339
             P+C    C N+G C  H     C C   G+ G+ CE +   C+S+ C  G  C    +   C C P + G  C E    C    C N G C  +     CSC   F+G+RC+       C ++  C+  GVC   +    C C+   + G RC      C    C NG  CQ +   + C C  GF G  C+  KE
Sbjct: 1200 SPVCDSQPCLNQGVCQDHFNDFNCSCRP-GWEGEVCEAQTDECSSSPCLYGK-CKDLLADYHCDCEPGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCPPGFKGKRCQWRFPPVACDANTKCFNEGVCVGGDSGGNCSCK-PGFSGARCEAEIDECSSNPCLNGATCQDQLNHFKCVCVPGFHGKFCENNKE 1393          

HSP 8 Score: 61.6178 bits (148), Expect = 1.451e-8
Identity = 61/190 (32.11%), Postives = 79/190 (41.58%), Query Frame = 2
Query: 3893 ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI---PKRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C S  C N G+C    +   C C P + G  C  +  +CSS+ C   G C        C C   ++G+ CE E   C    C  GG C+   G   C C    ++G RC     P  C     C N G C   +    C C+ GF G+RC+ E  EC  N C N   C    N F C C   G+ G  C
Sbjct: 1202 VCDSQPCLNQGVCQDHFNDFNCSCRPGWEGEVCEAQTDECSSSPCLY-GKCKDLLADYHCDCEPGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCP-PGFKGKRCQWRFPPVACDANTKCFNEGVCVGGDSGGNCSCKPGFSGARCEAEIDECSSNPCLNGATCQDQLNHFKCVCV-PGFHGKFC 1388          
BLAST of Cell polarity protein vs. Ensembl Medaka
Match: ENSORLT00000020612.2 (crumbs cell polarity complex component 2 [Source:NCBI gene;Acc:101175660])

HSP 1 Score: 148.288 bits (373), Expect = 5.449e-35
Identity = 194/800 (24.25%), Postives = 309/800 (38.62%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPE-FTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVC----QIRN----------GYPY-------CDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDC-----THTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQV------------TVGFQTFMKTGTIYT-------------------------FRTT-----------DGRYWSLKMDNGKLVIDINGNKYQTQSN---VNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEIS------YKEIIIGASNEERDI-------FKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHG-IFPMENSYGGYLVMNIIPPKQTHKDE--TQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAI 5530
            C    CQN G C  +      C C  G+ GE CE+    C  + C+NG  C       +C C   GF+G++CE     C+   CQNNG C  E     C+C     +G  CE  I  C    C N G C  H     C+CTA GF GQ CE  I  C S  C N G C+   +   C C    F G  C  N ++C+S+ C + GTC     + +C C   +EG+ C+++   C    C  GG C     +RN           + Y       C C    + G  C++    C    C +GG CQ     Y+C C +GF G  C+E   EC  N CKN   C    N + C C     +   + G  C  ++ G      ++     PV    G  S               T    +F   G IY                          FRTT             R+++L++  G L   +   +    S+   VNDG++Y V++  + ER +  + GP  E        V +  QN +       ++E  +G   +E          F G +     + K +  Q    +  +   +         + P        C   G+C+ M     C+C    F+G+RCE       F  EN+   Y V NI    ++H       FL+++   +  +++F+  D+ +  I + +G +       +  L+ + + + + N +LV       ++ F   G   +  N+ ++ + D + +       + K++  +F+G +
Sbjct:  151 CSTQACQNGGTCVDVPDAGHQCQCVPGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCV-PGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCECA-PGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTA-GFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTCLDGINQYKCVCWPGYEGENCQMDIDECEKGPCDNGGTCFQRSDVRNYKNLPELSVTTFSYGTAAGFICLCM-AGFTGHNCSVNVDECESAPCQHGGRCQDLVNSYHCLCPDGFTGVHCEEDINECASNPCKNGATCEDSVNSYKCHCPKAEGSQEPWGGQDCDVRLVGCLQHQCQHEKSCVPVLKDDGAHSYMCMCLPGWSGELCNTSTTFSFSSEGYIYLRLPGSKNRTKRGADDKRQRLHMQLRFRTTLPDMLLLYRGSMERFFTLELVQGSLQARVKSARVLQVSHPGPVNDGRWYDVTVAMD-ERLVMTVTGPNCEKGCQ----VKTLGQNHLIFLHPGFFQEFYVGGVPQEYLTNSLSGKGFIGCMEDLEVDHKLLLPQDLIREDNKDMKLGCYKKEWCQDDP--------CMQRGQCVDMWVRASCRCHRP-FYGERCEGEYPSWTFGHENT-SSYSVFNI---SESHGQNFTLSFLMRSLKHSGLLLQFQREDKPYLSIYLKEGTVALYSPTVYTTLLLEARSITDGNNHLVTIKVHNGHVDFPKAGHHRALGNV-SVEAGDVAFVGGLPAARSMKAWGGHFKGCL 927          

HSP 2 Score: 122.865 bits (307), Expect = 3.120e-27
Identity = 115/354 (32.49%), Postives = 151/354 (42.66%), Query Frame = 2
Query: 3491 AIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCY-MYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCT-KNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNC----QVRN-----------------GQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
              +   C+C  G+ GE C+    TC    C+NGG C  + D   +C C   G++G NCE++   C    CQN  IC        C C     +G  CE  I  C+   C N G C    +   C+C A GF G  CE EI  C  + C+NGG+C+   +  +C+CT  F G  C  N  +C+S  C NDG C       +C C    FEG  CE   + C SD C +GG C        C C    YEG  C +    C    C NGG C     VRN                   + C C  GF G  C     EC    C++ G C  + N + C C   G+ G+ C E +
Sbjct:  127 GANSYACHCPIGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCV-PGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCV-PGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCEC-APGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHGGTCLDGINQYKCVCW-PGYEGENCQMDIDECEKGPCDNGGTCFQRSDVRNYKNLPELSVTTFSYGTAAGFICLCMAGFTGHNCSVNVDECESAPCQHGGRCQDLVNSYHCLCP-DGFTGVHCEEDI 475          

HSP 3 Score: 114.005 bits (284), Expect = 1.620e-24
Identity = 106/314 (33.76%), Postives = 137/314 (43.63%), Query Frame = 2
Query: 3485 QLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYD--KQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGIC-SIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCY--VHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGIC 4375
            Q   D+  C+C +G+TG  CE+    C  + C  G R Y  D      C C   G+ G NC+ S   CS   CQN G C  + +    C C    ++G+ CE+ +  C    C N   C   V+  Q  C     GF G  CE +I  C S  C+N G C+      TC+C P F G  C     +C  + C N G C        C CT  F+GQ CE+    C S  C   G C        CDC  T +EG  C  NI + C  + C +GG C     QY C C  G++G  CQ +  EC    C N G C
Sbjct:   86 QPGTDEFICHCPDGYTGPSCEQEVDECHSNPCM-GVRSYCVDGANSYACHCP-IGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCV-PGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFC---VPGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCECAPGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNI-QECASDPCQHGGTCLDGINQYKCVCWPGYEGENCQMDIDECEKGPCDNGGTC 392          

HSP 4 Score: 113.235 bits (282), Expect = 3.182e-24
Identity = 102/334 (30.54%), Postives = 145/334 (43.41%), Query Frame = 2
Query: 3533 GEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSG--TGFRGNNCEQSF--CSDSFCQNNGICSIENGLP--VCDCRNTQHKGKVCEKPI--CSESFCNN-RGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVP-RDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            G  C      C    C+NG  C  ++ +  C C      + G +CE+ +  CS + C N   C+ + G    +C C +  + G  CE+ +  C  + C   R  C        C C   G+ G+ C+  +  C++  C+NGG CV   D+   CQC P + G  C E   +C S  C N   C       QC C   F+G  CE++ K C S  C   G C     +  C+C    +EG  C +    C L  C NGG C      Y CEC  GFQG  C+    EC    C NDG C    N + CDC  TG+ G  C + +    ++  ++G
Sbjct:   24 GLLCTAAADRCLSSPCKNGATCLYHEGEYVCVCPNFPVKYTGKHCEELYDACSTTSCTN---CTSQPGTDEFICHCPDG-YTGPSCEQEVDECHSNPCMGVRSYCVDGANSYACHC-PIGWAGENCQDSVTTCSTQACQNGGTCVDVPDAGHQCQCVPGYQGENCEENVDECWSEPCQNGAICKDGVNGYQCFCVPGFQGSHCELDIKECASQPCQNNGTCLDEVDHYTCECA-PGFEGMNCEVEIDECELHPCQNGGICIDHIAMYSCECTAGFQGQDCEVNIDECASMPCLNDGRCIDGINSYECDCDGTGFEGDHCEDNIQECASDPCQHG 351          

HSP 5 Score: 79.337 bits (194), Expect = 5.161e-14
Identity = 100/413 (24.21%), Postives = 160/413 (38.74%), Query Frame = 2
Query: 2849 RYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIML---NKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCG----GCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE---KPIC--SESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTC 4039
            RY+  + + +  + + I +  +   G ++       + G     L L+++ L++   ++      ++   S   + D  WH + + +    + L R  + VD   Q   ++  V  +++                      L  S  +LAEK          GCLGE  +         ++ A        L       GC+    C+   C N+G+C Q   +   C+C  G+ GE CE     C    C  G +C        CDC   G++G NCE+    C +  C N G C    G   C C     KGK C+    P+   + + C N G C   +    C C   GF G +CE EI  C+SN C NG  C  + +   C C P F G  C   +   +  F+ G+C
Sbjct: 1035 RYSAYSSLQSPVNNITIDLRTRDETGTLL-----RSDGGSEVFCLGLLNSSLLV--KLDSGAGAPLLAFTSDRTIADGAWHHIQLSMVEPAQSLSRWSLTVDG--QRAGVSFGVGGNLNF---------------------LNESNIWLAEK--------FTGCLGEVRVGGVYLPLVNITDAPQQSQFTRLGGHEPILGCQGSPVCDSQPCLNQGVC-QDHFNDFNCSCRPGWEGEVCEAQTDECSSSPCLYG-KCKDLLADYHCDCE-PGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCP-PGFKGKRCQWRFPPVACDANTKCFNEGVCVGGDSGGNCSCKP-GFSGARCEAEIDECSSNPCLNGATCQDQLNHFKCVCVPGFHGKFCENNRRVQDTSFHPGSC 1404          

HSP 6 Score: 69.707 bits (169), Expect = 4.778e-11
Identity = 55/157 (35.03%), Postives = 72/157 (45.86%), Query Frame = 2
Query: 4004 CSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCK------NDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C S  C N G C        CSC   +EG+ CE +   C S  C YG    +   Y +CDC+   Y+G  C       LEF C NGG C+   G + C C  GF+G RCQ R   PP  C       N+G+C   ++G  C C   G+ G  C  ++
Sbjct: 1203 CDSQPCLNQGVCQDHFNDFNCSCRPGWEGEVCEAQTDECSSSPCLYGKCKDLLADY-HCDCE-PGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCPPGFKGKRCQWRF--PPVACDANTKCFNEGVCVGGDSGGNCSCK-PGFSGARCEAEI 1354          

HSP 7 Score: 62.003 bits (149), Expect = 1.207e-8
Identity = 58/196 (29.59%), Postives = 81/196 (41.33%), Query Frame = 2
Query: 3776 KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE---KRCPSDF-CYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERK 4336
             P+C    C N+G C  H     C C   G+ G+ CE +   C+S+ C  G  C    +   C C P + G  C E    C    C N G C  +     CSC   F+G+RC+       C ++  C+  GVC   +    C C+   + G RC      C    C NG  CQ +   + C C  GF G  C+  +
Sbjct: 1200 SPVCDSQPCLNQGVCQDHFNDFNCSCRP-GWEGEVCEAQTDECSSSPCLYGK-CKDLLADYHCDCEPGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCPPGFKGKRCQWRFPPVACDANTKCFNEGVCVGGDSGGNCSCK-PGFSGARCEAEIDECSSNPCLNGATCQDQLNHFKCVCVPGFHGKFCENNR 1392          

HSP 8 Score: 60.4622 bits (145), Expect = 2.873e-8
Identity = 61/190 (32.11%), Postives = 79/190 (41.58%), Query Frame = 2
Query: 3893 ICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI---PKRCPLEF-CSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C S  C N G+C    +   C C P + G  C  +  +CSS+ C   G C        C C   ++G+ CE E   C    C  GG C+   G   C C    ++G RC     P  C     C N G C   +    C C+ GF G+RC+ E  EC  N C N   C    N F C C   G+ G  C
Sbjct: 1202 VCDSQPCLNQGVCQDHFNDFNCSCRPGWEGEVCEAQTDECSSSPCLY-GKCKDLLADYHCDCEPGYKGKNCEEEVDNCLEFSCINGGRCEETVGTHSCSCP-PGFKGKRCQWRFPPVACDANTKCFNEGVCVGGDSGGNCSCKPGFSGARCEAEIDECSSNPCLNGATCQDQLNHFKCVCV-PGFHGKFC 1388          
BLAST of Cell polarity protein vs. Ensembl Medaka
Match: notch1a (neurogenic locus notch homolog protein 1 [Source:NCBI gene;Acc:101171596])

HSP 1 Score: 130.183 bits (326), Expect = 2.238e-29
Identity = 114/355 (32.11%), Postives = 155/355 (43.66%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDS--FCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCT-ATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRCQ-ERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
             C    C+N G C  +A+    C C  G+TG+ C+     C  + C NGG+C   D   +C C    F G  C+     C+ +   C N GIC  E G   C C   ++ G+ C+ P   CS S C N G C V       DC+   GF+GQ CE  I  C  + C+NGG+C    +   CQC P +TG  C E     +   N C N GTC+ ++    C C   + G  C      C +  C++G  C  R    +C+C +    G  C++   C    C  G NC     NG+  C C  G+ GS C  +  EC    N C++ G C      F C C   GY G  C   V
Sbjct:   74 ACMSAPCRNGGTCELIALTDFRCQCPPGWTGKSCQTPN-PCASNPCANGGQCSSLDSTYRCTCP-PNFHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQ-EYTGQHCQTPYVPCSPSPCQNGGTC-VQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCPPHYTGQYCTENVDECEMMPNVCQNGGTCHDTHGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDRVASFFCECPH-GRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDECALGANPCEHGGRCLNTLGSFQCKCLQ-GYEGPRCEMDV 422          

HSP 2 Score: 119.013 bits (297), Expect = 5.642e-26
Identity = 115/369 (31.17%), Postives = 159/369 (43.09%), Query Frame = 2
Query: 3428 CRNP-LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCN----ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            C+ P + C    CQN G C Q       C+C  GF G+ CE     CP   C+NGG C        C C    + G  C ++        + CQN G C   +G   C C N    G  C K I  C+ + C +   C+       C+C   G  G  C   + C SN C+ G  C   P + +  C C P +TG  CN    E    +N C + G C  +    QC C + +EG RCE++   C S+ C     C  + G  +C C    YEG  C+I    C  + C N G C  +   +YCEC +GF G+ CQ +  EC    C+N   C+   N + C+C   GY G  C   +    ++   YG
Sbjct:  184 CQTPYVPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCP-PHYTGQYCTENVDECEMMPNVCQNGGTCHDTHGSYHCVCVNGW-TGDDCSKNIDDCAAAACFHGATCHDRVASFFCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDECALGANPCEHGGRCLNTLGSFQCKCLQGYEGPRCEMDVNECMSNPCQNDATCLDQIGGFHCICM-PGYEGVFCHIDTDECASQPCLNNGKCIDKINSFYCECPKGFSGNLCQVDIDECASTPCRNGAKCTDGPNKYNCECAE-GYTGQHCEIDINECYSDPCHYG 547          

HSP 3 Score: 107.457 bits (267), Expect = 2.091e-22
Identity = 113/373 (30.29%), Postives = 148/373 (39.68%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER---------------------KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            +C    C N+G C    +    CNC   +TG+ CE     C +  C NG  C       +C C   GF G  CE     C  + C N G+C        C C     +G  CE+ I  C  + C N   C        C C  TGF G  CE     CT + C NGG CV   +  TC C   FTG  C  +  +C S  C N GTC       +C+C   + G  C+ + + C S  C  GG C  +     C CQ T + G  C+IP   C +          + C N G C      ++C CQ G+ GS CQE+                      EC    C+N G C  + N + C C   G  G+ C
Sbjct:  763 ECASNPCLNQGTCID-DVAGYKCNCLLPYTGQTCEIDINECVKSPCWNGAFCLNTMGGYQCKCQ-PGFTGQKCETDIDDCKPNPCSNGGLCHDGISSFTCTCL-PGFRGGRCEQDINECESNPCKNGANCTDCVNSYTCTC-PTGFSGINCEINTNDCTDSSCFNGGTCVDGINSFTCLCLTGFTGSYCQFDINECDSKPCLNGGTCLDGYGTYKCTCPHGYTGVNCQHLVRWCDSSPCKNGGTCWQQGASYTCQCQ-TGWTGLYCDIPSVSCEVAAKQQGVEVNQLCRNSGQCLDAGSTHHCRCQAGYTGSYCQEQVDERILSCVPGYHGVNCSKEINECQSQPCQNGGTCIDLINTYKCSCPR-GTQGVHC 1129          

HSP 4 Score: 104.76 bits (260), Expect = 1.350e-21
Identity = 113/377 (29.97%), Postives = 149/377 (39.52%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC-NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC------------QERKECPPNFCKNDGICSVINNGFTCDCTH-------------------TGYFGISCSEKV 4450
            +C+   C N G C  +      C C  GFTG  C+     C  + C N G C       KC+C    + G  CE     C  S C N   C    G   C C+     G+ CE  I  C  + C+N G C+       C C   GF G +CE++I  C SN CKNG  C    +  TC C   F+G  C  N   C+ + CFN GTC        C C   F G  C+ +   C S  C  GG C    G   C C +  Y G  C ++ + C    C NGG C  +   Y C+CQ G+ G  C            Q+  E     C+N G C    +   C C                      GY G++CS+++
Sbjct:  725 ECDSNPCMNGGTCKDMT-SGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCL-LPYTGQTCEIDINECVKSPCWNGAFCLNTMGGYQCKCQ-PGFTGQKCETDIDDCKPNPCSNGGLCHDGISSFTCTCLP-GFRGGRCEQDINECESNPCKNGANCTDCVNSYTCTCPTGFSGINCEINTNDCTDSSCFNGGTCVDGINSFTCLCLTGFTGSYCQFDINECDSKPCLNGGTCLDGYGTYKCTCPH-GYTGVNCQHLVRWCDSSPCKNGGTCWQQGASYTCQCQTGWTGLYCDIPSVSCEVAAKQQGVEVN-QLCRNSGQCLDAGSTHHCRCQAGYTGSYCQEQVDERILSCVPGYHGVNCSKEI 1095          

HSP 5 Score: 102.064 bits (253), Expect = 7.748e-21
Identity = 110/356 (30.90%), Postives = 144/356 (40.45%), Query Frame = 2
Query: 3428 CRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRD--FCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQ-HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI----CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIR--NGYPYCDCQNTNYEGTRCNIP-KRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C+ P  C    C N G C  L      C C   F G+ C+     C +    C NGG C        C C    + G +C+  +  CS S CQN G C ++ G    DC       G+ CE  I  C    C N G C        C C    + GQ C   +       N C+NGG C        C C   +TG  C  N   C++  CF+  TC+       C C     G  C ++  C S+ C  G  C     NG   C C    Y G+ CN+    C L    C +GG C    G + C+C +G++G RC+ +  EC  N C+ND  C     GF C C   GY G+ C
Sbjct:  107 CQTPNPCASNPCANGGQCSSLD-STYRCTCPPNFHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQE-YTGQHCQTPYVPCSPSPCQNGGTC-VQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCPPH-YTGQYCTENVDECEMMPNVCQNGGTCHDTHGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDRVASFFCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCP-PGYTGSACNLDIDECALGANPCEHGGRCLNTLGSFQCKCLQGYEGPRCEMDVNECMSNPCQNDATCLDQIGGFHCICM-PGYEGVFC 456          

HSP 6 Score: 101.679 bits (252), Expect = 1.014e-20
Identity = 116/378 (30.69%), Postives = 148/378 (39.15%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTA------------------------------------TGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C  G C++        +    C C  G+TG  CE     C    C+NGG C   +    C C   G  G NCE +   C    C         NG   C CR   + G +C   I  C+ + C+N G C        C C                                      +G+ GQ C+  +  C SN C NGG C    S   C C   FTG  C  N  +C+SN C N GTC       +C+C   + GQ CEI+   C    C+ G  C    G   C CQ   + G +C      C    CSNGG C      + C C  GF+G RC Q+  EC  N CKN   C+   N +TC C  TG+ GI+C
Sbjct:  544 CHYGTCKD-------GLASFTCYCRPGYTGRLCETNINECLSQPCKNGGTCQDRENSYICSCP-KGTAGFNCEINLDDCKSQPCDYGRCIDKINGY-ECACR-PGYTGTMCNINIDDCAINPCHNGGTCIDGINSFTCLCPEGYNDATCLSQVDECSSNPCIHGLCQDLINGYKCTCDSGWSGQNCDINKNECDSNPCMNGGTCKDMTSGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGQTCEIDINECVKSPCWNGAFCLNTMGGYQCKCQ-PGFTGQKCETDIDDCKPNPCSNGGLCHDGISSFTCTCLPGFRGGRCEQDINECESNPCKNGANCTDCVNSYTCTCP-TGFSGINC 909          

HSP 7 Score: 93.2041 bits (230), Expect = 4.013e-18
Identity = 104/345 (30.14%), Postives = 140/345 (40.58%), Query Frame = 2
Query: 3515 CSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK----CDCSGTGFRGNNC---EQSFCSDSFCQNNGICSIENGLPVCDCR---NTQHKGKVCEKP-ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREIC----TSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERP-QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEK 4477
            C   + G +C+     C    CRNGGRC    +       C+C   GF    C       C  + C+N G C +   + + D R        GK C+ P  C+ + C N G+C   +    C C    F GQ C+ ++     T   C NGG+CV       C+C  E+TG  C      CS + C N GTC    +    CSC   F GQ CE     CP   C  GGVC        C C   +Y G  C  N+   C +    C NGG C   +G Y+C C  G+ G  C +   +C    C +   C      F C+C H G  G+ C      + N  +K
Sbjct:   17 CPSDYIGNRCQ-YPSPCSPSPCRNGGRCRAVSRGNTFDFLCECP-LGFTDRLCLTPTNHACMSAPCRNGGTCEL---IALTDFRCQCPPGWTGKSCQTPNPCASNPCANGGQCSSLDSTYRCTCPPN-FHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQEYTGQHCQTPYVPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCP-PHYTGQYCTENV-DECEMMPNVCQNGGTCHDTHGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDRVASFFCECPH-GRTGLLCHLDDACISNPCQK 352          

HSP 8 Score: 87.8113 bits (216), Expect = 1.685e-16
Identity = 106/375 (28.27%), Postives = 150/375 (40.00%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLG---CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC------------EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----------NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGG---VCQIRNGYPYCDCQNTNYEGTRCN-IPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGL 4459
            +C+   C N G C    +D  G   C C  G+TG  C+ +   C    C+NGG C+       C C  TG+ G  C            +Q    +  C+N+G C        C C+   + G  C++ +                ++ I  C   G+ G  C +EI  C S  C+NGG C+   +   C C     G  C          N+   +   CFN+G C       QC C   + G+RCE +   C SD C   G     Q+ N Y  C+C+ T Y G RC+ +   C    C NGG C V +     + C+C  GF GS C+ +   C    CKN G C   + G  C C  + + G  C      L
Sbjct:  953 ECDSKPCLNGGTC----LDGYGTYKCTCPHGYTGVNCQHLVRWCDSSPCKNGGTCWQQGASYTCQCQ-TGWTGLYCDIPSVSCEVAAKQQGVEVNQLCRNSGQCLDAGSTHHCRCQ-AGYTGSYCQEQV----------------DERILSCVP-GYHGVNCSKEINECQSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEMNLDDCNPFNDPFTNEPKCFNNGRCVDRIGGYQCMCPPGYVGERCEGDVNECLSDPCDPRGSYNCIQLMNSY-RCECR-TGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYDSHSCGSLNCKNGGTCVSGHLGPRCLCP-SAFTGPECETPTDSL 1301          

HSP 9 Score: 82.4185 bits (202), Expect = 6.959e-15
Identity = 94/299 (31.44%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 3617 PKCDCSGTGFRGNNCE-QSFCSDSFCQNNGIC-SIENGLP---VCDCRNTQHKGKVCEKPI---CSESFCNNRGRCYVHNEQPI-CDCTATGFIGQKCER-EICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPY-CDCQNTNYEGTRC--NIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            P+C    + + GN C+  S CS S C+N G C ++  G     +C+C       ++C  P    C  + C N G C +       C C   G+ G+ C+    C SN C NGG C   DS   C C P F G  C    NE   +   C N G C        C C + + GQ C+     C    C  GG C  +    Y C C    + G  C  NI   CP   C NGG C      Y C+C   + G  C E   EC   PN C+N G C   +  + C C + G+ G  CS+ +
Sbjct:   15 PRCP---SDYIGNRCQYPSPCSPSPCRNGGRCRAVSRGNTFDFLCECP-LGFTDRLCLTPTNHACMSAPCRNGGTCELIALTDFRCQCPP-GWTGKSCQTPNPCASNPCANGGQCSSLDSTYRCTCPPNFHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQEYTGQHCQTPYVPCSPSPCQNGGTCVQKGDTTYDCSCL-PGFMGQHCEHNI-DDCPGHNCQNGGVCADGVNTYNCQCPPHYTGQYCTENVDECEMMPNVCQNGGTCHDTHGSYHCVCVN-GWTGDDCSKNI 305          

HSP 10 Score: 81.2629 bits (199), Expect = 1.585e-14
Identity = 99/350 (28.29%), Postives = 132/350 (37.71%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCP----------RDFCRNGGRCYMYDKQPKCDCSG-------------------TGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDC-RNTQHKGKVCE----------KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGL--CVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQ---CSCTKNFEGQRCEIEKR-CPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP--KRCPLEFCSNGGNCQVR-NGQYY-CECQEGFQGSRCQ 4327
            C+   C+N G C+Q       C C  G+TG  C+    +C              CRN G+C        C C                      G+ G NC +    C    CQN G C        C C R TQ  G  CE           P  +E  C N GRC        C C   G++G++CE ++  C S+ C   G   C+   +   C+C   +TG +C++    C    C N GTC +++  P    C C   F G  CE +   C S  C  GG C   +  P C C +  + G  C  P    C    C NGG CQ   N  ++ C C   F G  C 
Sbjct:  992 CDSSPCKNGGTCWQQGA-SYTCQCQTGWTGLYCDIPSVSCEVAAKQQGVEVNQLCRNSGQCLDAGSTHHCRCQAGYTGSYCQEQVDERILSCVPGYHGVNCSKEINECQSQPCQNGGTCIDLINTYKCSCPRGTQ--GVHCEMNLDDCNPFNDPFTNEPKCFNNGRCVDRIGGYQCMCPP-GYVGERCEGDVNECLSDPCDPRGSYNCIQLMNSYRCECRTGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYDSHSCGSLNCKNGGTCVSGHLGPRCLCPSA-FTGPECETPTDSLCISNPCYNGGTCQTTPNAPFFKCSCPSNFNGLLCH 1336          

HSP 11 Score: 54.6842 bits (130), Expect = 1.741e-6
Identity = 75/263 (28.52%), Postives = 115/263 (43.73%), Query Frame = 2
Query: 3443 KCEMGYCQNRGL--CYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK---CDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKP---ICSESFCNNRGRCYVHNEQPICDCT-ATGFIGQKCEREICTSNFCKNGG--LCVPRDSQPTC---QCTPEFTGFQCNERKCSSNFC-FNDGTCYISNERPQCSCTKNFEGQR----CEIEKRCPSDFCYYGGV-CQIRNG 4165
            +C    C  RG   C QL ++   C C  G+TG++C+K+   C    CRNGG C +    P    C C   GF G++CE     C    C+N G C   +  P C C  +   G  CE P   +C  + C N G C      P   C+  + F G  C   I   +F    G  +  P + + +C   QC  E+ G    +  C+++ C ++ G C ++ + P  +C+   +  R     + + +C S  C Y G  CQ + G
Sbjct: 1181 ECLSDPCDPRGSYNCIQL-MNSYRCECRTGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCP-PGFTGSSCEYDSHSCGSLNCKNGGTCVSGHLGPRCLCP-SAFTGPECETPTDSLCISNPCYNGGTCQTTPNAPFFKCSCPSNFNGLLC--HILDYSFVGGFGRDITPPPEVEVSCGIPQCD-EWAGNHICDSLCNNHACGWDGGDCSLNFDDPWKNCSAALQCWRYFNDGKCDGQCNSPGCLYDGFDCQGQEG 1437          
BLAST of Cell polarity protein vs. Ensembl Medaka
Match: notch1a (neurogenic locus notch homolog protein 1 [Source:NCBI gene;Acc:101171596])

HSP 1 Score: 129.798 bits (325), Expect = 3.812e-29
Identity = 114/355 (32.11%), Postives = 155/355 (43.66%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDS--FCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTA-TGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER----KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVR--NGQYYCECQEGFQGSRCQ-ERKECP--PNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
             C    C+N G C  +A+    C C  G+TG+ C+     C  + C NGG+C   D   +C C    F G  C+     C+ +   C N GIC  E G   C C   ++ G+ C+ P   CS S C N G C V       DC+   GF+GQ CE  I  C  + C+NGG+C    +   CQC P +TG  C E     +   N C N GTC+ ++    C C   + G  C      C +  C++G  C  R    +C+C +    G  C++   C    C  G NC     NG+  C C  G+ GS C  +  EC    N C++ G C      F C C   GY G  C   V
Sbjct:  105 ACMSAPCRNGGTCELIALTDFRCQCPPGWTGKSCQTPN-PCASNPCANGGQCSSLDSTYRCTCP-PNFHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQ-EYTGQHCQTPYVPCSPSPCQNGGTC-VQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCPPHYTGQYCTENVDECEMMPNVCQNGGTCHDTHGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDRVASFFCECPH-GRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDECALGANPCEHGGRCLNTLGSFQCKCLQ-GYEGPRCEMDV 453          

HSP 2 Score: 129.028 bits (323), Expect = 5.610e-29
Identity = 116/357 (32.49%), Postives = 157/357 (43.98%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLA-IDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPL----------EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C    C+N G+C +        C C EG+ G+ CE     C +  C NG  C       +C C   GF G  CE     C  + C N G+C        C C     +G  CE+ I  C  + C N   C        C C  TGF G  CE     CT + C NGG CV   +  TC C   FTG  C  +  +C S  C N GTC       +C+C   + G  C+ + + C S  C  GG C  +     C CQ T + G  C+IP   C +          + C N G C      ++C CQ G+ GS CQE+  EC PN C+N   C+    G++C+C   GY G++CS+++
Sbjct:  833 CSSRPCKNGGVCKEAEDYQSFSCICPEGWQGQTCEIDINECVKSPCWNGAFCLNTMGGYQCKCQ-PGFTGQKCETDIDDCKPNPCSNGGLCHDGISSFTCTCL-PGFRGGRCEQDINECESNPCKNGANCTDCVNSYTCTC-PTGFSGINCEINTNDCTDSSCFNGGTCVDGINSFTCLCLTGFTGSYCQFDINECDSKPCLNGGTCLDGYGTYKCTCPHGYTGVNCQHLVRWCDSSPCKNGGTCWQQGASYTCQCQ-TGWTGLYCDIPSVSCEVAAKQQGVEVNQLCRNSGQCLDAGSTHHCRCQAGYTGSYCQEQVDECSPNPCQNGATCTDYLGGYSCECV-PGYHGVNCSKEI 1184          

HSP 3 Score: 118.242 bits (295), Expect = 1.009e-25
Identity = 115/369 (31.17%), Postives = 159/369 (43.09%), Query Frame = 2
Query: 3428 CRNP-LKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF----CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCE-REICTSNFCKNGGLCV--PRDSQPTCQCTPEFTGFQCN----ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYG 4483
            C+ P + C    CQN G C Q       C+C  GF G+ CE     CP   C+NGG C        C C    + G  C ++        + CQN G C   +G   C C N    G  C K I  C+ + C +   C+       C+C   G  G  C   + C SN C+ G  C   P + +  C C P +TG  CN    E    +N C + G C  +    QC C + +EG RCE++   C S+ C     C  + G  +C C    YEG  C+I    C  + C N G C  +   +YCEC +GF G+ CQ +  EC    C+N   C+   N + C+C   GY G  C   +    ++   YG
Sbjct:  215 CQTPYVPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCP-PHYTGQYCTENVDECEMMPNVCQNGGTCHDTHGSYHCVCVNGW-TGDDCSKNIDDCAAAACFHGATCHDRVASFFCEC-PHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDECALGANPCEHGGRCLNTLGSFQCKCLQGYEGPRCEMDVNECMSNPCQNDATCLDQIGGFHCICM-PGYEGVFCHIDTDECASQPCLNNGKCIDKINSFYCECPKGFSGNLCQVDIDECASTPCRNGAKCTDGPNKYNCECAE-GYTGQHCEIDINECYSDPCHYG 578          

HSP 4 Score: 102.449 bits (254), Expect = 6.773e-21
Identity = 106/333 (31.83%), Postives = 142/333 (42.64%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK-RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDC 4408
            +C    C N G C    I+   C C +GF+G  C+     C    CRNG +C     +  C+C+  G+ G +CE     C    C   G C        C CR   + G++CE  I  C    C N G C       IC C   G  G  CE  +  C S  C + G C+ + +   C C P +TG  CN     C+ N C N GTC        C C + +    C  +   C S+ C +G    + NGY  C C ++ + G  C+I K  C    C NGG C+     Y+C C+ GF G  CQ    EC  N C N G C     G+ C+C
Sbjct:  493 ECASQPCLNNGKCID-KINSFYCECPKGFSGNLCQVDIDECASTPCRNGAKCTDGPNKYNCECA-EGYTGQHCEIDINECYSDPCHY-GTCKDGLASFTCYCR-PGYTGRLCETNINECLSQPCKNGGTCQDRENSYICSC-PKGTAGFNCEINLDDCKSQPC-DYGRCIDKINGYECACRPGYTGTMCNINIDDCAINPCHNGGTCIDGINSFTCLCPEGYNDATCLSQVDECSSNPCIHGLCQDLINGY-KCTC-DSGWSGQNCDINKNECDSNPCMNGGTCKDMTSGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNC 817          

HSP 5 Score: 101.679 bits (252), Expect = 1.261e-20
Identity = 110/356 (30.90%), Postives = 144/356 (40.45%), Query Frame = 2
Query: 3428 CRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRD--FCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQ-HKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI----CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIR--NGYPYCDCQNTNYEGTRCNIP-KRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C+ P  C    C N G C  L      C C   F G+ C+     C +    C NGG C        C C    + G +C+  +  CS S CQN G C ++ G    DC       G+ CE  I  C    C N G C        C C    + GQ C   +       N C+NGG C        C C   +TG  C  N   C++  CF+  TC+       C C     G  C ++  C S+ C  G  C     NG   C C    Y G+ CN+    C L    C +GG C    G + C+C +G++G RC+ +  EC  N C+ND  C     GF C C   GY G+ C
Sbjct:  138 CQTPNPCASNPCANGGQCSSLD-STYRCTCPPNFHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQE-YTGQHCQTPYVPCSPSPCQNGGTC-VQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCPPH-YTGQYCTENVDECEMMPNVCQNGGTCHDTHGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDRVASFFCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCP-PGYTGSACNLDIDECALGANPCEHGGRCLNTLGSFQCKCLQGYEGPRCEMDVNECMSNPCQNDATCLDQIGGFHCICM-PGYEGVFC 487          

HSP 6 Score: 98.9821 bits (245), Expect = 7.482e-20
Identity = 112/372 (30.11%), Postives = 150/372 (40.32%), Query Frame = 2
Query: 3440 LKCEMG--YCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK----CDCSGTGFRGNNC---EQSFCSDSFCQNNGICSIENGLPVCDCR---NTQHKGKVCEKP-ICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREIC----TSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER--KCSSNFCFNDGTCYISNERP-QCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRC--NIPKRCPL--EFCSNGGNCQVRNGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEK 4477
            LKC +    C N G C   +     C C   + G +C+     C    CRNGGRC    +       C+C   GF    C       C  + C+N G C +   + + D R        GK C+ P  C+ + C N G+C   +    C C    F GQ C+ ++     T   C NGG+CV       C+C  E+TG  C      CS + C N GTC    +    CSC   F GQ CE     CP   C  GGVC        C C   +Y G  C  N+   C +    C NGG C   +G Y+C C  G+ G  C +   +C    C +   C      F C+C H G  G+ C      + N  +K
Sbjct:   21 LKCSLPTESCLNGGRCVATSSGNGECRCPSDYIGNRCQ-YPSPCSPSPCRNGGRCRAVSRGNTFDFLCECP-LGFTDRLCLTPTNHACMSAPCRNGGTCEL---IALTDFRCQCPPGWTGKSCQTPNPCASNPCANGGQCSSLDSTYRCTCPPN-FHGQTCKLDVNECAQTPYLCLNGGICVNEVGSYHCRCPQEYTGQHCQTPYVPCSPSPCQNGGTCVQKGDTTYDCSCLPGFMGQHCEHNIDDCPGHNCQNGGVCADGVNTYNCQCP-PHYTGQYCTENV-DECEMMPNVCQNGGTCHDTHGSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDRVASFFCECPH-GRTGLLCHLDDACISNPCQK 383          

HSP 7 Score: 97.0561 bits (240), Expect = 2.682e-19
Identity = 111/377 (29.44%), Postives = 156/377 (41.38%), Query Frame = 2
Query: 3443 KCEMGYCQNRGLCYQLAIDKLG---CNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNC------------EQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC----------NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGG---VCQIRNGYPYCDCQNTNYEGTRCN-IPKRCPLEFCSNGGNCQVRNGQ---YYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGL 4459
            +C+   C N G C    +D  G   C C  G+TG  C+ +   C    C+NGG C+       C C  TG+ G  C            +Q    +  C+N+G C        C C+   + G  C++ +  CS + C N   C  +     C+C   G+ G  C +EI  C S  C+NGG C+   +   C C     G  C          N+   +   CFN+G C       QC C   + G+RCE +   C SD C   G     Q+ N Y  C+C+ T Y G RC+ +   C    C NGG C V +     + C+C  GF GS C+ +   C    CKN G C   + G  C C  + + G  C      L
Sbjct: 1024 ECDSKPCLNGGTC----LDGYGTYKCTCPHGYTGVNCQHLVRWCDSSPCKNGGTCWQQGASYTCQCQ-TGWTGLYCDIPSVSCEVAAKQQGVEVNQLCRNSGQCLDAGSTHHCRCQ-AGYTGSYCQEQVDECSPNPCQNGATCTDYLGGYSCECVP-GYHGVNCSKEINECQSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEMNLDDCNPFNDPFTNEPKCFNNGRCVDRIGGYQCMCPPGYVGERCEGDVNECLSDPCDPRGSYNCIQLMNSY-RCECR-TGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYDSHSCGSLNCKNGGTCVSGHLGPRCLCP-SAFTGPECETPTDSL 1390          

HSP 8 Score: 95.1301 bits (235), Expect = 9.534e-19
Identity = 113/383 (29.50%), Postives = 149/383 (38.90%), Query Frame = 2
Query: 3446 CEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPI--CSESFCNNRGRCYVHNEQPICDCTA------------------------------------TGFIGQKCE--REICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCE-IEKRCPSDFCYYGGVCQIRNGYPYCDCQ-NTNYEGTRCNIP-KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            C  G C++        +    C C  G+TG  CE     C    C+NGG C   +    C C   G  G NCE +   C    C         NG   C CR   + G +C   I  C+ + C+N G C        C C                                      +G+ GQ C+  +  C SN C NGG C    S   C C   FTG  C  N  +C+SN C N GTC       +C+C   + G+ CE +   C S  C  GGVC+    Y    C     ++G  C I    C    C NG  C    G Y C+CQ GF G +C+ +  +C PN C N G+C    + FTC C   G+ G  C + +
Sbjct:  575 CHYGTCKD-------GLASFTCYCRPGYTGRLCETNINECLSQPCKNGGTCQDRENSYICSCP-KGTAGFNCEINLDDCKSQPCDYGRCIDKINGY-ECACR-PGYTGTMCNINIDDCAINPCHNGGTCIDGINSFTCLCPEGYNDATCLSQVDECSSNPCIHGLCQDLINGYKCTCDSGWSGQNCDINKNECDSNPCMNGGTCKDMTSGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENCETLLAPCSSRPCKNGGVCKEAEDYQSFSCICPEGWQGQTCEIDINECVKSPCWNGAFCLNTMGGYQCKCQPGFTGQKCETDIDDCKPNPCSNGGLCHDGISSFTCTCL-PGFRGGRCEQDI 946          

HSP 9 Score: 88.1965 bits (217), Expect = 1.496e-16
Identity = 98/316 (31.01%), Postives = 131/316 (41.46%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDC-RNTQHKGKVCE----------KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGL--CVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQ---CSCTKNFEGQRCEIEKR-CPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP--KRCPLEFCSNGGNCQVR-NGQYY-CECQEGFQGSRCQ 4327
            C+N G C   A     C C  G+TG  C++    C  + C+NG  C  Y     C+C   G+ G NC +    C    CQN G C        C C R TQ  G  CE           P  +E  C N GRC        C C   G++G++CE ++  C S+ C   G   C+   +   C+C   +TG +C++    C    C N GTC +++  P    C C   F G  CE +   C S  C  GG C   +  P C C +  + G  C  P    C    C NGG CQ   N  ++ C C   F G  C 
Sbjct: 1116 CRNSGQCLD-AGSTHHCRCQAGYTGSYCQEQVDECSPNPCQNGATCTDYLGGYSCECV-PGYHGVNCSKEINECQSQPCQNGGTCIDLINTYKCSCPRGTQ--GVHCEMNLDDCNPFNDPFTNEPKCFNNGRCVDRIGGYQCMCPP-GYVGERCEGDVNECLSDPCDPRGSYNCIQLMNSYRCECRTGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYDSHSCGSLNCKNGGTCVSGHLGPRCLCPSA-FTGPECETPTDSLCISNPCYNGGTCQTTPNAPFFKCSCPSNFNGLLCH 1425          

HSP 10 Score: 75.8702 bits (185), Expect = 7.095e-13
Identity = 105/386 (27.20%), Postives = 140/386 (36.27%), Query Frame = 2
Query: 3443 KCEM--GYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCE-QSFCSDSFCQNNGICSIE--NGLPVCDCRNTQHKGKVCEKPI----CSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIP--------------------------------------KRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQ-ERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCS 4441
            +CEM    CQN G C+        C C  G+TG+ C K    C    C +G  C+       C+C   G  G  C     C  + CQ    C     NG  +C C    + G  C   I       + C + GRC        C C   G+ G +CE ++  C SN C+N   C+ +     C C P + G  C  +  +C+S  C N+G C        C C K F G  C+++   C S  C  G  C        C+C    Y G  C I                                         C  + C NGG CQ R   Y C C +G  G  C+    +C    C + G C    NG+ C C   GY G  C+
Sbjct:  298 ECEMMPNVCQNGGTCHDTH-GSYHCVCVNGWTGDDCSKNIDDCAAAACFHGATCHDRVASFFCECP-HGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCP-PGYTGSACNLDIDECALGANPCEHGGRCLNTLGSFQCKCLQ-GYEGPRCEMDVNECMSNPCQNDATCLDQIGGFHCICMPGYEGVFCHIDTDECASQPCLNNGKCIDKINSFYCECPKGFSGNLCQVDIDECASTPCRNGAKCTDGPNKYNCECAE-GYTGQHCEIDINECYSDPCHYGTCKDGLASFTCYCRPGYTGRLCETNINECLSQPCKNGGTCQDRENSYICSCPKGTAGFNCEINLDDCKSQPC-DYGRCIDKINGYECAC-RPGYTGTMCN 676          

HSP 11 Score: 54.299 bits (129), Expect = 2.703e-6
Identity = 75/263 (28.52%), Postives = 115/263 (43.73%), Query Frame = 2
Query: 3443 KCEMGYCQNRGL--CYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPK---CDCSGTGFRGNNCE--QSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKP---ICSESFCNNRGRCYVHNEQPICDCT-ATGFIGQKCEREICTSNFCKNGG--LCVPRDSQPTC---QCTPEFTGFQCNERKCSSNFC-FNDGTCYISNERPQCSCTKNFEGQR----CEIEKRCPSDFCYYGGV-CQIRNG 4165
            +C    C  RG   C QL ++   C C  G+TG++C+K+   C    CRNGG C +    P    C C   GF G++CE     C    C+N G C   +  P C C  +   G  CE P   +C  + C N G C      P   C+  + F G  C   I   +F    G  +  P + + +C   QC  E+ G    +  C+++ C ++ G C ++ + P  +C+   +  R     + + +C S  C Y G  CQ + G
Sbjct: 1270 ECLSDPCDPRGSYNCIQL-MNSYRCECRTGYTGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCP-PGFTGSSCEYDSHSCGSLNCKNGGTCVSGHLGPRCLCP-SAFTGPECETPTDSLCISNPCYNGGTCQTTPNAPFFKCSCPSNFNGLLC--HILDYSFVGGFGRDITPPPEVEVSCGIPQCD-EWAGNHICDSLCNNHACGWDGGDCSLNFDDPWKNCSAALQCWRYFNDGKCDGQCNSPGCLYDGFDCQGQEG 1526          
BLAST of Cell polarity protein vs. Ensembl Medaka
Match: jag1b (jagged canonical Notch ligand 1 [Source:NCBI gene;Acc:101168394])

HSP 1 Score: 128.257 bits (321), Expect = 7.362e-29
Identity = 123/365 (33.70%), Postives = 154/365 (42.19%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQS--FCSDSFCQNNGICSIENGLPVCDC------RNTQHKGKVCEKPIC----------------------SESFCNNRGRCYVH-NEQPICDCTATGFIGQKCEREI--CTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEI-EKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPK--RCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRC-QERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            CQN G C  L ++   C C  GFTGE CE+    C    C NGGRC       +C C  TGF GN C+    +CS + CQN   C       VC C      RN  H    C    C                      S + C   GRC      Q  C+C   GF G  C   I  C SN C NGG C+ + S   C C   + G  C  N   CS++ C N GTC        C C   ++G+ C   E +C    C  GG C        C C +  +EGT CNI K   C    C NGG C V+   + C C+EG++G  C Q   +C P+ C N G C   +N + C+C   G+ G  C
Sbjct:  453 CQNGGTCKDL-VNGYRCLCPPGFTGELCERDVDECASSPCLNGGRCQDEVNGFQCLCL-TGFSGNLCQLDIDYCSQNPCQNGAPCFNRANDYVCACPEDYEGRNCSHLKDHCRTTTCTVIDSCTVAVASNSTPGGERYISSNVCGPHGRCRSQAGGQFTCECQE-GFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTCRDLVTDFFCECKNGWKGKTCHSRESQCDEATCNNGGTCHDEGDTFQCRC-SPGWEGTTCNIAKNSSCLPNPCENGGTCVVKGESFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWYRCECA-PGFAGPDC 812          

HSP 2 Score: 107.071 bits (266), Expect = 2.233e-22
Identity = 113/365 (30.96%), Postives = 155/365 (42.47%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGIC-SIENGLPVCDCRNTQHKGKVC--EKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICT-SNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNE--RKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEG------------TRCNIPKRCPLEFCSNG----------------GNCQVR-NGQYYCECQEGFQGSRCQER-KECPPNFCKNDGICSVINNGFTCDCTHTGYFGISC 4438
            C N G C     DK  C C+EG++G  CE+ E  C  + C NGG C    +  +C C+  G+ G +C  +   CS + C + G C  + NG   C C  +Q  GK C  +   C    C N   C        C+C   G++GQ C+  I    + C+NGG C    +   C C P FTG  C     +C+S+ C N G C       QC C   F G  C+++   C  + C  G  C  R     C C   +YEG            T C +   C +   SN                 G C+ +  GQ+ CECQEGF+G+ C E   +C  N C N G C    + + C C   G+ G  C
Sbjct:  301 CLNGGTCINTGPDKYQCTCAEGYSGANCERAERACLSNPCSNGGSCSETSQGYECRCA-PGWSGPSCSMNVDDCSPNPCSHGGTCQDLVNGYK-CHCP-SQWTGKTCLIDANECDSKPCVNANSCRNLIGGYFCECLP-GWMGQNCDININDCKDQCQNGGTCKDLVNGYRCLCPPGFTGELCERDVDECASSPCLNGGRCQDEVNGFQCLCLTGFSGNLCQLDIDYCSQNPCQNGAPCFNRANDYVCACPE-DYEGRNCSHLKDHCRTTTCTVIDSCTVAVASNSTPGGERYISSNVCGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICA-DGWEGEHC 659          

HSP 3 Score: 95.1301 bits (235), Expect = 8.858e-19
Identity = 84/247 (34.01%), Postives = 108/247 (43.72%), Query Frame = 2
Query: 3461 CQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSF--CSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCE--KPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKC---EREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQC--NERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQIR-NGY 4168
            C   G C   A  +  C C EGF G  C +    C  + C NGG C       +C C+  G+ G +CE +   CS S C N G C        C+C+N   KGK C   +  C E+ CNN G C+   +   C C+  G+ G  C   +   C  N C+NGG CV +    TC C   + G  C  N   CS + C+N GTC   +   +C C   F G  C I    C S  C  G  C    NGY
Sbjct:  594 CGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICA-DGWEGEHCEINIDDCSTSPCHNGGTCRDLVTDFFCECKNGW-KGKTCHSRESQCDEATCNNGGTCHDEGDTFQCRCSP-GWEGTTCNIAKNSSCLPNPCENGGTCVVKGESFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCALGSTCVDEINGY 837          

HSP 4 Score: 79.337 bits (194), Expect = 5.849e-14
Identity = 85/285 (29.82%), Postives = 125/285 (43.86%), Query Frame = 2
Query: 3641 GFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEK----PICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREI---CTSNFCKNGGLCV---PRDSQPTCQCTPEFTGFQCN--ERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIE-KRCPSDFCYYGGVCQ-IRNGYPYCDCQNTNYEGTRCNI-PKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV 4450
            G+ G +C  + C       +G+C    G   CDC     +G+ C+K    P C    C       V   Q +C+   T + G  C++++    T   C NGG C+   P   Q  C C   ++G  C   ER C SN C N G+C  +++  +C C   + G  C +    C  + C +GG CQ + NGY  C C  + + G  C I    C  + C N  +C+   G Y+CEC  G+ G  C        + C+N G C  + NG+ C C   G+ G  C   V
Sbjct:  218 GWSGPDCNTAICRQGCSTEHGLCKEPGG---CDCL-YGWQGQYCDKCIPHPGCVHGTC-------VEPWQCLCE---TNWGGHLCDKDLNYCGTRQPCLNGGTCINTGPDKYQ--CTCAEGYSGANCERAERACLSNPCSNGGSCSETSQGYECRCAPGWSGPSCSMNVDDCSPNPCSHGGTCQDLVNGY-KCHCP-SQWTGKTCLIDANECDSKPCVNANSCRNLIGGYFCECLPGWMGQNCDININDCKDQCQNGGTCKDLVNGYRCLCP-PGFTGELCERDV 483          
BLAST of Cell polarity protein vs. Planmine SMEST
Match: SMESG000027800.1 (SMESG000027800.1)

HSP 1 Score: 4758.74 bits (12342), Expect = 0.000e+0
Identity = 2451/2490 (98.43%), Postives = 2461/2490 (98.84%), Query Frame = 2
Query:  110 CLNCKCFPNXXXXXXXXXXXXXENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNEIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQKRTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRXXXXXXXXXXXXXXXXAGNHGGIIMRPNELYXXXXXXXXXXXXXXXXXXXXXXXXSLLGLPVIXXXXXXXXXXXXXXXXXXXWAXXXXXXXXXXXXTGLAPGKASAAALKQKILTPMQLSSVQXXXXXXXXXXXXXEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESN+IKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQ+RTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKD  G+KQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRY GIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAV+KSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGF CDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGF  +           ++N Y  +    I+    THKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKE IKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQI+MPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ
Sbjct:    4 CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNDIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQERTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDKFGSKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYSGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVVKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFICDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFSDK----------DVKNVYMEFFQWRIV---MTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKEKIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQIAMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 2480          
BLAST of Cell polarity protein vs. Planmine SMEST
Match: SMESG000027800.1 (SMESG000027800.1)

HSP 1 Score: 4757.97 bits (12340), Expect = 0.000e+0
Identity = 2450/2490 (98.39%), Postives = 2460/2490 (98.80%), Query Frame = 2
Query:  110 CLNCKCFPNXXXXXXXXXXXXXENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNEIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQKRTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRXXXXXXXXXXXXXXXXAGNHGGIIMRPNELYXXXXXXXXXXXXXXXXXXXXXXXXSLLGLPVIXXXXXXXXXXXXXXXXXXXWAXXXXXXXXXXXXTGLAPGKASAAALKQKILTPMQLSSVQXXXXXXXXXXXXXEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESN+IKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQ+RTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKD  G+KQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRY GIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAV+KSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGF CDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGF     +K +  ++           M     + THKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKE IKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQI+MPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ
Sbjct:    4 CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNDIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQERTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDKFGSKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYSGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVVKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFICDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGF----SDKDVKNVY-----------MEFFQWRITHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKEKIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQIAMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 2478          
BLAST of Cell polarity protein vs. Planmine SMEST
Match: SMESG000027800.1 (SMESG000027800.1)

HSP 1 Score: 4739.1 bits (12291), Expect = 0.000e+0
Identity = 2445/2490 (98.19%), Postives = 2455/2490 (98.59%), Query Frame = 2
Query:  110 CLNCKCFPNXXXXXXXXXXXXXENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNEIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQKRTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRXXXXXXXXXXXXXXXXAGNHGGIIMRPNELYXXXXXXXXXXXXXXXXXXXXXXXXSLLGLPVIXXXXXXXXXXXXXXXXXXXWAXXXXXXXXXXXXTGLAPGKASAAALKQKILTPMQLSSVQXXXXXXXXXXXXXEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESN+IKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQ+RTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDK      LTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKD  G+KQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRY GIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAV+KSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGF CDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGF  +           ++N Y  +    I+    THKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKE IKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQI+MPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ
Sbjct:    4 CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNDIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQERTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDK------LTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDKFGSKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYSGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVVKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFICDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFSDK----------DVKNVYMEFFQWRIV---MTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKEKIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQIAMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 2474          
BLAST of Cell polarity protein vs. Planmine SMEST
Match: SMESG000027800.1 (SMESG000027800.1)

HSP 1 Score: 4736.79 bits (12285), Expect = 0.000e+0
Identity = 2444/2490 (98.15%), Postives = 2454/2490 (98.55%), Query Frame = 2
Query:  110 CLNCKCFPNXXXXXXXXXXXXXENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNEIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQKRTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRXXXXXXXXXXXXXXXXAGNHGGIIMRPNELYXXXXXXXXXXXXXXXXXXXXXXXXSLLGLPVIXXXXXXXXXXXXXXXXXXXWAXXXXXXXXXXXXTGLAPGKASAAALKQKILTPMQLSSVQXXXXXXXXXXXXXEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESN+IKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQ+RTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDK      LTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKD  G+KQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRY GIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAV+KSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGF CDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGF     +K +  ++           M     + THKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKE IKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQI+MPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ
Sbjct:    4 CLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVEIVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFWIKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQTLELGITKKDWNFIKISYQNSKFSVESNDIKTPAVSEISKLNNFDLSQESLVLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQERTINFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEKSYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRTSDK------LTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIATEGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITEKTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIEREEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDKFGSKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLPPYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYSGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVVKSIDISKLEFYFGGMPEDLFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTYPLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQEGFQGSRCQERKECPPNFCKNDGICSVINNGFICDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIPYCKCENTGF----SDKDVKNVY-----------MEFFQWRITHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKEKIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKIILPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILGAGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGKASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPITHNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQIAMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 2472          
BLAST of Cell polarity protein vs. Planmine SMEST
Match: SMESG000056635.1 (SMESG000056635.1)

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 469/1396 (33.60%), Postives = 761/1396 (54.51%), Query Frame = 2
Query: 1481 DYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTKEPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFG-IDGKDYRKQMNPKGTFVTTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDNPSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKCLNDVRHCTASHCEGGTCHDRSYPYL-SDKNFYCDCSAISRTYRNPVGNXXXXXXXXXXXXXXTSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPDATIFQTFRSNSDL---YFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLNDNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVGSDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTXXXXXXXXXXXXXXXXVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYDMYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIE-DGSQFQLDDNNWHRVVIMLNKKLRRIIVHVDKGYQPKVINLAVIKS-----IDISKLEFYFGGMPED-LFTNVFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGA-INTYPLNSLDCGGCR-NPLKCEMGYCQNRGLCYQLAIDKLGCNCSEG-FTGEKCEKIEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNNGICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVH--NEQPICDCTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNERKCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVCQIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQE-GFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKVTGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGRYWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGPQTETFLI--SFDGVTSGVQNEISYKEIIIGASNEE---RDIFKGAIGGFNWNGKYIFEQIKTGQGERKGTIEI----ILVPTI-INRPPT--SCPKGFCANNGECIIMDYIPYCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFLLQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDNENPYLVKFIREKENIKFFINGIQTSSFNLKN-IISNDGSLIHKKIILGADKSYKTYFQGAIGGFEWNGYKMIDDSG 5575
            ++++++ P+P +FT    ++R  PW+F ++ SIE++F T+EPRG+L FVG   A TD + LE ++ N+Y AFG + GKD+R ++NP    V+ G F  + I+    +    KF++VE+     +  + EF SYTYIGG+D  +RLPW  +S+ GF GCINY+R+N ++++D +  + Q   ++ G   G C      C    C  G CH+RSY  L   KNFYCDCS   ++Y     +I R E C  +S+    +  S+ +  F      DK   TH DDI+I F+T      +F      +++   + S +++ G V++   + + +N   K +F     NLND +WH + + R A ++  YVD   N   G++        F N  + I +GS     G +K  G I+NF+WN+ D LG +   G Y   + T KP+LP LPP+PR PP+ CT++P+H YT + +I  T + + ++IEFKT++ GIIWH  ++++S  ++MTL++  N +IL + +   + V+ IE       + DN WHRV+I LNK    + +H+D      + N   +K+      +++ +    GG+ ++  +T  +  LR   P +++  + P+    +GCLGE L+    +  N +    +N++P  SL C  C+ N  KC   YCQN+G CY +   K+ C+C +  F GE C+    +C  + C+NG  C +      C+C+GTGF G +CE S C +  CQNNGIC ++ G+P CDC  T ++G++CE P C   FC N G C ++  N+ P C C +TGF G +C + IC  N+C   G C+ RD    C C   FTG +C +  CS + C N G C + +  P C C K+F+G+ CE  K CP  +C YGG C++ NG P C+C  TNY G +C  PK+CP ++C NGG C + N  + C C    + G RC  +  CP N+CKN G C +    F C+C+ TGY G  C +KV G+  +Y++ GY I    PP+ ++    ++GFQTF+KTGT++ + T D +YW +K+ NG+LV DING  +  ++ V+DG+Y+ + + ++    +  L     E  LI  +   + +   N I Y ++ +  S  +   RD F+GAIG        I + +K       G +      IL P + +   PT   C  GFC N+G+C++ +Y P C C  +GF G +C+++I  I  +  +  GY+++   P   T+ D  +F+ ++  S+ P+      +    EI + + K+    NG+    ++D + ++   P   K +     +  ++NG +     LK  +I  + S+   K+++GA+++     +G++G F +N   +I  +G
Sbjct:   25 EFILTSQPIPVSFTMPGAMLRLHPWNFAKYSSIELEFHTREPRGILFFVGSSTASTDSIGLEIFNSNVY-AFGKLLGKDFRIKLNPDNIRVSNGKFFKVAIQILATNYLVLKFDDVEIKEKIPTPGKLEFNSYTYIGGVDTITRLPWKAFSQTGFTGCINYIRINGERFLDTKQHSKQT--EMQGAKTGVCQTSTARCLPGICGPGKCHERSYNMLDQSKNFYCDCSGTFKSYAYSAVDILRGEPCLIDSQRFQCNTKSYLLYTF------DKEKTTHYDDISIDFQTTNTKEPLFLMKSGTANVINTFLSAEVLAGQVIIIIKLYESNNENYKSSFFSKNSNLNDGQWHTLKLSRFAYNVEFYVDEQENLSRGELYQSSLEEKFFNRVKEILLGSTTKPPGPDKCTGEIKNFFWNEEDLLGRKNKYGYYSSQLVTEKPTLPILPPFPRQPPMPCTLKPNHIYTVLNNIPLTNEGIILFIEFKTKFDGIIWHAVNVFSS-EDWMTLLVNSNSIILAYSLPPNEGVHTIEMTRGGILIQDNTWHRVIINLNKPKEILHIHIDD--VESLTNEIKLKNSKKELAEMNFISLSLGGISDNSQYTQFYNLLRNKNPEVSKLFSGPDELKFIGCLGEILVINSSYSGNLIQKPNVNSFPKESLFCRACQENVKKCPKNYCQNKGRCYNINETKIACDCKKTQFYGEFCDIKRPSCDPNPCKNG-ICQIVGNNRICNCTGTGFTGFDCEISRCFNHKCQNNGICILKQGIPECDCTKTVYEGQLCETPKCPLDFCLNNGHCLLNQVNQLPYCVCNSTGFYGYRCNKPICPQNYCTKNGNCLVRDDSAVCYCDEGFTGDKCEKPICSKDKCINGGKCVVVDRSPFCVCAKDFQGKSCEKPKPCPVGYCLYGGKCRMVNGMPRCNCTQTNYMGKKCEKPKKCPEKYCENGGICSIINNVFICNCSNVSYTGERCTNKVGCPDNYCKNGGACEIHRGKFGCNCSLTGYGGEQCDQKVDGVMCDYKEPGYAITAFKPPMVSSGIVTSMGFQTFVKTGTLFCYETADDKYWLIKLVNGRLVADINGISFNMKTVVSDGRYHFLKVSRDETNFVISLDHYPFENLLIPTAITSILTLPNNIIIYTKLTLCNSCPDTFNRDRFQGAIGSAKSGHVDISKGLKNDGSAGGGIMIGGITNILTPVMPLPEIPTIQPCYAGFCKNSGKCLVKNYGPRCDCGISGFTGNQCDQKIMAIKSVPPN-PGYVIITRNPVIATNFDLIRFISESSESSTPLTALITPEGNSIEIKIENQKVFVRINGEAKGPLND-KLIEKNVPNFFKLVNLLGRVTVYVNGTKLGHIVLKEPLIMKNNSIQISKVLVGANRNADETIKGSLGDFRYNELNLISSNG 1405          

HSP 2 Score: 326.25 bits (835), Expect = 2.950e-89
Identity = 182/484 (37.60%), Postives = 274/484 (56.61%), Query Frame = 2
Query: 6149 LSANANGMAHGDHGDFHSTTIREERGNITRNIGGSMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIGQGSIMRIDTTHHETDFEGR------PNVFAGEEMKVDCCVLSQNSRYAVTGSANSPPQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHHRLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIVCWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAHYMVFDL-MASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIWNLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSADQTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNLESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQ 7579
            ++A+ N +   ++ D   + + +E+ +I + + G  Q+     ++    H MR  R          ++   N  + S  FGT G     +I    + + F  +      PNVF+  EMK+DCCV+S NSRYA+TGS   PPQ+WD+  G L  +MDG    CT LHLA  + +L+GLV     T+      LK L MW F  G  I    + MC+  C++   + +++  +  D S++I+      NQ  +++ Y+    +N +GI  LK + N + ++AGF   D+   YMVFD+ M S  NG+         NA T  T+ I  +E +TGT  GELIIW+L T + VR+ILIS     N++++ NPHKD++ C+ VS +G  L T   D TV V+ M DE+L++ L  H D++ S V S DNE++VSGS DGS+R+WN+ +G +MC F SNIEI  V L++DKK +V LGER G+ KL+ML+
Sbjct: 1515 VTASGNKLLLIENNDLQISPLLQEKASI-QLLSGGFQADTNETMI----HTMRQNRMDMNKT---SDFFTSNGFNKS-TFGTTGSADFEKIQPVKYASIFAQQDTDLQQPNVFSEGEMKIDCCVMSNNSRYAITGSVAGPPQVWDLNDGFLTHIMDGANQACTSLHLAMNNSVLIGLV-----TQNQQPFSLKLLMMWKFPDGQIIDSGDEYMCTTCCVSADGECVILADDMKDSSITILNL---TNQQTRKLVYKA-GLVNGDGIQLLKQTKNGQFLIAGFQTFDNSTSYMVFDMTMQSRKNGVF------KINANTNCTDFINNNEVVTGTESGELIIWDLNTVQAVRRILISPNFVDNSESR-NPHKDSLTCVTVSNDGSLLATTGLDATVKVWNMEDEKLLYNLNKHKDEIQSLVWSNDNEMLVSGSLDGSIRIWNVTNGQEMCGFNSNIEITKVLLSDDKKVVVGLGERAGVNKLVMLK 1973          
The following BLAST results are available for this feature:
BLAST of Cell polarity protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOTCH14.924e-3133.88notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881... [more]
SNED15.050e-3033.96sushi, nidogen and EGF like domains 1 [Source:HGNC... [more]
SNED18.819e-3033.96sushi, nidogen and EGF like domains 1 [Source:HGNC... [more]
SNED11.258e-2933.96sushi, nidogen and EGF like domains 1 [Source:HGNC... [more]
NOTCH36.576e-2730.81notch receptor 3 [Source:HGNC Symbol;Acc:HGNC:7883... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crb-17.440e-3329.60Drosophila CRumBs homolog [Source:UniProtKB/TrEMB... [more]
clec-785.211e-2328.57C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
glp-13.584e-2130.42pep chromosome:WBcel235:III:9092241:9099698:1 gene... [more]
lin-124.160e-2029.89pep chromosome:WBcel235:III:9060096:9071760:-1 gen... [more]
F55H12.32.113e-1730.63pep chromosome:WBcel235:I:8876319:8893051:1 gene:W... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crb1.604e-2729.47gene:FBgn0259685 transcript:FBtr0111008[more]
crb1.720e-2729.47gene:FBgn0259685 transcript:FBtr0334925[more]
crb2.466e-2729.47gene:FBgn0259685 transcript:FBtr0304726[more]
crb2.531e-2729.47gene:FBgn0259685 transcript:FBtr0084603[more]
Nrx-11.563e-2622.31gene:FBgn0038975 transcript:FBtr0334611[more]
back to top
BLAST of Cell polarity protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crb11.240e-3226.12crumbs cell polarity complex component 1 [Source:Z... [more]
crb11.240e-3226.12crumbs cell polarity complex component 1 [Source:Z... [more]
crb11.541e-3226.12crumbs cell polarity complex component 1 [Source:Z... [more]
notch1a6.209e-3032.42notch receptor 1a [Source:NCBI gene;Acc:30718][more]
notch1b6.354e-3030.63notch receptor 1b [Source:ZFIN;Acc:ZDB-GENE-990415... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch11.421e-3131.82notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
emid14.228e-3028.85EMI domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
emid14.483e-3028.85EMI domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
emid15.248e-3028.85EMI domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
notch15.584e-3031.49notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
back to top
BLAST of Cell polarity protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Notch18.858e-3234.25notch 1 [Source:MGI Symbol;Acc:MGI:97363][more]
Sned11.288e-2934.06sushi, nidogen and EGF-like domains 1 [Source:MGI ... [more]
Notch32.485e-2729.83notch 3 [Source:MGI Symbol;Acc:MGI:99460][more]
Tnxb9.263e-2631.96tenascin XB [Source:MGI Symbol;Acc:MGI:1932137][more]
Tnxb1.585e-2531.96tenascin XB [Source:MGI Symbol;Acc:MGI:1932137][more]
back to top
BLAST of Cell polarity protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P21783|NOTC1_XENLA1.008e-3232.77Neurogenic locus notch homolog protein 1 OS=Xenopu... [more]
sp|Q07008|NOTC1_RAT2.564e-3134.53Neurogenic locus notch homolog protein 1 OS=Rattus... [more]
sp|Q01705|NOTC1_MOUSE6.196e-3134.25Neurogenic locus notch homolog protein 1 OS=Mus mu... [more]
sp|G3I6Z6|NOTC1_CRIGR1.078e-3034.25Neurogenic locus notch homolog protein 1 OS=Cricet... [more]
sp|P46531|NOTC1_HUMAN2.364e-3033.88Neurogenic locus notch homolog protein 1 OS=Homo s... [more]
back to top
BLAST of Cell polarity protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KLP98.780e-12534.25Cell polarity protein OS=Schistosoma mansoni OX=61... [more]
A0A5K4ELY61.124e-12434.25Cell polarity protein OS=Schistosoma mansoni OX=61... [more]
G4VG966.077e-6433.78Cell polarity protein OS=Schistosoma mansoni OX=61... [more]
A0A183ME421.882e-1532.99Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A564XYW44.811e-15737.25Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svep15.790e-3033.53sushi, von Willebrand factor type A, EGF and pentr... [more]
notch1b2.762e-2932.21neurogenic locus notch homolog protein 1-like [Sou... [more]
notch1b3.527e-2932.21neurogenic locus notch homolog protein 1-like [Sou... [more]
notch1b3.527e-2932.21neurogenic locus notch homolog protein 1-like [Sou... [more]
notch1a6.329e-2932.22neurogenic locus notch homolog protein 1 [Source:N... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp1ab6.655e-2135.75low density lipoprotein receptor-related protein 1... [more]
ENSPMAT00000002643.19.089e-2133.51pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 g... [more]
ENSPMAT00000001302.13.436e-2028.08pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 ... [more]
ENSPMAT00000002014.14.660e-2036.90pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 g... [more]
ENSPMAT00000000962.16.142e-1927.62pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 ... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MDV12.316e-921.36Peripheral protein of cytosolic face of mitochondr... [more]
TUP14.188e-831.25General repressor of transcription; forms complex ... [more]
PWP21.690e-728.18Conserved 90S pre-ribosomal component; essential f... [more]
MET301.833e-730.70F-box protein containing five copies of the WD40 m... [more]
RSA44.714e-722.66WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488515.847e-3835.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469697.783e-2933.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330484.881e-2833.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331997.979e-2833.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297201.820e-2734.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell polarity protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041634.11.905e-3524.00crumbs cell polarity complex component 2 [Source:N... [more]
ENSORLT00000020612.25.449e-3524.25crumbs cell polarity complex component 2 [Source:N... [more]
notch1a2.238e-2932.11neurogenic locus notch homolog protein 1 [Source:N... [more]
notch1a3.812e-2932.11neurogenic locus notch homolog protein 1 [Source:N... [more]
jag1b7.362e-2933.70jagged canonical Notch ligand 1 [Source:NCBI gene;... [more]
back to top
BLAST of Cell polarity protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027800.10.000e+098.43SMESG000027800.1[more]
SMESG000027800.10.000e+098.39SMESG000027800.1[more]
SMESG000027800.10.000e+098.19SMESG000027800.1[more]
SMESG000027800.10.000e+098.15SMESG000027800.1[more]
SMESG000056635.12.950e-8933.60SMESG000056635.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025553 ID=SMED30025553|Name=Cell polarity protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7999bp
AAAAATCCAACGTTTAAGCGACTTCGCCAAAAAAAATTTTTTTTATAAAG
CATTTGAAATAATTTCATGAAAATATAAAGAGAAAGAATTCAAGTATAAA
ATGAAGATTTGTTTGAATTGTAAATGTTTTCCGAATTTATTAATATTATT
ATTATTATGTGGATCATTAATCTGTGAAAATATCCATTTGCCTTTGGATA
ACTTAGTTGGTCAGAAACTTATCGACTCTTCTTATTTTGGACCAGTTGAG
ATTGTTTCCAGAGGAGACGGAAAGGCACTTCGATTCAATGGTACCAAAGG
TCCAGTTTCAATTACCTATACCCTTGATAAAGCTACAGATGCTATTTCAT
CTTGTTTTCGAGGCTTTTCCCATTGCACAGATTATATAATCAAATTTTGG
ATTAAACTCAACTTTGAATCTCCTATTTTTAATCGTGAGTCTTTTATTAA
ATTTGGCCCCCCAAACAACAAGGGAAAAGGATTGAGCATTTATCCTATCA
ATGAAAACAAATTAAGTATCTCGTTTGATAATGGCAAAGAAAAACAAACT
CTTGAGCTTGGAATCACTAAAAAGGATTGGAATTTTATAAAAATCTCCTA
TCAAAACTCGAAATTTAGTGTTGAATCTAACGAAATCAAAACGCCGGCTG
TGTCAGAAATCAGCAAATTGAACAATTTTGACTTGTCACAAGAATCTTTG
GTGTTGGGGTTCGGAAAGAAATCAAATGGAATTGTAGTTGAATTAGACGA
TTTCAAGTTCCTGTTAACTAAAACGTCGAAGGATTACCAATCTGACTCGT
TTCAAAGCGAAGAAAGATATGATACTAAATCTTCTCAACAGAAGAGGACG
ATTAATTTCAATGGACAAAATTATTTAAAATATAACTTTGAAAACAGAAT
TATTCGGCCAAGTGAAAATGAGGAATTAGATTTACAGTTTAAATTTAGTG
AAGATTTCACAAGTGGTTTGTTATGGTATTCAGAAAAAGGTCTTGAGAAG
AGCTACATTTATTTGAAGGATTCCCGGCTGTACTACGCGTATATTTATAG
AAAAAGTGGCGATGGAGCGCAGATAACAGCCACAGAAGAAATCTACGTGC
CAGAAATTCTTTCCCCCAATATGTATCACAGATTAGTCATTCATAGAACA
TCAGACAAAACTTCCGAATTCAGTAATCTGACTTTAACTATTAATAAAGT
TCTAAAAGCAAATAAGGCTATTATTGTTGGAAGAGTGCCATTAATTCCAG
CAAATGGACACATTTATGTTGGGGGTCACGAAAATTCAAGAATCGCTACT
GAAGGAAGAATTGATACCAGATTTAGAGGATCTATTAAAAATGTAACGGT
TTCGGGAGAAAATCATGAAACCTTTGATTTAATTAATATTTTTCGAGATA
AAAGTTCTGTAGGCATTGTGAAAAATTTTGGAGAGGTCACAATTACTGAA
AAGACATCATATGATTATACTCACACCGGTGATTACCTTATTTCCGCTAC
CCCTGTTCCGTTTACATTTACGGAATTTGACAAGCTTGTCAGATTTTCTC
CATGGGATTTTGAACAATTCGAGTCAATAGAGATACAATTTAGAACTAAG
GAACCGAGAGGAGTTTTATTATTCGTCGGTCCAGATAATGCTCATACTGA
TTATGTCTGCTTGGAATTTTATGATCGAAATCTTTATCTAGCTTTTGGTA
TAGATGGAAAAGACTATAGAAAACAAATGAACCCAAAAGGCACTTTTGTG
ACGACTGGAAACTTCCACACAATATTTATCAAAAGAGACAGAAATCATAA
ATTCACTGCAAAGTTTGAAAATGTTGAAGTTGATATCGGCGATCAATCTG
GTCATCAAAGAGAATTCGGCTCTTACACATACATCGGTGGAATTGACAAT
CCTAGTCGACTACCTTGGTATGTTTGGTCAAGAGAGGGTTTTGTAGGATG
TATCAACTATATGAGAGTTAATGAAGATAAATACATTGACCCAAGAGGGA
AAAACAATCAATATTCTGGTGACATTGCTGGGGTGGATATTGGAAAATGT
CTAAATGATGTTCGACACTGTACAGCCTCACACTGCGAAGGAGGAACTTG
TCATGATAGAAGTTATCCATATCTTTCAGATAAAAATTTCTATTGTGATT
GCTCTGCCATTTCCAGAACATACCGAAATCCTGTTGGAAACATTGAAAGA
GAAGAAATATGTGCAAGAGAAAGTGAAGAAATAACTAGCGACGGAACAAG
TTTTTATGTCGTCGATTTTAAATCTGAAGATAGTAGAGATAAAATGATGA
AAACCCACACGGATGATATTGCTATCAGCTTCAAAACTCTTCAGCCTGAT
GCAACGATCTTTCAGACTTTTAGAAGCAATTCCGATTTATACTTTTCCGT
CAAACTTGTAGGAGGTTATGTAGTTGTCGAAACCAATATTAATGATAAGG
ATAATATTGGTACCAAACAAACATTTCGTGTACCAGTTGGAAATCTAAAT
GACAATAAATGGCATAATATTTACATCAAACGTCGAGCAGAACACATTCT
GATATATGTTGATAACGTAAATAATCAAATTATAGGAAAAATACCGGTTC
TAAAATATTTAAGAACCTTCGATAATACATTTGAATATATATTTGTTGGG
TCAGATAATTTTGAGGCTGGAAAAGAGAAATTTGTCGGCTCAATCAGAAA
CTTCTATTGGAATCAATTTGACTTCCTAGGAACCCGAAGACTTGCAGGTA
CATACAAAGGTACTATTAAAACTCCAAAACCAAGTCTACCACCTTTGCCC
CCGTATCCGAGAGACCCACCAGTCAAATGCACTATGCGACCAGATCACAG
ATACACAAAAGTCACAGATATAGCAGCCACACAAGACGAAGTTGGAATTT
ATATAGAATTCAAAACTAGATATGGTGGAATTATTTGGCATGGCTATGAT
ATGTACAACAGTGGAAGAAACTACATGACTCTTATGCTCATAGACAACAA
ACTGATTCTAGTGCACCATATCAATGAGGTGAAAAGTGTAAATATTATTG
AGGATGGTTCCCAATTTCAATTAGATGATAACAATTGGCACAGAGTAGTG
ATAATGCTGAATAAAAAACTGAGAAGAATCATTGTACATGTGGACAAAGG
TTATCAACCAAAGGTCATAAACTTAGCAGTTATTAAAAGCATTGACATAT
CGAAATTGGAGTTCTATTTTGGAGGAATGCCAGAAGACTTGTTTACGAAC
GTATTTACACAGTTACGAGTTTCTCTACCATATCTTGCTGAAAAGGTTGC
GACTCCAAATACCTGGTCACTTGTTGGATGCCTAGGAGAATTTTTAATAT
CTGAAGACAAGTTTCTATCTAATAAACTATCTGGAGCCATAAACACATAT
CCTTTAAATTCGTTAGACTGCGGAGGCTGTAGAAACCCCTTGAAATGCGA
AATGGGATACTGTCAGAATAGAGGTTTATGTTATCAATTAGCAATTGACA
AATTAGGTTGCAATTGTTCTGAAGGTTTCACAGGAGAAAAGTGTGAGAAA
ATAGAGTTTACGTGCCCAAGAGACTTTTGTCGCAATGGAGGTCGATGCTA
TATGTATGATAAACAACCAAAATGTGATTGCAGTGGTACAGGATTTAGAG
GGAATAATTGTGAACAATCCTTTTGTTCTGATTCATTTTGTCAAAATAAT
GGGATCTGTAGTATAGAAAATGGTTTACCAGTATGTGATTGTCGAAATAC
TCAACACAAAGGAAAAGTTTGCGAGAAACCAATTTGTTCAGAATCATTTT
GTAACAATCGCGGAAGATGTTATGTTCACAACGAACAACCAATTTGTGAC
TGTACAGCTACTGGTTTTATAGGGCAAAAATGTGAACGGGAAATATGTAC
TTCTAATTTTTGTAAAAACGGTGGCTTGTGTGTTCCTAGAGACAGTCAAC
CCACTTGTCAATGTACTCCAGAGTTTACAGGTTTTCAATGCAACGAACGA
AAGTGCTCAAGCAACTTTTGTTTTAATGATGGCACTTGTTATATTTCAAA
TGAGAGACCACAATGTTCATGTACCAAAAACTTTGAAGGACAACGATGTG
AAATTGAAAAACGTTGTCCGAGTGATTTTTGCTACTACGGAGGCGTTTGT
CAGATAAGAAACGGATATCCGTATTGTGACTGTCAAAACACTAATTACGA
AGGAACAAGGTGTAATATTCCAAAAAGATGCCCTTTGGAGTTTTGTTCAA
ACGGGGGAAATTGTCAAGTAAGAAACGGTCAATATTATTGTGAATGCCAA
GAAGGATTTCAAGGAAGTCGATGTCAAGAAAGAAAAGAATGCCCACCTAA
CTTCTGTAAAAATGATGGTATCTGTTCTGTCATTAATAATGGATTCACAT
GTGATTGTACACATACTGGATATTTTGGCATTAGTTGTTCAGAAAAAGTC
ACTGGTTTGAAAAATGAATATGAAAAATATGGGTATGTGATTTACCCAGT
TTCTCCTCCCGTGGGAACTACAAGCGATCAAGTAACAGTTGGCTTCCAAA
CGTTTATGAAAACAGGAACTATATATACATTTAGGACTACAGACGGAAGA
TATTGGTCATTAAAAATGGATAATGGTAAATTAGTAATAGACATAAATGG
CAATAAATACCAAACACAAAGCAATGTTAATGATGGACAATATTATGTTG
TTTCAATTAAAAAAGAAGGAGAAAGAGGAATCTTTAAATTATTGGGTCCT
CAAACTGAGACGTTTTTGATATCCTTTGACGGTGTCACATCTGGGGTTCA
AAATGAAATTTCTTACAAAGAAATAATCATAGGAGCAAGTAATGAAGAAA
GAGATATATTTAAAGGAGCTATCGGAGGTTTCAATTGGAATGGAAAGTAC
ATATTTGAACAAATAAAGACTGGTCAAGGCGAACGAAAAGGTACAATAGA
GATAATTCTCGTCCCCACCATTATTAATAGACCTCCAACTTCTTGCCCCA
AAGGCTTTTGCGCCAATAACGGAGAATGCATTATTATGGACTATATTCCA
TACTGTAAATGCGAAAATACTGGATTTTTCGGACAAAGATGTGAAAAACG
TATACATGGAATTTTTCCAATGGAGAATAGTTATGGTGGATATTTAGTAA
TGAATATAATCCCTCCTAAACAGACGCATAAAGATGAAACGCAATTTCTT
TTGCAAGCTTATACCTCAAATAATCCCGTCATTCGCTTTGAACTCAACGA
TGAACAATTTTATGAAATAAATATGATTGATGGGAAATTAATTTTTTTGG
AGAACGGAAAATTCCCAAGACTTATATCAGATGGGCAACGTATGGATAAT
GAGAATCCGTATTTAGTAAAGTTTATAAGAGAAAAGGAAAACATTAAGTT
TTTCATAAATGGAATACAGACCAGTTCCTTTAATTTGAAAAATATAATTA
GTAATGATGGCAGTCTCATTCATAAAAAAATAATTTTAGGTGCTGATAAA
TCTTACAAAACATATTTTCAAGGAGCTATAGGAGGATTTGAGTGGAATGG
CTACAAAATGATTGATGATTCTGGGAATTTGTTAAATTCGGTAAATAAAA
AGGGAGAAGTGATAATAATTCTGATGCCGAATCTGACAAGGAAAATTATT
TTACCAAAAAAAGTGAAGCCATTACCAGATCTTGTTCCCGCTGGAAATCA
TGGAGGAATTATTATGAGACCCAATGAATTATATGTACCAGGAGTTGGCA
GCGGAGGAGGTGCCATTGTTCCTGTAGGGGTTGGGCCTGTCATATTGGGA
GCTGGATCATTACTTGGTCTTCCTGTAATATCTACATTGGGTGCCGGTTT
ATTCTTGGCTACTTTGCTTTTACTATCAGCACTTCTATGGGCGTGCTGGA
GGTGTAAGCCGGGCTGTTGTCCTTGCTGCACCGGATTAGCTCCTGGAAAA
GCTTCAGCAGCTGCTTTAAAACAGAAAATACTGACTCCAATGCAGTTATC
ATCTGTTCAAACGGGAGGTGCTGGTTATGGCGGTGCAGGAAAAACTGGTG
AAAAGAGTTTCTGGTCCCGGATGAGATCTGGTTTTGCAACTCCAATAACT
CATAACATTTATGAGTCCAATGGATATAAATCTGAAAACATTGGATTACT
ATCAGCTAATGCCAATGGAATGGCTCATGGCGATCATGGGGACTTTCATT
CAACGACAATAAGGGAGGAAAGAGGTAATATAACTAGGAATATTGGAGGA
AGCATGCAGTCTTTACCAGGCGGTCCACTTCTTTATTCAGGAACTCATAA
CATGAGATCAACAAGATCTGTGGCAGGTGGAGCACCTTATGGTCATAATT
ATGGCCATGGAAATATGCTTGATGTCAGTGATCGATTTGGTACAATCGGT
CAAGGGTCAATTATGAGAATAGATACAACACATCATGAAACAGATTTTGA
AGGAAGACCAAACGTATTTGCAGGTGAAGAAATGAAAGTCGATTGTTGTG
TTTTGAGTCAAAACTCCAGATATGCAGTCACAGGTTCGGCTAATAGTCCT
CCACAAATTTGGGATATGCAAACAGGAGAACTTTTCAAAGTTATGGATGG
AATGGAAATAGGATGTACTGATCTTCATCTAGCTTGTGGTGATAAAATAT
TAGTGGGATTAGTAATGGATGAAATGCCTACTGAGGCATCTGACCATCAC
CGATTAAAAAGACTACAAATGTGGGATTTCGCCACTGGTTCTCAAATTTC
TATGCCCCTGGATGTCATGTGCTCGGCCTCATGTATCACACACTCTTCGG
ATCATATGGTCATTAACCGAGAATACCCAGATGGCAGCATGTCAATTGTT
TGCTGGGATTTACAAGCCAACCAACCTGTCCAAGAAATACATTATCAAAC
TCCTGATTTTATGAACCATGAGGGTATAACTTTCTTAAAAATATCTCACA
ACGACCGAATGGTTGTTGCTGGATTTACTGGAATGGATGACCAAGCACAT
TACATGGTATTTGACCTCATGGCGTCATATCCCAACGGAATTATGGTACA
GCCTTTAATAAGTAGTTTTAATGCAAAAACATGTGCTACTGAGATAATTG
GAGCCGACGAAGCAATAACAGGTACCCGAAAGGGAGAGTTAATAATTTGG
AATTTACGAACAGCAAAACCAGTTCGTCAGATACTTATTTCCGCAACTCT
TGAAGGAAATACACAAACCAAATTAAATCCTCACAAAGATGCAATTAACT
GTATAGCTGTTTCAAAGAATGGAGAATTTCTTGTTACTGGTAGCGCAGAT
CAGACCGTAAATGTTTACACAATGGCAGATGAAAGATTGATGCATACTCT
AGAAGGCCATGCAGATGATGTTCTCAGTGCAGTAATTTCCTTGGACAATG
AAATTATAGTGTCAGGAAGTTGGGATGGCTCAATGAGAGTTTGGAATCTT
GAAAGTGGATCCCAGATGTGTTGGTTTACATCAAATATAGAAATTCTCTC
AGTCAAATTAACAAATGACAAAAAAGCAATTGTTGCACTTGGAGAACGAA
TGGGCTTAAGAAAGCTTATCATGCTTCAAATAATTAGAAACCGAACAAGA
AGAACTCGTCACACAGGTGGGGGTATAGGCAGCCCCCCGTTTTCTCCGAT
ATCAACTTGATAAATTTTAACCACTGAGTTCTTTTCCGAAACAATACCTT
TATATCTATTTATCTTTGAATGAAAAATTAAAATTTATTTTTTAAAACTG
TCTAAACTCTTCTAAGAATCCAAAATAACTTTCGAAATTTTATTGTACTA
GGTTTTTTTATTTGTTGTTTATGAAGAGGAAATGTGATAGTTGTGTACAG
AGAAAATTGGATATATTTATTTGTTATTTATTAGATTTGTTTATTTGAAT
ATATTATATTGTTGAAGTAAAATCCAACAATAAGAAAATTATTTATTGAG
GTGAAATCATTAAATGTGAAAACATAAATTTAGTGTTATTAGAAAAGCT
back to top

protein sequence of SMED30025553-orf-1

>SMED30025553-orf-1 ID=SMED30025553-orf-1|Name=SMED30025553-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2520bp
MKICLNCKCFPNLLILLLLCGSLICENIHLPLDNLVGQKLIDSSYFGPVE
IVSRGDGKALRFNGTKGPVSITYTLDKATDAISSCFRGFSHCTDYIIKFW
IKLNFESPIFNRESFIKFGPPNNKGKGLSIYPINENKLSISFDNGKEKQT
LELGITKKDWNFIKISYQNSKFSVESNEIKTPAVSEISKLNNFDLSQESL
VLGFGKKSNGIVVELDDFKFLLTKTSKDYQSDSFQSEERYDTKSSQQKRT
INFNGQNYLKYNFENRIIRPSENEELDLQFKFSEDFTSGLLWYSEKGLEK
SYIYLKDSRLYYAYIYRKSGDGAQITATEEIYVPEILSPNMYHRLVIHRT
SDKTSEFSNLTLTINKVLKANKAIIVGRVPLIPANGHIYVGGHENSRIAT
EGRIDTRFRGSIKNVTVSGENHETFDLINIFRDKSSVGIVKNFGEVTITE
KTSYDYTHTGDYLISATPVPFTFTEFDKLVRFSPWDFEQFESIEIQFRTK
EPRGVLLFVGPDNAHTDYVCLEFYDRNLYLAFGIDGKDYRKQMNPKGTFV
TTGNFHTIFIKRDRNHKFTAKFENVEVDIGDQSGHQREFGSYTYIGGIDN
PSRLPWYVWSREGFVGCINYMRVNEDKYIDPRGKNNQYSGDIAGVDIGKC
LNDVRHCTASHCEGGTCHDRSYPYLSDKNFYCDCSAISRTYRNPVGNIER
EEICARESEEITSDGTSFYVVDFKSEDSRDKMMKTHTDDIAISFKTLQPD
ATIFQTFRSNSDLYFSVKLVGGYVVVETNINDKDNIGTKQTFRVPVGNLN
DNKWHNIYIKRRAEHILIYVDNVNNQIIGKIPVLKYLRTFDNTFEYIFVG
SDNFEAGKEKFVGSIRNFYWNQFDFLGTRRLAGTYKGTIKTPKPSLPPLP
PYPRDPPVKCTMRPDHRYTKVTDIAATQDEVGIYIEFKTRYGGIIWHGYD
MYNSGRNYMTLMLIDNKLILVHHINEVKSVNIIEDGSQFQLDDNNWHRVV
IMLNKKLRRIIVHVDKGYQPKVINLAVIKSIDISKLEFYFGGMPEDLFTN
VFTQLRVSLPYLAEKVATPNTWSLVGCLGEFLISEDKFLSNKLSGAINTY
PLNSLDCGGCRNPLKCEMGYCQNRGLCYQLAIDKLGCNCSEGFTGEKCEK
IEFTCPRDFCRNGGRCYMYDKQPKCDCSGTGFRGNNCEQSFCSDSFCQNN
GICSIENGLPVCDCRNTQHKGKVCEKPICSESFCNNRGRCYVHNEQPICD
CTATGFIGQKCEREICTSNFCKNGGLCVPRDSQPTCQCTPEFTGFQCNER
KCSSNFCFNDGTCYISNERPQCSCTKNFEGQRCEIEKRCPSDFCYYGGVC
QIRNGYPYCDCQNTNYEGTRCNIPKRCPLEFCSNGGNCQVRNGQYYCECQ
EGFQGSRCQERKECPPNFCKNDGICSVINNGFTCDCTHTGYFGISCSEKV
TGLKNEYEKYGYVIYPVSPPVGTTSDQVTVGFQTFMKTGTIYTFRTTDGR
YWSLKMDNGKLVIDINGNKYQTQSNVNDGQYYVVSIKKEGERGIFKLLGP
QTETFLISFDGVTSGVQNEISYKEIIIGASNEERDIFKGAIGGFNWNGKY
IFEQIKTGQGERKGTIEIILVPTIINRPPTSCPKGFCANNGECIIMDYIP
YCKCENTGFFGQRCEKRIHGIFPMENSYGGYLVMNIIPPKQTHKDETQFL
LQAYTSNNPVIRFELNDEQFYEINMIDGKLIFLENGKFPRLISDGQRMDN
ENPYLVKFIREKENIKFFINGIQTSSFNLKNIISNDGSLIHKKIILGADK
SYKTYFQGAIGGFEWNGYKMIDDSGNLLNSVNKKGEVIIILMPNLTRKII
LPKKVKPLPDLVPAGNHGGIIMRPNELYVPGVGSGGGAIVPVGVGPVILG
AGSLLGLPVISTLGAGLFLATLLLLSALLWACWRCKPGCCPCCTGLAPGK
ASAAALKQKILTPMQLSSVQTGGAGYGGAGKTGEKSFWSRMRSGFATPIT
HNIYESNGYKSENIGLLSANANGMAHGDHGDFHSTTIREERGNITRNIGG
SMQSLPGGPLLYSGTHNMRSTRSVAGGAPYGHNYGHGNMLDVSDRFGTIG
QGSIMRIDTTHHETDFEGRPNVFAGEEMKVDCCVLSQNSRYAVTGSANSP
PQIWDMQTGELFKVMDGMEIGCTDLHLACGDKILVGLVMDEMPTEASDHH
RLKRLQMWDFATGSQISMPLDVMCSASCITHSSDHMVINREYPDGSMSIV
CWDLQANQPVQEIHYQTPDFMNHEGITFLKISHNDRMVVAGFTGMDDQAH
YMVFDLMASYPNGIMVQPLISSFNAKTCATEIIGADEAITGTRKGELIIW
NLRTAKPVRQILISATLEGNTQTKLNPHKDAINCIAVSKNGEFLVTGSAD
QTVNVYTMADERLMHTLEGHADDVLSAVISLDNEIIVSGSWDGSMRVWNL
ESGSQMCWFTSNIEILSVKLTNDKKAIVALGERMGLRKLIMLQIIRNRTR
RTRHTGGGIGSPPFSPIST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001791Laminin_G
IPR001680WD40_repeat
IPR000742EGF-like_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR013320ConA-like_dom_sf
IPR013032EGF-like_CS
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR009030Growth_fac_rcpt_cys_sf
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane