DNA-binding protein Ikaros

Overview
NameDNA-binding protein Ikaros
Smed IDSMED30025549
Uniprot Best hitSpermatogenesis-associated protein 48 OS=Homo sapiens OX=9606 GN=SPATA48 PE=4 SV=2 (E=2.00938e-12)
Length (bp)1328
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-binding protein Ikaros (SMED30025549) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-binding protein Ikaros (SMED30025549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-binding protein Ikaros (SMED30025549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-binding protein Ikaros (SMED30025549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025549SMESG000052707.1 dd_Smed_v4_3031_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025549SMESG000052707.1 dd_Smed_v4_3031_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025549SMESG000052707.1 dd_Smed_v4_3031_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025549SMESG000052707.1 dd_Smed_v4_3031_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-binding protein Ikaros vs. Ensembl Human
Match: SPATA48 (spermatogenesis associated 48 [Source:HGNC Symbol;Acc:HGNC:22564])

HSP 1 Score: 72.4034 bits (176), Expect = 4.184e-13
Identity = 50/143 (34.97%), Postives = 76/143 (53.15%), Query Frame = 1
Query:  736 LYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMK-RPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKI 1161
             Y S+TQKAYED+P+D  L P+     +T+E++ DPI   ++  K Y  V +  + V  E ++  Q R   FL   +P +F S + R   IP Y+G + + N +D+DNP + D   L   R S P +   +      GYTGK+
Sbjct:  236 FYKSSTQKAYEDVPWDKMLPPKLVPEETTLEKTADPISQCFTL-KRYKGVPAITQMVG-ELWDRFQTR--SFLAPVKPINFVSSSSRSKYIPLYTGHVQSTNADDVDNP-LGDIASLAKQRYSKPLYTNTSRAANIPGYTGKV 373          
BLAST of DNA-binding protein Ikaros vs. Ensembl Zebrafish
Match: SPATA48 (chromosome 13 C7orf72 homolog [Source:NCBI gene;Acc:101884205])

HSP 1 Score: 89.3521 bits (220), Expect = 6.431e-19
Identity = 71/214 (33.18%), Postives = 108/214 (50.47%), Query Frame = 1
Query:  529 PTALTY----HNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGK 1158
            P+AL Y    H +  +     A+L+AK +   TNA   +  S+    I NA P+ +      AT     A +++YTS TQ+ YED+ +DS L PR   P+S++E+  DP+   +   + +   + W+       +   QLR   F  K+P  F S  P+   IP Y G +G+ N ++++ P  +DF PLTVLRS VP     +      GYTGK
Sbjct:  149 PSALIYDNSEHKRWNSRMRPEAALKAKLE-GWTNAQSIKQPSQDSHEI-NADPDPSVLFDSKAT----AAQQYIYTSATQRGYEDVAWDSKLPPRHEPPISSLEKMADPVSQCFVLKRYHSRPELWQ--AIGSHWSKHQLR-GTFNPKKPISFTSSCPKSGHIPLYCGTVGSENMDNVNIPE-EDFTPLTVLRSKVPPHTLTSYRTTIPGYTGK 352          
BLAST of DNA-binding protein Ikaros vs. Ensembl Xenopus
Match: SPATA48 (spermatogenesis associated 48 [Source:NCBI gene;Acc:100491044])

HSP 1 Score: 90.5077 bits (223), Expect = 1.508e-19
Identity = 67/211 (31.75%), Postives = 106/211 (50.24%), Query Frame = 1
Query:  532 TALTYHNKIKTVDACRASLRAK-EKRKITNALLAQIDSRKKTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKI 1161
            T+  +++  ++  A RA LR    KR           S  +TF  NA  + +  +  N +  E  A KF++TS+TQ AYE++P+DS L  +   P S ++       A+++  K     + W+ N  L  ++  Q R   +   RP+ F S  PR  QIP Y+GC G+ N EDIDNP   ++ P T +R+  P +     +P   GYTG++
Sbjct:   64 TSTCWNSVARSEAALRAILRGSASKRTPPQKAHGPSSSLSQTFAFNAVKD-SDDVS-NESLREAMARKFMFTSSTQSAYEEVPWDSKLPAKLSPPESAVKMKSRSASASFTPMKSEFHPEPWQVNGRL--WDRFQTR-RTYTGTRPNTFMSRFPRMDQIPNYTGCTGSRNSEDIDNPSA-EYTPFTKVRTQQPHYYKSAYSPNIPGYTGRV 268          
BLAST of DNA-binding protein Ikaros vs. Ensembl Mouse
Match: Spata48 (spermatogenesis associated 48 [Source:MGI Symbol;Acc:MGI:1921112])

HSP 1 Score: 60.077 bits (144), Expect = 2.705e-9
Identity = 40/144 (27.78%), Postives = 73/144 (50.69%), Query Frame = 1
Query:  736 LYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKC--YPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKI 1161
             Y S+TQKAYED+P+D  L P+     +T+E++ D I   +S  +    P++      +  + F+            +P +F SP+ R   IP Y+G + + + +++DNP+  D + +   R S  ++   + +    GYTGK+
Sbjct:  243 FYKSSTQKAYEDVPWDKMLPPKLDPEETTVEKAADHISQCFSLKRYERLPAITQMVGGL-WDRFQTRLFS----APAKPINFVSPSTRSKYIPLYTGHVQSTDADNVDNPY-GDIKSVASPRHSKLQYTNSSRSANIPGYTGKV 380          
BLAST of DNA-binding protein Ikaros vs. UniProt
Match: sp|A4D263|SPT48_HUMAN (Spermatogenesis-associated protein 48 OS=Homo sapiens OX=9606 GN=SPATA48 PE=4 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.009e-12
Identity = 50/143 (34.97%), Postives = 76/143 (53.15%), Query Frame = 1
Query:  736 LYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMK-RPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKI 1161
             Y S+TQKAYED+P+D  L P+     +T+E++ DPI   ++  K Y  V +  + V  E ++  Q R   FL   +P +F S + R   IP Y+G + + N +D+DNP + D   L   R S P +   +      GYTGK+
Sbjct:  236 FYKSSTQKAYEDVPWDKMLPPKLVPEETTLEKTADPISQCFTL-KRYKGVPAITQMVG-ELWDRFQTR--SFLAPVKPINFVSSSSRSKYIPLYTGHVQSTNADDVDNP-LGDIASLAKQRYSKPLYTNTSRAANIPGYTGKV 373          
BLAST of DNA-binding protein Ikaros vs. UniProt
Match: sp|Q5NC83|SPT48_MOUSE (Spermatogenesis-associated protein 48 OS=Mus musculus OX=10090 GN=Spata48 PE=2 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 2.013e-8
Identity = 40/144 (27.78%), Postives = 73/144 (50.69%), Query Frame = 1
Query:  736 LYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKC--YPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKI 1161
             Y S+TQKAYED+P+D  L P+     +T+E++ D I   +S  +    P++      +  + F+            +P +F SP+ R   IP Y+G + + + +++DNP+  D + +   R S  ++   + +    GYTGK+
Sbjct:  239 FYKSSTQKAYEDVPWDKMLPPKLDPEETTVEKAADHISQCFSLKRYERLPAITQMVGGL-WDRFQTRLFS----APAKPINFVSPSTRSKYIPLYTGHVQSTDADNVDNPY-GDIKSVASPRHSKLQYTNSSRSANIPGYTGKV 376          
BLAST of DNA-binding protein Ikaros vs. TrEMBL
Match: gnl|BL_ORD_ID|18254627 (tr|A0A267GR96|A0A267GR96_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002996g1 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.025e-40
Identity = 113/348 (32.47%), Postives = 171/348 (49.14%), Query Frame = 1
Query:  139 LFY-MDENCGPNDIEAYKIQEMKRKNRLNLGRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYNKANHRGI--NPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYE-----DIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGK 1158
            +FY  D N G NDI  ++ +  +R +R    R   +     K +  +F K       R   PYRDYE+ V+P+S  +  G   A  RG+   P+ + + N+  PQ   P+ I+S R   P  + E++R SE +P  L  H K+      RA      +   T+      +S K T + +      PK  P+ +E +  A K++YTSTTQ AYE     D+P   Y   +R+ P  T+E   DP+    +  K  P   +W       +++  QLRPD++  +RP+ +CS   R   +PTYSGC+GA N ++IDNP+ +   P TVLR+  PKF          GYTG+
Sbjct:   24 VFYRTDANAGLNDIRRFQQERFRRIHRFPPNRGSADAKSFGKESSPEFKKFEDSGLQRCAAPYRDYESIVDPISGSI--GAGAAFVRGLPGRPIGVYAHND-GPQYNRPQTIHSIRKGMPGAYPEIDRASETEPPGLPAHEKLVGPGYTRAV-----QGGWTSGTDQTPESAKLTLLCH-----LPKARPDMSERDRLAYKYIYTSTTQSAYEAVPAEDMPRGGY---KRFPPTHTLEAHADPVSLTNNSKKTLPPAQTWCSQERGLTWDFKQLRPDYYNRQRPYTYCSVARRTDHLPTYSGCVGADNPQEIDNPY-EPLRPYTVLRNPQPKFGVSGAPTDIPGYTGR 354          
BLAST of DNA-binding protein Ikaros vs. TrEMBL
Match: gnl|BL_ORD_ID|18225754 (tr|A0A267EMV2|A0A267EMV2_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002565g1 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.359e-40
Identity = 113/348 (32.47%), Postives = 171/348 (49.14%), Query Frame = 1
Query:  139 LFY-MDENCGPNDIEAYKIQEMKRKNRLNLGRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYNKANHRGI--NPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYE-----DIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGK 1158
            +FY  D N G NDI  ++ +  +R +R    R   +     K +  +F K       R   PYRDYE+ V+P+S  +  G   A  RG+   P+ + + N+  PQ   P+ I+S R   P  + E++R SE +P  L  H K+      RA      +   T+      +S K T + +      PK  P+ +E +  A K++YTSTTQ AYE     D+P   Y   +R+ P  T+E   DP+    +  K  P   +W       +++  QLRPD++  +RP+ +CS   R   +PTYSGC+GA N ++IDNP+ +   P TVLR+  PKF          GYTG+
Sbjct:   24 VFYRTDANAGLNDIRRFQQERFRRIHRFPPYRGSADAKSFGKESSPEFKKFEDSGLQRCAAPYRDYESIVDPISGSI--GAGAAFVRGLPGRPIGVYAHND-GPQYNRPQTIHSIRKGMPGAYPEIDRASETEPPGLPAHQKLVGPGYTRAV-----QGGWTSGTDQTPESAKLTLLCH-----LPKARPDMSERDRLAYKYIYTSTTQSAYEAVPAEDMPRGGY---KRFPPTHTLEAHADPVSLTNNSKKTLPPAQTWCSQERGLTWDFKQLRPDYYNRQRPYTYCSVARRTDHLPTYSGCVGADNPQEIDNPY-EPLRPYTVLRNPQPKFGVSGAPTDIPGYTGR 354          
BLAST of DNA-binding protein Ikaros vs. TrEMBL
Match: gnl|BL_ORD_ID|21118495 (tr|A0A2T7P8Q7|A0A2T7P8Q7_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09060 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.956e-39
Identity = 107/331 (32.33%), Postives = 166/331 (50.15%), Query Frame = 1
Query:  178 EAYKIQEMKRKNRLNLGRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYNKANHRGINPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKT-FISNAFPEFTPKIGPNATEDELK----AIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTG 1155
            E  KI++MK  +   L   +  +SF   +++  F   N   ++    P+R ++N ++PVS F++ G +   H G   ++       TPQ+ DPKE NS R+N P    EL R++ + P   T  N  K  D           R       ++ D RK    +  A   + PK  P + E +      A+++LY+S+TQ+ YE++P+D+ L P+ WAPV+T+E  PD I   +S+ +  P+   W+      SF+  Q R  ++    P  FCSP PR HQIP Y GCIGA N E++DN   + F P T+ R  +P  +  +  P   GY G
Sbjct:    6 EKRKIRQMKFPD---LRGRHDCESFQKSLDDPSFKVWNDEGDHSAYAPHRCFDNIIDPVSGFVSVGGDVDRHTGHERIRSMVQLNRTPQSADPKEKNSIRVNDPAAPPELRRENTWAPGEPTKWNSRKVSDGW--------IRSQLGGWTSEYDPRKPAPELIRAKSMYIPK--PPSEESKYSRDHLALRYLYSSSTQRGYEEVPWDTMLPPKMWAPVTTLENKPDQISQCFSQRRYEPAAQEWQ--ALGRSFDWFQQRRGYY-KSAPITFCSPCPRAHQIPLYGGCIGAENLEEMDNVQ-ESFHPFTIKRVIIPCPSETSHRPNIPGYKG 319          
BLAST of DNA-binding protein Ikaros vs. TrEMBL
Match: gnl|BL_ORD_ID|23512066 (tr|A0A210PW04|A0A210PW04_MIZYE Uncharacterized protein C7orf72 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19203 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.503e-38
Identity = 108/348 (31.03%), Postives = 166/348 (47.70%), Query Frame = 1
Query:  142 FYMDENCGPNDIEAYKIQEMKRKNRLNL----GRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYNKANHRGINPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRK------KTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTG 1155
             Y+D N G N ++  +I+  +R   +      GR   +    +   +  + K N   + R   PYRDY+N V+PVS F++ G +   + G   +       ETPQ   P+  NS+R        EL R + ++P A +  N     D           R       +  D R+      K    +AF    P        D L A+K+ Y ++TQK++E++P+D+ LHP++WAPVSTIEE PD I   Y+  +  P+   W+      S++  Q R  ++   +P  FCS NPR  QIP+Y G IGA N ++IDN   + F+P TV R  +P+++     P   GY G
Sbjct:   26 LYVDANAGGNSVQ--QIETHRRARHMKFPTLTGRGDVDSFTTSMKTDIGYKKWNDEGDFRSSAPYRDYDNIVDPVSGFVSAGGDVDRNTGRKKINSLVQLNETPQAVPPQGKNSDRKKEVKAPPELRRSNTYEPGAPSMWNSRSVSDIW--------IRSQLGGWTSDYDPRQPAPEMSKWRSKSAFVPKPPSEQSRDGRDHL-AMKYKYGTSTQKSFEEVPWDNMLHPKQWAPVSTIEERPDMISQNYTLKRYDPAAQEWQSTG--RSWDWFQKRQGYY-KNQPVAFCSSNPRAQQIPSYGGSIGAENLDEIDNAQ-EPFDPYTVKRVLIPRYSETGHRPNIPGYKG 358          
BLAST of DNA-binding protein Ikaros vs. TrEMBL
Match: gnl|BL_ORD_ID|23901468 (tr|K1Q5G4|K1Q5G4_CRAGI Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10006803 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.374e-35
Identity = 107/353 (30.31%), Postives = 174/353 (49.29%), Query Frame = 1
Query:  133 KCLFYMDENCGPNDIEAYKIQEMKRKNRLNL----GRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYN---KANHRGINPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISNAF---PEFTPKIGPNATED--ELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTG 1155
            +    +D N G N ++  +I+  +R  ++      GR   +        +  F + N   + R   PYRDY+N V+PVS F++ G +      H+ I P  +A  N+  PQ   P+  +S+R N      EL R + ++P A ++ N  KT D    S              +  D RK+   ++ +     F PK     ++D  +  A+KF+Y S+TQK+YE++P+D+ L  ++WAPVST+E+ PD I   Y+  +  P+   W+      S++  Q R  ++    P +F SP PR   IP YSGCIGA N ++ DN   + F P T+ R ++P+++     P   GY G
Sbjct:   23 QSYLQVDTNAGGNTVQ--QIENHRRIRQMKFPTLSGRADVDSFKAFPAKDIGFKRWNDEGDFRANAPYRDYDNIVDPVSGFVSAGGDVDRGTGHKKIRP--LAQLND-VPQCAAPQSKHSDRKNSEKAPPELRRSNTYEPGAPSFWNSRKTSDEWIKSQ--------LGGWTSDYDPRKEAPETSRWRSKSAFVPKPPSEQSKDGRDHLALKFMYGSSTQKSYEEVPWDNMLPSKQWAPVSTLEDRPDMISQTYTLKRYDPAAQEWQGTG--RSWDWFQKRRGYY-KDGPINFSSPCPRTQHIPNYSGCIGADNLDEKDN-QKEPFYPYTIKRVNIPRYSETGHRPNIPGYQG 358          
BLAST of DNA-binding protein Ikaros vs. Ensembl Cavefish
Match: SPATA48 (spermatogenesis associated 48 [Source:NCBI gene;Acc:103044575])

HSP 1 Score: 97.4413 bits (241), Expect = 7.234e-22
Identity = 61/170 (35.88%), Postives = 93/170 (54.71%), Query Frame = 1
Query:  724 AIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGK------------IPI--LPGNMLPP 1191
            A ++ YTS  Q+ YED+ +DS L PR  AP+ST+E+  DP+   ++  +     + W+       +   QLR   +  K+P  F SP+P+  QIP Y G +G+ N +++D+P  KDF+PLTVLR+ +P +      P   GYTGK            +P   +PG+ LPP
Sbjct:  194 ARRYSYTSAAQRGYEDVDWDSKLPPRFKAPLSTLEKMADPVNQHFTLKRYNSRPELWQAIGTY--WNKHQLR-ATYNAKKPVSFTSPHPKSGQIPLYCGVVGSENMDNVDDPD-KDFKPLTVLRTILPPYTPTAHRPTIPGYTGKALHARPHTSDITLPSRPIPGSSLPP 359          
BLAST of DNA-binding protein Ikaros vs. Ensembl Cavefish
Match: SPATA48 (spermatogenesis associated 48 [Source:NCBI gene;Acc:103044575])

HSP 1 Score: 86.6557 bits (213), Expect = 3.119e-18
Identity = 49/136 (36.03%), Postives = 80/136 (58.82%), Query Frame = 1
Query:  724 AIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTET 1131
            A ++ YTS  Q+ YED+ +DS L PR  AP+ST+E+  DP+   ++  +     + W+       +   QLR   +  K+P  F SP+P+  QIP Y G +G+ N +++D+P  KDF+PLTVLR+ +P +    ++
Sbjct:  194 ARRYSYTSAAQRGYEDVDWDSKLPPRFKAPLSTLEKMADPVNQHFTLKRYNSRPELWQAIGTY--WNKHQLR-ATYNAKKPVSFTSPHPKSGQIPLYCGVVGSENMDNVDDPD-KDFKPLTVLRTILPPYTPTAQS 325          
BLAST of DNA-binding protein Ikaros vs. Planmine SMEST
Match: SMESG000052707.1 (SMESG000052707.1)

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 390/390 (100.00%), Postives = 390/390 (100.00%), Query Frame = 1
Query:   67 MVERIIKXXXXXXXXXXXXXXXKCLFYMDENCGPNDIEAYKIQEMKRKNRLNLGRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYNKANHRGINPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKIPILPGNMLPPFNTDPIPRNVLGQPC 1236
            MVERIIKDLRLSNLGGRRLRDSKCLFYMDENCGPNDIEAYKIQEMKRKNRLNLGRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYNKANHRGINPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKIPILPGNMLPPFNTDPIPRNVLGQPC
Sbjct:    1 MVERIIKDLRLSNLGGRRLRDSKCLFYMDENCGPNDIEAYKIQEMKRKNRLNLGRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFLTPGYNKANHRGINPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQSEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISNAFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPVSTIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRPHDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFATCTETPVFVGYTGKIPILPGNMLPPFNTDPIPRNVLGQPC 390          
The following BLAST results are available for this feature:
BLAST of DNA-binding protein Ikaros vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPATA484.184e-1334.97spermatogenesis associated 48 [Source:HGNC Symbol;... [more]
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPATA486.431e-1933.18chromosome 13 C7orf72 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPATA481.508e-1931.75spermatogenesis associated 48 [Source:NCBI gene;Ac... [more]
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Spata482.705e-927.78spermatogenesis associated 48 [Source:MGI Symbol;A... [more]
back to top
BLAST of DNA-binding protein Ikaros vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A4D263|SPT48_HUMAN2.009e-1234.97Spermatogenesis-associated protein 48 OS=Homo sapi... [more]
sp|Q5NC83|SPT48_MOUSE2.013e-827.78Spermatogenesis-associated protein 48 OS=Mus muscu... [more]
back to top
BLAST of DNA-binding protein Ikaros vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182546271.025e-4032.47tr|A0A267GR96|A0A267GR96_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182257541.359e-4032.47tr|A0A267EMV2|A0A267EMV2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|211184951.956e-3932.33tr|A0A2T7P8Q7|A0A2T7P8Q7_POMCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|235120661.503e-3831.03tr|A0A210PW04|A0A210PW04_MIZYE Uncharacterized pro... [more]
gnl|BL_ORD_ID|239014683.374e-3530.31tr|K1Q5G4|K1Q5G4_CRAGI Uncharacterized protein OS=... [more]
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SPATA487.234e-2235.88spermatogenesis associated 48 [Source:NCBI gene;Ac... [more]
SPATA483.119e-1836.03spermatogenesis associated 48 [Source:NCBI gene;Ac... [more]
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein Ikaros vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein Ikaros vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052707.10.000e+0100.00SMESG000052707.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025549 ID=SMED30025549|Name=DNA-binding protein Ikaros|organism=Schmidtea mediterranea sexual|type=transcript|length=1328bp
GGTGAAAATGACAAAATTTGAATTAACGAAATTTTAAAGATAAATTTTCA
ATATTAAGTTTTTCAAATGGTTGAACGAATTATCAAAGATTTAAGATTAT
CAAATTTAGGAGGGCGAAGACTTAGAGATTCAAAATGTTTATTTTACATG
GATGAAAACTGTGGCCCAAACGACATTGAAGCATATAAAATTCAAGAAAT
GAAAAGGAAAAATAGGTTGAATTTGGGTCGAAACTATTATAACAAATCTT
TTATAAATAAAGTTAACGAAGAAGATTTTTACAAAGTTAATCATTTGAAA
GAAAATCGTTTACCACAACCATACAGAGATTATGAAAATTTTGTTAATCC
AGTTTCACATTTTCTAACACCAGGCTACAACAAAGCCAATCATCGAGGAA
TTAATCCCGTTAAAATAGCATCGTTTAATGAAGAAACTCCTCAAAATACA
GATCCAAAGGAAATCAACTCTAATCGAATAAATTGTCCAAATGTTTTCGA
GGAGTTGAATCGCCAAAGTGAATTTGATCCAACAGCGCTCACTTATCATA
ACAAAATTAAAACCGTTGATGCTTGTAGAGCTAGTCTTAGAGCTAAAGAG
AAACGGAAAATCACAAATGCATTATTAGCTCAAATAGACAGCAGAAAGAA
AACTTTCATTTCGAATGCTTTTCCTGAATTTACGCCCAAAATCGGACCAA
ATGCCACTGAAGATGAATTGAAAGCCATTAAATTTCTCTATACATCTACT
ACACAAAAGGCGTATGAAGATATACCATTTGATAGTTATTTACATCCTCG
GCGGTGGGCTCCAGTCAGCACGATTGAAGAATCTCCTGATCCCATTAGAG
CAGCGTACTCCAAAAATAAATGTTATCCATCTGTGGACAGTTGGAGAAAA
AATGTTGACTTGGAGAGTTTTGAAGCAGCTCAATTAAGGCCAGATCACTT
TTTGATGAAGCGACCTCATGATTTTTGCTCCCCTAATCCAAGAGGACATC
AAATACCGACTTACAGCGGATGCATTGGAGCATATAATAAAGAAGATATT
GATAATCCACATGTCAAAGATTTCGAGCCACTTACTGTGTTGCGAAGCTC
GGTTCCAAAATTTGCCACTTGTACAGAAACGCCAGTATTTGTCGGGTACA
CGGGCAAAATTCCAATTTTGCCTGGTAATATGCTGCCGCCATTTAATACA
GATCCAATTCCGCGGAATGTACTCGGCCAGCCATGCTAAATTTTATTTAC
GATTTTTCATAACTGCCTGCAGTTTTCCAAGTTAAACAAAGAATTAGTCT
TTCATTTATTTAGGATCCAAAGATTATA
back to top

protein sequence of SMED30025549-orf-1

>SMED30025549-orf-1 ID=SMED30025549-orf-1|Name=SMED30025549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=391bp
MVERIIKDLRLSNLGGRRLRDSKCLFYMDENCGPNDIEAYKIQEMKRKNR
LNLGRNYYNKSFINKVNEEDFYKVNHLKENRLPQPYRDYENFVNPVSHFL
TPGYNKANHRGINPVKIASFNEETPQNTDPKEINSNRINCPNVFEELNRQ
SEFDPTALTYHNKIKTVDACRASLRAKEKRKITNALLAQIDSRKKTFISN
AFPEFTPKIGPNATEDELKAIKFLYTSTTQKAYEDIPFDSYLHPRRWAPV
STIEESPDPIRAAYSKNKCYPSVDSWRKNVDLESFEAAQLRPDHFLMKRP
HDFCSPNPRGHQIPTYSGCIGAYNKEDIDNPHVKDFEPLTVLRSSVPKFA
TCTETPVFVGYTGKIPILPGNMLPPFNTDPIPRNVLGQPC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
Vocabulary: INTERPRO
TermDefinition
IPR027867SPATA48
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027867Spermatogenesis-associated protein 48PFAMPF15073SPATA48coord: 298..365
e-value: 1.1E-14
score: 54.9
NoneNo IPR availablePANTHERPTHR34759FAMILY NOT NAMEDcoord: 53..369