Coiled-coil domain-containing protein 93

Overview
NameCoiled-coil domain-containing protein 93
Smed IDSMED30025543
Length (bp)1980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain-containing protein 93 (SMED30025543) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 93 (SMED30025543) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain-containing protein 93 (SMED30025543) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 93 (SMED30025543) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025543

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30025543h1SMcG0022196 Contig1890GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30025543h1SMcG0022196 Contig1890GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30025543h1SMcG0022196 dd_Smed_v4_2519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025543h1SMcG0022196 dd_Smed_v4_2519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025543h1SMcG0022196 dd_Smed_v4_2519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025543h1SMcG0022196 dd_Smed_v4_2519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025543h1SMcG0022196 dd_Smed_v4_2519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025543h1SMcG0022196 dd_Smed_v4_2519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30025543h1SMcG0022196 dd_Smed_v6_2519_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30025543h1SMcG0022196 dd_Smed_v6_2519_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025543h1SMcG0022196 dd_Smed_v6_2519_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Human
Match: CCDC93 (coiled-coil domain containing 93 [Source:HGNC Symbol;Acc:HGNC:25611])

HSP 1 Score: 315.079 bits (806), Expect = 6.062e-98
Identity = 206/622 (33.12%), Postives = 338/622 (54.34%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN-VSEEVSVMSTLLEYGRKEILGSISN------------ASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDY-EAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIK----------NRMKIKLVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDEEQVSA----------------LEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ ++D+DLLFQEN  IG+KIAL+EK+V VL +M CPH++EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + K K         +     V  L + Y P+RK+K+    +  + EE  + +TLLEYGR+      S             A  +A +++   +E ++ + E+   I  +  +M++   E +++T   V Q++     +++  + +Y E +S +  + SP+K+      TS L  +      K + +  QI    +++ E++          N  K  L EL  Y E  +      E I++  +   +++++ +V   + LK +EQ+ K+  ++E  +L +++  L  E  P  DE+ +S+                L+   N  K++L   RL  A + RE+  L   +D++PS+ E+ QYQKRF+EL  +IS    E KQ + +YN LD  K  L +E++LLNSIHENF +++ + +A++Q  +QM++    I+  +   E +K++ K  RDQ  ++Y  +++K R Y K  K  +E
Sbjct:   19 EDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKT-----YSLPEDDDFIKRK---------EKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYGRRYGFSRQSKMEKAEDKKTALPAGLSATEKADAHEEDELRAAEE-QRIQSLMTKMTAMANEESRLTASSVGQIVGLCSAEIKQIVSEYAEKQSELSAEESPEKL-----GTSQLHRR------KVISLNKQIAQKTKHLEELRASHTSLQARYNEAKKTLTELKTYSEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIENLKAERAPRGDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKE 614          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Human
Match: CCDC93 (coiled-coil domain containing 93 [Source:HGNC Symbol;Acc:HGNC:25611])

HSP 1 Score: 313.923 bits (803), Expect = 1.850e-97
Identity = 206/621 (33.17%), Postives = 338/621 (54.43%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN-VSEEVSVMSTLLEYGR-----------KEILGSISNASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDY-EAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIK----------NRMKIKLVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDEEQVSA----------------LEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ ++D+DLLFQEN  IG+KIAL+EK+V VL +M CPH++EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + K K         +     V  L + Y P+RK+K+    +  + EE  + +TLLEYGR            E   +   A  +A +++   +E ++ + E+   I  +  +M++   E +++T   V Q++     +++  + +Y E +S +  + SP+K+      TS L  +      K + +  QI    +++ E++          N  K  L EL  Y E  +      E I++  +   +++++ +V   + LK +EQ+ K+  ++E  +L +++  L  E  P  DE+ +S+                L+   N  K++L   RL  A + RE+  L   +D++PS+ E+ QYQKRF+EL  +IS    E KQ + +YN LD  K  L +E++LLNSIHENF +++ + +A++Q  +QM++    I+  +   E +K++ K  RDQ  ++Y  +++K R Y K  K  +E
Sbjct:   19 EDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKT-----YSLPEDDDFIKRK---------EKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYGRYGFSRQSKMEKAEDKKTALPAGLSATEKADAHEEDELRAAEE-QRIQSLMTKMTAMANEESRLTASSVGQIVGLCSAEIKQIVSEYAEKQSELSAEESPEKL-----GTSQLHRR------KVISLNKQIAQKTKHLEELRASHTSLQARYNEAKKTLTELKTYSEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIENLKAERAPRGDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKE 613          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Celegans
Match: C16A11.2 (pep chromosome:WBcel235:II:4238159:4244829:1 gene:WBGene00015815.1 transcript:C16A11.2a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C16A11.2)

HSP 1 Score: 97.8265 bits (242), Expect = 4.646e-21
Identity = 40/104 (38.46%), Postives = 69/104 (66.35%), Query Frame = 1
Query:  145 LQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCS-MNIDIDLLFQE--NWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQ 447
            + +L ++GY RAR+  L+ ++K+VGG+ W I  C  +++ +DLL++E  + NI  +   +EKL+  LK + CPH I  HQI G DF+ + +V+QWL++  L ++
Sbjct:   22 IAMLSASGYHRARVSCLNDYDKIVGGIVWAIMRCDDVDVAVDLLYEESEDQNIKLRTEQSEKLIEALKAVQCPHEIATHQISGLDFLALKNVIQWLLRHVLAQE 125          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Celegans
Match: C16A11.2 (pep chromosome:WBcel235:II:4238203:4244830:1 gene:WBGene00015815.1 transcript:C16A11.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C16A11.2)

HSP 1 Score: 97.8265 bits (242), Expect = 4.646e-21
Identity = 40/104 (38.46%), Postives = 69/104 (66.35%), Query Frame = 1
Query:  145 LQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCS-MNIDIDLLFQE--NWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQ 447
            + +L ++GY RAR+  L+ ++K+VGG+ W I  C  +++ +DLL++E  + NI  +   +EKL+  LK + CPH I  HQI G DF+ + +V+QWL++  L ++
Sbjct:   22 IAMLSASGYHRARVSCLNDYDKIVGGIVWAIMRCDDVDVAVDLLYEESEDQNIKLRTEQSEKLIEALKAVQCPHEIATHQISGLDFLALKNVIQWLLRHVLAQE 125          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Celegans
Match: C31E10.5 (pep chromosome:WBcel235:X:13991458:13995834:-1 gene:WBGene00007846.1 transcript:C31E10.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C31E10.5)

HSP 1 Score: 49.6766 bits (117), Expect = 5.925e-6
Identity = 27/98 (27.55%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  154 LVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENW---NIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTL 438
            LV AG    R+   S  N+++ G    ++G   N   + L   N    N   ++   +K+V +L  +NCP ++EPH +  +D+  +  ++ W+++QTL
Sbjct:   26 LVLAGCNLNRVTTHSLQNQIMRGTISALKGFQTNPKAEALKYRNVPSDNAKERMDQCKKVVEILVDVNCPFKVEPHHLIRTDYAMLTPMIIWVLRQTL 123          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Fly
Match: fidipidine (gene:FBgn0025519 transcript:FBtr0087185)

HSP 1 Score: 238.81 bits (608), Expect = 7.125e-70
Identity = 173/597 (28.98%), Postives = 314/597 (52.60%), Query Frame = 1
Query:   88 EVDSNATEDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIAC-QYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDEEQVS-----ALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKL 1860
            EV     ED++   KE  T  +LV+AGY+RARIKGLS F+KVVGGMTWCI+ C  ++D+DLLF E+ +IG+KIAL EK+V VL  M CPH +EPHQ+QG +F+ I+ V+QWLVK ++  + ER   +K  A  Q+ +    + D      ++  K ++ + +I  +QD           Y P+R++++  +  +  +   V  TLLEYG  +   +  +++    DR    ++ ++D  E +  +++I++  +   K           Q +++ + + +  LE       + +Q+  K+++  K A   ++ K+    +++ +++   N  +E   E+++++     EL  +++  +++         +E +Q ++   + LK+ E + K + + +          L+N    I+D E  S     A   +L   ++RL+  RL+LA + R +  +E  LD IP + E+ QYQ+RF EL+ E+S    E KQ Y +YN L+  K  + +E+ LLNSI E + E + +   +E   +Q +   + ++  +    ++  + +  RD+  EE  ++++  RQYA   K L    Q  E+L
Sbjct:   26 EVQVERREDSDATAKEQDTFDILVAAGYYRARIKGLSAFDKVVGGMTWCIECCDYDVDVDLLFHESLSIGQKIALVEKIVAVLIDMKCPHSLEPHQVQGLEFLAIHPVIQWLVKTSVENRAERGQRLKRFAIGQFHNHYQYKSD-----KDNLTKIRLASTNIKAIQDL----------YGPRRQYERQEAPDDDDDVSRVRLTLLEYG--DPGPTFRSSAERKADRGP-GEKDELDLEEYLRSLSLIKDDPTGTQKRID--LDPTARQELQQHYAEFK--LEMETDAQELKSQNQQKRLEAAKIA---MEHKIRRYCKENEQLQDAENEQKEKTKEVEDQLNTLNTELKAHKDTQDKADPKL-----LEKIQSLLQQHEELKKSEAEFKESCRTD----------LANLQLQIDDLESFSAQDAEAQAAALAGEEQRLKELRLQLAKRNRGIVAIERKLDAIPDRTELAQYQRRFHELHNEMSGKHLETKQYYTLYNTLNDKKRYMEKELALLNSICEAYNEGMMSPHGREDFIRQFESIVDGVKSAQDKVRHKYNEERMRRDELNEELQSLLELQRQYALAVKQLTRECQRCEQL 582          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Zebrafish
Match: ccdc93 (coiled-coil domain containing 93 [Source:ZFIN;Acc:ZDB-GENE-060421-8315])

HSP 1 Score: 315.464 bits (807), Expect = 3.321e-98
Identity = 207/615 (33.66%), Postives = 341/615 (55.45%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKK-PNSLKNVSEEVSVMSTLLEYGRKEIL--------------GSISNASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKL--LKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKLDQKCNELG 1884
            ED EQ  K    L+LL++AGYFRARIKGL+ F+KVVGG+TWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T         E+  +   K  +  IS +    NV E     Y PQR++K+  ++ + + EE  V STLLE+GR+                  S     G     + VS+E+ + + E+ + I  +   M++   E  K++   V  ++  +  +++    +Y  K+    +  P++    +     L    +++T+K+ E+E ++ S ++ +       KIKL E     E  E      E I++  + + ++ ++ +V   + LK +EQ  +S  ++E  +L + +  LKL + D+  + +E    +++     +++LQ  RL +A + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +EVNLLNSIH++F++++ +   KEQ  +QM++    I+  +   E ++++ K  RDQ  +EY  ++DK R Y K  K+ +E  +  E L  K    G
Sbjct:   33 EDEEQNVKLAEILELLLAAGYFRARIKGLTPFDKVVGGLTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVVQWLVKKAIETREEMGDYIRSYSISQFQKTHA-----FPEDEEFASKK--DRAISTV---VNVCE----VYAPQRRYKRQEDAGELLDEESRVHSTLLEFGRRYGFSKQSKSGTAVEQKQASAQGTQGAPPGMTQVSEEEDLQAAEE-LRIKALMTGMAAMATEEGKLSASTVGHIVGLQSEEIKQIATEYAEKAERSVEDRPERFGPVQQHRRQLASLNKQITQKTKELE-ELQSKQQEVRSACEDAKIKLAEATSQTEKLEKELSSLEDIESQADSVLLDKLRALVAMNENLKHQEQTFRSHCREEMTRLQQNIEELKLESGDDGDDKKEMNMLIDQQYTADREKLQKIRLLMARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEVNLLNSIHDHFQQAMASSGGKEQFLRQMEQIVEGIKQSRIKMEKKRQENKMRRDQLNDEYLELLDKQRLYFKTVKDFKEECRKNEMLLSKLRAKG 631          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Xenopus
Match: rasef (RAS and EF-hand domain containing [Source:Xenbase;Acc:XB-GENE-5734494])

HSP 1 Score: 182.956 bits (463), Expect = 1.125e-51
Identity = 116/301 (38.54%), Postives = 166/301 (55.15%), Query Frame = 1
Query:  145 LQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRV---DIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQR-KFKK-PNSLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQ----------EKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNA 1002
            L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ V+QWLVK+ +  + E    ++  +   F +        D ELR   +          +  L +  +V       Y P+R K+K+   S + + EE  V STLLEYGR+  L            R  V Q          E++    E+ + I  +  +M++   E  ++T   V Q++  +  +++  + +Y  K + L  S+  + +Y   A
Sbjct:    1 LELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVIQWLVKRAIETRQEMGDYIRSYSVSQFHKEHSLPEDQDFELRREKT----------VRTLSETLDV-------YRPRRKKYKRQGGSSELMDEESRVHSTLLEYGRRYGLSKQMKPEKPEDRRVPVPQGLVGKGEVREEEEELRAEEELRIKALMTEMAATGMEEGRLTASTVGQIVGLQSKEIKQMVSEYAEKQSEL--SAEDRAEYLGAA 282          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Mouse
Match: Ccdc93 (coiled-coil domain containing 93 [Source:MGI Symbol;Acc:MGI:1918079])

HSP 1 Score: 315.464 bits (807), Expect = 2.633e-98
Identity = 208/614 (33.88%), Postives = 340/614 (55.37%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNVSEEVS-VMSTLLEYGRKEILGSISN-----------ASG-NAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILT-QSSPKKVDYWKNATSNL-QLKLEEVTEKSLEVETQINSVRENISEIKNRM---KIKLVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEP----IEDEEQVSALEESL----------NNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  CS ++D+DLLFQEN  IG+KIAL+EK+V VL +M CPH++EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + K K               V  L  AY P+RK+++    + + +E S V STLLEYGR+      S            A+G +A ++    +E ++ + E+   I  +  +M++   E +++T   V Q++     +++  + +Y  K + L+ + SP+K+      TS L Q K+  + ++ L+    +  ++ N + +K +    K  L EL ++ E  +      E ++   +   +++++ +V   + LK +EQ+ K+  ++E  +L +++  L  E  P    I   E   AL  ++          N  K++L   RL  A + RE+  L   +D++PS+ E+ QYQKRF+EL  +IS    E KQ + +YN LD  K  L +E++LLNSIHENF +++ + +A++Q  +QM++    I+  +   E +K++ K  RDQ  ++Y  +++K R Y K  K  +E
Sbjct:   19 EDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCSFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSISQFQKT-----YSLPEDDDFIKRK---------DKAVKTVVGLSDAYKPRRKYRRQRGAEELPDEESRVHSTLLEYGRRYGFSRQSKTEKAEDKKTALAAGLSAAEKVDAHEEDELQAAEE--RIQSLMTKMTAMANEESRLTASSVGQIVGLCSEEIKQIVSEYAGKQSELSAEESPEKL-----GTSQLHQRKVISLNKQILQKSKHLEELQANHTSLKAKYSDRKKTLTELKDHGEKLDKEQAALEKLEAKADPSMLQNLRALVAMNESLKSQEQEFKAHCREEMARLQQEIETLKAERAPGEKIISGGEPQGALTSTMTHNEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKE 611          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Mouse
Match: Ccdc93 (coiled-coil domain containing 93 [Source:MGI Symbol;Acc:MGI:1918079])

HSP 1 Score: 314.694 bits (805), Expect = 5.846e-98
Identity = 208/614 (33.88%), Postives = 340/614 (55.37%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNVSEEVS-VMSTLLEYGRKEILGSISN-----------ASG-NAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILT-QSSPKKVDYWKNATSNL-QLKLEEVTEKSLEVETQINSVRENISEIKNRM---KIKLVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEP----IEDEEQVSALEESL----------NNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  CS ++D+DLLFQEN  IG+KIAL+EK+V VL +M CPH++EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + K K               V  L  AY P+RK+++    + + +E S V STLLEYGR+      S            A+G +A ++    +E ++ + E+   I  +  +M++   E +++T   V Q++     +++  + +Y  K + L+ + SP+K+      TS L Q K+  + ++ L+    +  ++ N + +K +    K  L EL ++ E  +      E ++   +   +++++ +V   + LK +EQ+ K+  ++E  +L +++  L  E  P    I   E   AL  ++          N  K++L   RL  A + RE+  L   +D++PS+ E+ QYQKRF+EL  +IS    E KQ + +YN LD  K  L +E++LLNSIHENF +++ + +A++Q  +QM++    I+  +   E +K++ K  RDQ  ++Y  +++K R Y K  K  +E
Sbjct:   19 EDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCSFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSISQFQKT-----YSLPEDDDFIKRK---------DKAVKTVVGLSDAYKPRRKYRRQRGAEELPDEESRVHSTLLEYGRRYGFSRQSKTEKAEDKKTALAAGLSAAEKVDAHEEDELQAAEE-QRIQSLMTKMTAMANEESRLTASSVGQIVGLCSEEIKQIVSEYAGKQSELSAEESPEKL-----GTSQLHQRKVISLNKQILQKSKHLEELQANHTSLKAKYSDRKKTLTELKDHGEKLDKEQAALEKLEAKADPSMLQNLRALVAMNESLKSQEQEFKAHCREEMARLQQEIETLKAERAPGEKIISGGEPQGALTSTMTHNEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKE 612          
BLAST of Coiled-coil domain-containing protein 93 vs. UniProt/SwissProt
Match: sp|Q640U7|CCD93_XENTR (Coiled-coil domain-containing protein 93 OS=Xenopus tropicalis OX=8364 GN=ccdc93 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.181e-101
Identity = 214/602 (35.55%), Postives = 334/602 (55.48%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRV---DIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKK-PNSLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQ----------EKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILT-----------QSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKL-SNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ V+QWLVK+ +  + E    ++  +   F +        D ELR   +          +  L +  +V       Y P+RK+K+   S + + EE  V STLLEYGR+  L            R  V Q          E++    E+ + I  +  +M++   E  ++T   V Q++  +  +++  + +Y  K + L+           Q   +KV          +  L+++ EK+ E+++     R+ ++E+ + M+ KL +     EN E   K  P    ++ ++++V   + LK +EQQ +S  ++E  +L + +  L +   E  E++EQ  A E+     +++LQ  RL LA + RE+  L+  +D++PS+ E+ QYQKRF+EL  ++S    E KQ + +YN LD  K  L +EVNLLNSIH+NF++++ + SA++Q  +QM++  + IR  +   E +K++ K  RDQ  +EY  +++K R Y K  K  +E
Sbjct:   14 EDEEQGVKLAEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVIQWLVKRAIETRQEMGDYIRSYSVSQFHKEHSLPEDQDFELRREKT----------VRTLSETLDV-------YRPRRKYKRQGGSSELMDEESRVHSTLLEYGRRYGLSKQMKPEKPEDRRVPVPQGLVGKGEVREEEEELRAEEELRIKALMTEMAATGMEEGRLTASTVGQIVGLQSKEIKQMVSEYAEKQSELSAEDRAEYLGAAQQHRRKVASLSKLIGQRKKLLDQLQEKASELQSGCGETRKQLTEVTSHME-KLDQELSVLENMES--KADPS--VLQKLRDLVAQNESLKAQEQQFRSKCREEMSRLQQNIDGLKAAATEHGEEKEQTQAFEQQYKAEREKLQKIRLLLARRNREIAILQRKIDEVPSRAELTQYQKRFIELYGQVSATHKETKQFFTLYNTLDDKKVYLEKEVNLLNSIHDNFQQAMASPSARDQFLRQMEQIVDGIRQSRNKMEKKKQENKMKRDQLNDEYLELLEKQRLYFKTVKEFKE 593          
BLAST of Coiled-coil domain-containing protein 93 vs. UniProt/SwissProt
Match: sp|Q6GQI5|CCD93_XENLA (Coiled-coil domain-containing protein 93 OS=Xenopus laevis OX=8355 GN=ccdc93 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.008e-99
Identity = 209/604 (34.60%), Postives = 341/604 (56.46%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKK-PNSLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQ---------EKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKN---RMKIKLVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKL-SNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKL 1860
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ V+QWLVK+ +  + E    ++  +   F +     +  L E+  ++  +     +  L +  +V       Y P+RK+K+   S + + EE  V STLLEYGR+  L            +  V Q         E++    E+ + I  +  +M++   E  ++T   V Q++  +  +++  + +Y  K + L  S+  + +Y   A    + K+  + ++  + +  ++ ++E  SE+++     K +L E+  + EN E      E +++  +   ++ ++++V   + LK +EQQ +S  ++E  +L + +  L +   E  E++EQ  A E+     K++LQ  RL LA + RE+  L   +D++PS+ E+ QYQKRF+EL  ++S    E KQ + +YN LD  K  L +EVNLLNS+H+NF++++ + S ++Q  +QM++  + IR  +   E +K++ K  RDQ  +EY  +++K R Y K  K  +E  +  E L
Sbjct:   14 EDEEQSVKLAEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVIQWLVKRAIETRQEMGDYIRSYSVSQFQK-----EHSLPEDQEFEHRR--EKAVRTLSETLDV-------YRPRRKYKRQGGSAELMDEESRVHSTLLEYGRRYGLSKQMKPEKPEDRKVPVPQGLVGKGEVKEEEELRAEEELRIKALMTEMAAMGMEEGRLTASTVGQIVGLQSDEIKQMVSEYAEKQSEL--SAEDRPEYL-GAAQQHRRKVASLNKQIGQRKKLLDQLQEKASELQSGSCEAKKQLTEVTSHMENLEQELLVLEKVESKADPSVLQKLRDLVAQNESLKLQEQQFRSKCREEMSRLQQNIDSLKAAATEHGEEKEQSQAFEQQYKAEKEKLQKIRLLLARRNREIAILHRKIDEVPSRAELTQYQKRFIELYGQVSATHKETKQFFTLYNTLDDKKVYLEKEVNLLNSVHDNFQQAMASPSVRDQFLRQMEQIVDGIRQSRNKMEKKKQENKMKRDQLNDEYLELLEKQRLYFKTVKEFREECRRNETL 600          
BLAST of Coiled-coil domain-containing protein 93 vs. UniProt/SwissProt
Match: sp|Q5ZKI4|CCD93_CHICK (Coiled-coil domain-containing protein 93 OS=Gallus gallus OX=9031 GN=CCDC93 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.195e-97
Identity = 209/605 (34.55%), Postives = 344/605 (56.86%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNV-SEEVSVMSTLLEYGRKEILG------------SISNASG-NAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDY-EAKSTILTQSSPKKVDYW-----KNATSNLQL-----KLEEVTEKSLEVETQINSVRENISEIKN---RMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDEEQVSAL-EESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ +IDIDLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T +     L E++ + + K        ++  T++ E     Y PQRK+K+    + +  EE  V +TLLEYGR+                 I   SG  A  ++    E  + + E+ + I  +   M++   E  K+T   V Q++  +  +++  + +Y E +S +  +  P+++        K A+ N Q+      LEE+  K ++++ +    ++ ++E+++   ++  +L  L        E+I++  +   +++++ +V   + LK +EQ+ K+  ++E  +L + +  L  E     +EE+ + L ++     K++LQ  RL LA + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +EVNLLNSIH+NF +++ +  ++EQ  +QM++    I+  +   E +K++ K  RDQ  +EY  +++K R Y K  K  +E
Sbjct:   19 EDEEQNIKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDIDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVVQWLVKRAIETREEMGDYIRSYSISQFQKTHR-----LPEDDEFMQRK-----EKAIKTVTDIFE----VYKPQRKYKRQKGAEEILDEESKVHATLLEYGRRYGFSRQAGKTEQTEDKKIVLPSGLAAAGKAEPCDEDDLRAAEE-LRIKTLMTGMAAMATEEGKLTASTVGQIVGLQSDEIKQIVSEYAEKQSELSAEERPERLGAAQQHRRKVASLNKQILQKTKLLEELQAKFVDLQAKCTEAKKTLTEVESYSEKLDKELAAL--------ETIESQADSSVLQNLRMLVAINENLKSQEQEFKAHCREEMERLQQDIENLKAEAAENGEEEEPNKLIDQQYQTEKEKLQKIRLLLARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEVNLLNSIHDNFHQAMASSGSREQFLRQMEQIVEGIKQNRMKMEKKKQENKMRRDQLNDEYLELLEKQRLYFKTVKEFKE 600          
BLAST of Coiled-coil domain-containing protein 93 vs. UniProt/SwissProt
Match: sp|Q5BJT7|CCD93_RAT (Coiled-coil domain-containing protein 93 OS=Rattus norvegicus OX=10116 GN=Ccdc93 PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.169e-97
Identity = 208/614 (33.88%), Postives = 340/614 (55.37%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN-VSEEVSVMSTLLEYGRKEILGSISN-----------ASG-NAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILT-QSSPKKVDYWKNATSNL-QLKLEEVTEKSLEVETQINSVRENISEIKNRMKIK---LVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEP----IEDEEQVSALEESL----------NNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  CS ++D+DLLFQEN  IG+KIAL+EK+V VL +M CPH++EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + K K               V  L  AY P+RK+++    +  + EE  V STLLEYGR+      S            A+G +A +++   +E ++ + E+   I  +  +M++   E +++T   V Q++     +++  + +YE K + L+ + SP+K+      TS L Q K+  + ++ L+    +  ++ N + ++ +   K   L EL  + E  +      E ++   +   +++++ +V   + LK +EQ+ K+  ++E  +L +++  L  E  P    I   E   AL  ++          N  K++L   RL  A + RE+  L   +D++PS+ E+ QYQKRF+EL  +IS    E KQ + +YN LD  K  L +E++LLNSIHENF +++ + +A++Q  +QM++    I+  +   E +K++ K  RDQ  ++Y  +++K R Y K  K  +E
Sbjct:   19 EDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCSFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSISQFQKT-----YSLPEDDDFIKRK---------DKAIQTVVDLSDAYKPRRKYRRQQGAEELLDEESRVHSTLLEYGRRHGFSRQSKTEKAEDKKTALAAGLSAAEKTDAHEEDELQAAEE-QRIQSLMTKMTAMANEESRLTASSVGQIVGLCSAEIKQIVSEYEGKQSELSAEESPEKL-----GTSQLHQRKVISLNKQILQKTKHLEELQANHTSLQAKYSDKKKTLTELKNHGEKLDQEQAALEKLEAKADPSILQNLRALVAMNESLKSQEQEFKAHCREEMARLQQEIEILKAERAPGEKTISSGEPQGALTSTMTHNEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKE 612          
BLAST of Coiled-coil domain-containing protein 93 vs. UniProt/SwissProt
Match: sp|Q567U6|CCD93_HUMAN (Coiled-coil domain-containing protein 93 OS=Homo sapiens OX=9606 GN=CCDC93 PE=1 SV=2)

HSP 1 Score: 315.079 bits (806), Expect = 2.911e-97
Identity = 206/622 (33.12%), Postives = 338/622 (54.34%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN-VSEEVSVMSTLLEYGRKEILGSISN------------ASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDY-EAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIK----------NRMKIKLVELNEYRENFE------ESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDEEQVSA----------------LEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ ++D+DLLFQEN  IG+KIAL+EK+V VL +M CPH++EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + K K         +     V  L + Y P+RK+K+    +  + EE  + +TLLEYGR+      S             A  +A +++   +E ++ + E+   I  +  +M++   E +++T   V Q++     +++  + +Y E +S +  + SP+K+      TS L  +      K + +  QI    +++ E++          N  K  L EL  Y E  +      E I++  +   +++++ +V   + LK +EQ+ K+  ++E  +L +++  L  E  P  DE+ +S+                L+   N  K++L   RL  A + RE+  L   +D++PS+ E+ QYQKRF+EL  +IS    E KQ + +YN LD  K  L +E++LLNSIHENF +++ + +A++Q  +QM++    I+  +   E +K++ K  RDQ  ++Y  +++K R Y K  K  +E
Sbjct:   19 EDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKT-----YSLPEDDDFIKRK---------EKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYGRRYGFSRQSKMEKAEDKKTALPAGLSATEKADAHEEDELRAAEE-QRIQSLMTKMTAMANEESRLTASSVGQIVGLCSAEIKQIVSEYAEKQSELSAEESPEKL-----GTSQLHRR------KVISLNKQIAQKTKHLEELRASHTSLQARYNEAKKTLTELKTYSEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIENLKAERAPRGDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKE 614          
BLAST of Coiled-coil domain-containing protein 93 vs. TrEMBL
Match: K1RNC6 (Coiled-coil domain-containing protein 93 OS=Crassostrea gigas OX=29159 GN=CGI_10015539 PE=4 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 9.370e-103
Identity = 225/619 (36.35%), Postives = 351/619 (56.70%), Query Frame = 1
Query:   88 EVDSNATEDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPN--SLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVS----------QEKQVDSLEDVVDINVIQNQMSSQVK-ETTKMTGKLVSQLMERKFGDVRDALEDYEAKST------------------ILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKL--LKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNG---ENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            E++ +  ED EQ  K   T+ LL++AGYFRARIKGLS F+KVVGGMTWCI  C+++ID+DLLFQEN  IG+KIALTE++V VL KM CPHRIEPHQIQG DFIHIY  VQWLVK+ +  ++E    ++  +   F +T K     + E+  +++ K         +  TN V  +++ Y PQR++K+ N  SLK+  EE  V STLLEYGR+  L S S+ S   GD+S+            QE   + L+   +   IQ  MS     +  K++   V  ++  K  +++     YE K +                   +T +  K++    +    +Q K +++ +  LE + ++  VR     I   M +KL E+ E  EN          +  +++++ +V   + LK++EQ  K+  K+E  +L  ++  LK   ++E  ED+ + S +++     +++L   RL LA KTRE+  L+  +DD+PS+ E+ QYQ+RF+EL  +++   +E KQ Y +YN LD  K  L++EV+LLNSIH+NF++++ N  AKEQ  +Q +   N + G+K+N    E +K++ K  RDQ  ++Y  +V+K R Y K  K+ +E
Sbjct:   29 EIEFDVREDEEQNVKLGQTIDLLLAAGYFRARIKGLSPFDKVVGGMTWCITTCNIDIDVDLLFQENSTIGQKIALTERIVAVLPKMKCPHRIEPHQIQGLDFIHIYPAVQWLVKKAIETREEMGDFIRAFSISQFSKTHK-----MPEDVVFEEMK---------EKATNSVSEVKEVYKPQRRYKRQNVDSLKD--EETRVHSTLLEYGRRYGL-SKSDTSEQDGDKSAKKKAAAASLGGQQEMTPEQLQ-AEEEKKIQKLMSGMAGFQEDKLSASAVGSIVGMKSEEIQQIASHYEEKKSEIEQIEKSERVGGTQHHKRMTAALSKQIQQQTDKLQQIQAKHDDLHKVYLETQEKLKQVRHRSGRIDEEM-LKLTEI-ETEEN----------QGVLQNLRSLVAMNENLKKQEQDFKAHCKEEMARLKAQIEELKEGAQEEDSEDKARASLIDKQYEADREKLHKIRLLLARKTREIAVLQRKIDDVPSRAELSQYQRRFIELYNQVAATHTETKQFYTLYNTLDDTKMYLNKEVSLLNSIHDNFRQAMANPGAKEQFLKQFE---NIVEGIKQNKAKLEKRKQEEKMKRDQFNDQYLDLVEKQRLYFKTVKDFKE 614          
BLAST of Coiled-coil domain-containing protein 93 vs. TrEMBL
Match: F6TUC2 (Coiled-coil domain containing 93 OS=Monodelphis domestica OX=13616 GN=CCDC93 PE=4 SV=3)

HSP 1 Score: 334.724 bits (857), Expect = 2.072e-102
Identity = 211/602 (35.05%), Postives = 352/602 (58.47%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN-VSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQ-----------EKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYW-----KNATSNLQLK-----LEEVTEKSLEVETQINSVRENISEIKN---RMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKL-SNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL +M CPHR+EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + + K     I  + D  +V       Y P+RK+++    +  + EE  V +TLLEYGR+  L S  + +  A D+ +V             E ++ + E+   I  +  +M++   + +++T   V Q++  +  +++  + +Y  KS +L +SSP+K+        K A+ N Q++     LEE+  K  +++T+ +  +  +SE+K+   ++  +L  L +     + SI        +++++ +V   + LK +EQ+ K+  ++E  +L + +  L ++  E  E++E    +E+     K++LQ  RL LA + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +E++LLNSIHENF++++ + +A++Q  +QM++  + I+  +   E +K++ K  RDQ  +EY  +++K R Y K  K  +E
Sbjct:   19 EDEEQNIKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPRMKCPHRLEPHQIQGLDFIHIFPVVQWLVKRAIETREEMGDYIRSYSISQFQKT-----YSLPEDDDFLQRK--EKSIKTVIDIFDV-------YKPRRKYRRQKGAEELLDEESRVHTTLLEYGRRYGL-SRQDKTEKAEDKKTVLSSGFSGSGKSLDEDELQAAEE-RHIETLMTKMAAMATDESRLTASTVGQIVGLRSEEIKQIVSEYAEKSELLAESSPEKLGVAQQHRRKVASLNKQIQQKTKLLEELQAKCADLQTKYDEAKTKLSEVKSYSEKLDQELAALEKIEAQADPSI--------LQNLRALVAMNENLKSQEQEFKAHCREEMSRLQQNIENLKADASEDGEEKEPTRIIEQQYKTEKEKLQKIRLLLARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFQQAMASTAARDQFLRQMEQIVDGIKQNRMKLEKKKQENKMRRDQLNDEYLELLEKQRLYFKTVKEFKE 596          
BLAST of Coiled-coil domain-containing protein 93 vs. TrEMBL
Match: A0A3Q2ZKX5 (Coiled-coil domain containing 93 OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 6.795e-102
Identity = 223/626 (35.62%), Postives = 354/626 (56.55%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKK-PNSLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQEKQV-----------DSLEDVVDINV--IQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILT------QSSPKKVDYWKNATSNLQL-----KLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIK-------IEDVQEMVTTLDRLKEEEQQLKSTYKKE--DVQLNEKLLKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKLDQKCNELG 1884
            ED EQ  K    L+LL++AGYFRARIKGLS F+KVVGGMTWCI  CS ++D+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ V+QWLVK+ +  ++E    ++  +   F ++       L E+  + + K         +    V++ LE  Y PQR++++  ++ + + EE  V STLLEYGR+    + S      G +SS+++  QV           D L+   +I +  +   M++   E  K+T   V  ++  +  +++    +Y  K + LT      +  P +      A+ N Q+     +LEE+  K  EV+T                K KL+E  E  E  E+ +K+  E+++       +E ++ +VT  + LK++EQ+ +S  K+E   +QLN + LK  +  E  E++E+   +E+  ++ +++LQ  RL +A + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +EVNLLNS+H+NF++++ + +AKEQ  +QM++    I+  +   E +K++ K  RDQ  +EY  ++DK R Y K  K+ +E  +  E L  K    G
Sbjct:   34 EDEEQNVKLTEILELLLAAGYFRARIKGLSPFDKVVGGMTWCITTCSFDVDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVIQWLVKRAIETREEMGDYVRSYSISQFQKSHS-----LPEDEEFLQRKG--------KAVRAVLDVLE-VYKPQRRYRRQKDAGQLLDEESRVHSTLLEYGRRYGFCNQSKQDKVDGGKSSLARGSQVAPPGTAEGSEEDDLQAAEEIRIKSLMTSMAAMANEEGKLTASAVGHIVGLQSEEIKQIASEYAEKQSELTSEERSERYGPLQQHRRAVASINKQIQQKTKQLEELRAKHEEVKTGCEDA-----------KRKLMEATEQSEKLEKELKSL-EDMEDQVDSSLLEKLRSLVTMSENLKQQEQEFRSHCKEEMSRLQLNIEELKSVSGQETEEEKERSQLIEKQYDSDREKLQKIRLLMARRNREIAILQRRIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEVNLLNSVHDNFQQAMSSAAAKEQFLRQMEQIVEGIKQSRIKMEKKKQENKMRRDQLNDEYLELLDKQRLYFKTVKDFKEECRRNEMLLSKLRAKG 633          
BLAST of Coiled-coil domain-containing protein 93 vs. TrEMBL
Match: A0A4X2L0D4 (KOG2701 domain-containing protein OS=Vombatus ursinus OX=29139 GN=CCDC93 PE=4 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.328e-101
Identity = 212/603 (35.16%), Postives = 350/603 (58.04%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN-VSEEVSVMSTLLEYGRKEILGSISN-----------ASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDY-EAKSTILTQSSPKKVDYW-----KNATSNLQLK-----LEEVTEKSLEVETQINSVRENISEIKN---RMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDEEQVS-ALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL +M CPHR+EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +T       L E++ + + K     I  + D  +V       Y P+RK+++    +  + EE  V +TLLEYGR+  L   S             SG +G   S+  E ++ + E+   I  +  +M++   E +++T   V Q++  +  +++  + +Y E +S +L +SSP+K+        K A+ N Q++     LEE+  K  +++ + +  +  +SE+K+   ++  +L  L +     + SI        +++++ +V   + LK +EQ+ K+  ++E  +L + +  L  E     DE++ +  +E+     K++LQ  RL LA + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +E++LLNSIHENF++++ + +A++Q  +QM++  + I+  +   E +K++ K  RDQ  +EY  +++K R Y K  K  +E
Sbjct:   19 EDEEQNIKLAEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPRMKCPHRLEPHQIQGLDFIHIFPVVQWLVKRAIETREEMGDYIRSYSISQFQKT-----YSLPEDDDFLQRK--EKSIKTVTDIFDV-------YKPRRKYRRQKGAEELLDEESRVHTTLLEYGRRYGLSRQSKTEKTEDKKMVLPSGFSGSGKSLD-EDELQAAEE-CHIETLMTKMAAMATEESRLTASAVGQIVGLRSEEIKQIVSEYAEKQSELLAESSPEKLGVTQQHRRKVASLNKQIQQKTKLLEELQAKCTDLQAKYDEAKTKLSEVKSYSEKLDQELAALEKIESQADPSI--------LQNLRALVAMNENLKSQEQEFKAHCREEMARLQQNIENLKAEASEDGDEKEPNRIIEQQYKIEKEKLQKIRLLLARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFQQAMASSAARDQFLRQMEQIVDGIKQNRMKLEKKKQENKMRRDQLNDEYLELLEKQRLYFKTVKEFKE 597          
BLAST of Coiled-coil domain-containing protein 93 vs. TrEMBL
Match: G3X323 (Coiled-coil domain containing 93 OS=Sarcophilus harrisii OX=9305 GN=CCDC93 PE=4 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 6.194e-101
Identity = 211/603 (34.99%), Postives = 346/603 (57.38%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN-VSEEVSVMSTLLEYGRKEILGSISN-----------ASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDY-EAKSTILTQSSPKKVDYW-----KNATSNLQLK-----LEEVTEKSLEVETQINSVRENISEIKN---RMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDE-EQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL +M CPHR+EPHQIQG DFIHI+ VVQWLVK+ +  ++E    ++  +   F +        L E+N + + K     I  + D  +V       Y P+RK+++    +  + EE  V +TLLEYGR+  L   S             SG +G   S+  E ++ + E+   I  +  +M++   E +++T   V Q++  +  +++  + +Y E +S +L + SP+K+        K A+ N Q++     LEE+  K  +++ + +  +  +SE+K+   ++  +L  L +     + SI        +++++ +V   + LK +EQ+ K+  ++E  +L + +  L  E     DE E    +++     K++LQ  RL LA + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +E++LLNSIHENF++++ + +A++Q  +QM++  + I+  +   E +K++ K  RDQ  +EY  +++K R Y K  K  +E
Sbjct:   19 EDEEQNIKLAEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPRMKCPHRLEPHQIQGLDFIHIFPVVQWLVKRAIETREEMGDYIRSYSVSQFQKI-----YSLPEDNDFLQRK--EKSIKTVTDIFDV-------YKPRRKYRRQKGAEELLDEESRVHTTLLEYGRRYGLSRQSKTEKTEDKKVVLPSGFSGSGKSLD-EDELQAAEE-RHIETLMTKMAAMATEESRLTASAVGQIVGLRSEEIKQIVSEYAEKQSELLAEPSPEKLGVTQQHRRKIASLNKQIQQKTKLLEELQAKCADLQVKYDEAKTKLSEVKSYSEKLDQELAALEKIESQADPSI--------LQNLRTLVAMNENLKSQEQEFKAHCREEMTRLQQNIESLKAETSEDGDEKEPTRVIDQQHKTEKEKLQKIRLLLARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFQQAMASSAARDQFLRQMEQIVDGIKQNRMKLEKKKQENKMRRDQLNDEYLELLEKQRLYFKTVKEFKE 597          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Cavefish
Match: ccdc93 (coiled-coil domain containing 93 [Source:NCBI gene;Acc:103043896])

HSP 1 Score: 317.39 bits (812), Expect = 5.583e-99
Identity = 212/622 (34.08%), Postives = 351/622 (56.43%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKK-PNSLKNVSEEVSVMSTLLEYGR----------------KEIL--GSISNASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKK---VDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPE-EIK-----IEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKL--LKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKLDQKCNELG 1884
            ED EQ  K    L+LL++AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ V+QWLVK+ +  ++E    ++  +   F +T         E+  + + K         Q   + V  + + Y PQR++++  ++ + + EE  V STLLEYGR                K++L  G+ S   G A     VS+E+ + + E+ + I  +   M++   E  ++T   V Q++  +  +++    +Y  K+    +  P++   V   +   ++L  ++++ T++  E++ +   VR    E K+    KL E  +  E  E  + +  + E +     +E ++ +V   + LK++EQ+ ++  ++E  +L + +  LK+   DE  + +E+   +++  N  +++LQ  RL +A + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +EVNLLNSIH+NF++++ +  AKEQ  +QM++    I+  +   E +K++ K  RDQ  ++Y  ++DK R Y K  K+ +E  +  E L  K    G
Sbjct:   33 EDEEQSIKLAEILELLLAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVIQWLVKRAIETREEMGDYVRAYSISQFQKTHT-----FPEDEEFKQRK---------QKAVSTVVEVSEVYAPQRRYRRQADAGELLDEESRVHSTLLEYGRRYGFSKHSKQDKAEEKKQLLAQGAQSVPPGMA----EVSEEEDLQAAEE-LRIKTLMTGMAAMATEEGRLTASTVGQIVGLQSEEIKQIAFEYAEKAERSAEDRPERYGPVQQHRRMVASLNKQIQQRTKELEEMQAKQQEVRTACEEAKS----KLTEATDLGERLERELSSLADVEAQADSGLLEKLRALVAMNENLKQQEQEFRTHCREEMTRLQQSIEDLKIEFGDEADDQKERSQLIDQQYNTDREKLQKIRLLMARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEVNLLNSIHDNFQQAMASSGAKEQFLRQMEQIVEGIKQNRIKMEKKKQENKMRRDQLNDDYLELLDKQRLYFKTVKDFKEECRKNEMLLSKLRAKG 631          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Cavefish
Match: ccdc93 (coiled-coil domain containing 93 [Source:NCBI gene;Acc:103043896])

HSP 1 Score: 311.997 bits (798), Expect = 8.008e-97
Identity = 207/616 (33.60%), Postives = 346/616 (56.17%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKK-PNSLKNVSEEVSVMSTLLEYG--------------------------RKEIL--GSISNASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKK---VDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPE-EIK-----IEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKL--LKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LL++AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ V+QWLVK+ +  ++E    ++  +   F +T         E+  + + K         Q   + V  + + Y PQR++++  ++ + + EE  V STLLEYG                          +K++L  G+ S   G A     VS+E+ + + E+ + I  +   M++   E  ++T   V Q++  +  +++    +Y  K+    +  P++   V   +   ++L  ++++ T++  E++ +   VR    E K+    KL E  +  E  E  + +  + E +     +E ++ +V   + LK++EQ+ ++  ++E  +L + +  LK+   DE  + +E+   +++  N  +++LQ  RL +A + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +EVNLLNSIH+NF++++ +  AKEQ  +QM++    I+  +   E +K++ K  RDQ  ++Y  ++DK R Y K  K+ +E
Sbjct:   33 EDEEQSIKLAEILELLLAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVIQWLVKRAIETREEMGDYVRAYSISQFQKTHT-----FPEDEEFKQRK---------QKAVSTVVEVSEVYAPQRRYRRQADAGELLDEESRVHSTLLEYGSPCLTISFYMQRYGFSKHSKQDKAEEKKQLLAQGAQSVPPGMA----EVSEEEDLQAAEE-LRIKTLMTGMAAMATEEGRLTASTVGQIVGLQSEEIKQIAFEYAEKAERSAEDRPERYGPVQQHRRMVASLNKQIQQRTKELEEMQAKQQEVRTACEEAKS----KLTEATDLGERLERELSSLADVEAQADSGLLEKLRALVAMNENLKQQEQEFRTHCREEMTRLQQSIEDLKIEFGDEADDQKERSQLIDQQYNTDREKLQKIRLLMARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEVNLLNSIHDNFQQAMASSGAKEQFLRQMEQIVEGIKQNRIKMEKKKQENKMRRDQLNDDYLELLDKQRLYFKTVKDFKE 625          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Cavefish
Match: ccdc93 (coiled-coil domain containing 93 [Source:NCBI gene;Acc:103043896])

HSP 1 Score: 259.225 bits (661), Expect = 2.090e-77
Identity = 185/613 (30.18%), Postives = 313/613 (51.06%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKK-PNSLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKK---VDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNY------PEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKL--LKLSNEDEPIEDE--------------------EQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSRE-----VNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LL++AGYFRARIKGLS F+KVVGGMTWCI  C+ +ID+DLLFQEN  IG+KIALTEK+V VL KM CPHR+EPHQIQG DFIHI+ V+QWLVK+ +  ++E    ++  +   F +T         E+  + + K         Q   + V  + + Y PQR++++  ++ + + EE  V STLLEYGR                                  I  +   M++   E  ++T   V Q++  +  +++    +Y  K+    +  P++   V   +   ++L  ++++ T K LE             E++  + + L + ++Y +  E  + +        +   +E ++ +V   + LK++EQ+ ++  ++E  +L + +  LK+   DE  + +                    E+   +++  N  +++LQ  RL +A + RE+  L+  +D++PS+ E+ QYQKRF+EL +++S    E KQ + +YN LD  K  L +E     + L+         ++ +  AKEQ  +QM++    I+  +   E +K++ K  RDQ  ++Y  ++DK R Y K  K+ +E
Sbjct:   30 EDEEQSIKLAEILELLLAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDIDVDLLFQENSTIGQKIALTEKIVSVLPKMKCPHRLEPHQIQGLDFIHIFPVIQWLVKRAIETREEMGDYVRAYSISQFQKTHT-----FPEDEEFKQRK---------QKAVSTVVEVSEVYAPQRRYRRQADAGELLDEESRVHSTLLEYGR----------------------------------IKTLMTGMAAMATEEGRLTASTVGQIVGLQSEEIKQIAFEYAEKAERSAEDRPERYGPVQQHRRMVASLNKQIQQRT-KELE-------------EVRPALSLHLFKQDQYADRLERELSSLADVEAQADSGLLEKLRALVAMNENLKQQEQEFRTHCREEMTRLQQSIEDLKIEFGDEADDQKVLKSLPLLHILHTWCSTVHNERSQLIDQQYNTDREKLQKIRLLMARRNREIAILQRKIDEVPSRAELTQYQKRFIELYSQVSATHKETKQFFTLYNTLDDKKVYLEKEYILLKLRLMFCFCVYINRAMASSGAKEQFLRQMEQIVEGIKQNRIKMEKKKQENKMRRDQLNDDYLELLDKQRLYFKTVKDFKE 580          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Sea Lamprey
Match: ccdc93 (coiled-coil domain containing 93 [Source:ZFIN;Acc:ZDB-GENE-060421-8315])

HSP 1 Score: 322.013 bits (824), Expect = 9.375e-102
Identity = 200/604 (33.11%), Postives = 336/604 (55.63%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKA--YFPQRKFKK---PNSLKNVSEEVSVMSTLLEYGRKEILGSISN----------ASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILT-----------QSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKL--LKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K    L+LLV+AGYFRARIKGLS+F+KVVGGMTWCI  CS++ID+DLLFQEN  IG+KIALTEK+V VL  M CPHRIEPHQIQG DFIHI+ V+QWLVK+ +  ++E    ++  +   F+++ +     L E++ + + K              ++  L  A  Y PQR++++    +SL  + EE  V STLLEYGR+       N              A  ++  ++E+++ +  D + I  + + M++   E  ++T   V Q++  +  +++    +Y  K + L            Q   + V       S  +++LEE+  K  E++    + +E + E++ + +I   E+ +      +S+++  +   ++ ++ +V   + LK +E + ++  K+E  +L   +  LKL   +   E+ EQ   +E+       +LQ  R+ L  + RE+  L+  +D++PS+ E+ QYQ+RFVEL ++++    E KQ Y +YN LD  K  L +EVNLLNSIH+NF++++ +   +EQ  +Q+++    I+  +   E ++++ K  RDQ  +E+  ++DK R Y K  K+ +E
Sbjct:   19 EDEEQGVKLSEILELLVAAGYFRARIKGLSSFDKVVGGMTWCITTCSVDIDVDLLFQENSTIGQKIALTEKIVSVLPSMKCPHRIEPHQIQGLDFIHIFPVIQWLVKRAIETREETGDHIRAFSISQFNKSRR-----LPEDDEFLERK-----------GKAIMALLAAAEEYKPQRRYRRQVGTDSL--LDEESRVQSTLLEYGRRYCFVQNKNEKVDDRKKSVPGATAVGKAQTTEEEELQA-ADEIRIKTLMSSMAAMATEEGRLTASTVGQIVGLQSEEIKQIASEYAEKQSELAGEEKTERLGPVQQHKRLVVSLGKQISQKEIQLEEIKAKHTELKVAFEAAKEKLMEVEKQGEILRKEMGQL-----DSMESQADSAVLQKLRALVAMNESLKSQEHEFRAHCKEELTRLQSSIEELKLQTNNTTGEEAEQDQLIEKQYRTDIDKLQKIRMLLGRRNREIAILQRKIDEVPSRAELTQYQRRFVELYSQVAATHKETKQFYTLYNTLDDKKLYLEKEVNLLNSIHDNFQQAMASQGGREQFLKQLEQIVEGIKQSRVKVEKKRQENKMRRDQLNDEHLDLLDKQRLYFKTVKDFKE 598          
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Nematostella
Match: EDO46239 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW5])

HSP 1 Score: 301.597 bits (771), Expect = 8.632e-94
Identity = 204/611 (33.39%), Postives = 326/611 (53.36%), Query Frame = 1
Query:  109 EDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRV-DIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNVSEEVSVMSTLLEYG-------------------RKEILGSISNASGNAGDRSSVSQEKQVDSL----------EDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEI---KNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNED--EPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQE 1836
            ED EQ  K L T+ LL++AGYFRARIKGLS F+KVVGGMTWCI  C  ++D+DLLFQEN  IG+KIALTEK+V VL +M CPHR+EPHQIQG DFI+I+ VVQWLVK+T+ +++E    ++  +   F++      D E +E                   C   + +L++ Y P+R ++KP   ++  EE  V +TLLEYG                             AS    +   + ++K++ SL          E  +  N + + +  Q +E ++M     S+  ER+  ++++ LE    +     Q+  + V   +   +  + +L+++TEK   +E  + + +E +S++     R+  ++ +LNE       +I N+        ++ +V   + LK++EQQ ++  K+E  +L E + KL +E   E  ED+E++  +       K +LQ  RL LA K RE+  L+  +D++PS+ E+ QYQ+RFVEL  +++    E KQ + +YN LD  K  L +E NLLNSIH+NF++++ + + KEQ   Q  +    + G K   + +K   K  RD   ++Y  +V+  R Y K  K   E
Sbjct:    5 EDEEQNVKLLETIDLLLAAGYFRARIKGLSPFDKVVGGMTWCITVCDFDVDVDLLFQENSTIGQKIALTEKIVAVLPRMKCPHRLEPHQIQGLDFINIFPVVQWLVKRTIERKEEMGDYIREFSVSQFNKFHSTPQDDEFKERKP---------------KCLETMSHLKETYKPKRLYRKPGK-EDDDEENRVRTTLLEYGWQYGFSKEEREKEKAEKKKAAVAASGRGRASSAGEEDEHIIEQKRLSSLLRGMSIMEGKEGALSPNAVGSIVGLQSEEISQMA----SEYAERQ-AELQEGLEG-RGERMGGAQAHKRMVASLEKQIAVQEKRLDQITEKRNNLEESLINAQEQLSQVTARSERINEEMQKLNEIESGENVAILNH--------LRSLVAMNENLKKQEQQFRAHCKEEMNRLQENIAKLKSEGGAEDSEDKERMELINNQYEADKAKLQKIRLLLARKNREIAGLQRKIDEVPSRAELTQYQRRFVELYNQVAATHKETKQFFTLYNTLDDSKLYLGKEANLLNSIHDNFEQAMSSPANKEQFLSQFDQIVKGVVGNKDKVDKRKLSEKQRRDALNDKYLDLVENQRLYYKTVKEFTE 585          
BLAST of Coiled-coil domain-containing protein 93 vs. Planmine SMEST
Match: SMESG000022913.1 (SMESG000022913.1)

HSP 1 Score: 1231.85 bits (3186), Expect = 0.000e+0
Identity = 606/611 (99.18%), Postives = 608/611 (99.51%), Query Frame = 1
Query:   79 MFEEVDSNATEDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNVSEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQEKQVDSLEDVVDINVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDVQLNEKLLKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKLDQKCNELGLKSQIENEI 1911
            MFEEVDSNAT DNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKN+SEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQEKQVDSLEDVVDI+VIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMV TLDRLKEEEQQLKSTYKKED QLNEKLLKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKLDQKCNELGLKSQIENEI
Sbjct:    1 MFEEVDSNATVDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMTWCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQIQGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELRENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNISEEVSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQEKQVDSLEDVVDIDVIQNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPKKVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVELNEYRENFEESIKNYPEEIKIEDVQEMVMTLDRLKEEEQQLKSTYKKEDFQLNEKLLKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTRELKQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSVKDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGENQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKLDQKCNELGLKSQIENEI 611          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC936.062e-9833.12coiled-coil domain containing 93 [Source:HGNC Symb... [more]
CCDC931.850e-9733.17coiled-coil domain containing 93 [Source:HGNC Symb... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C16A11.24.646e-2138.46pep chromosome:WBcel235:II:4238159:4244829:1 gene:... [more]
C16A11.24.646e-2138.46pep chromosome:WBcel235:II:4238203:4244830:1 gene:... [more]
C31E10.55.925e-627.55pep chromosome:WBcel235:X:13991458:13995834:-1 gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fidipidine7.125e-7028.98gene:FBgn0025519 transcript:FBtr0087185[more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc933.321e-9833.66coiled-coil domain containing 93 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rasef1.125e-5138.54RAS and EF-hand domain containing [Source:Xenbase;... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc932.633e-9833.88coiled-coil domain containing 93 [Source:MGI Symbo... [more]
Ccdc935.846e-9833.88coiled-coil domain containing 93 [Source:MGI Symbo... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q640U7|CCD93_XENTR2.181e-10135.55Coiled-coil domain-containing protein 93 OS=Xenopu... [more]
sp|Q6GQI5|CCD93_XENLA1.008e-9934.60Coiled-coil domain-containing protein 93 OS=Xenopu... [more]
sp|Q5ZKI4|CCD93_CHICK1.195e-9734.55Coiled-coil domain-containing protein 93 OS=Gallus... [more]
sp|Q5BJT7|CCD93_RAT2.169e-9733.88Coiled-coil domain-containing protein 93 OS=Rattus... [more]
sp|Q567U6|CCD93_HUMAN2.911e-9733.12Coiled-coil domain-containing protein 93 OS=Homo s... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RNC69.370e-10336.35Coiled-coil domain-containing protein 93 OS=Crasso... [more]
F6TUC22.072e-10235.05Coiled-coil domain containing 93 OS=Monodelphis do... [more]
A0A3Q2ZKX56.795e-10235.62Coiled-coil domain containing 93 OS=Kryptolebias m... [more]
A0A4X2L0D41.328e-10135.16KOG2701 domain-containing protein OS=Vombatus ursi... [more]
G3X3236.194e-10134.99Coiled-coil domain containing 93 OS=Sarcophilus ha... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccdc935.583e-9934.08coiled-coil domain containing 93 [Source:NCBI gene... [more]
ccdc938.008e-9733.60coiled-coil domain containing 93 [Source:NCBI gene... [more]
ccdc932.090e-7730.18coiled-coil domain containing 93 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc939.375e-10233.11coiled-coil domain containing 93 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462398.632e-9433.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 93 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022913.10.000e+099.18SMESG000022913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025543 ID=SMED30025543|Name=Coiled-coil domain-containing protein 93|organism=Schmidtea mediterranea sexual|type=transcript|length=1980bp
TGAAAGTTTCCGATTACATTAATTTTCAATTGATAATTCGTTATTTCTAT
TTTTAAGGATTGAATTACCCGATAAAAAATGTTTGAAGAAGTAGACTCTA
ATGCCACTGAGGATAATGAACAAAAAAATAAAGAATTGCTCACTCTACAA
TTATTGGTTTCTGCTGGATATTTTCGTGCCAGAATTAAGGGTTTATCAAC
ATTCAATAAAGTCGTCGGTGGTATGACTTGGTGTATCCAAGGTTGCAGTA
TGAATATTGATATTGATCTCCTTTTTCAAGAAAACTGGAATATTGGAAGA
AAAATAGCATTAACAGAAAAACTTGTAAGAGTTTTGAAAAAGATGAACTG
TCCTCATCGAATTGAACCACATCAAATCCAAGGGTCAGATTTTATCCATA
TTTATTCAGTAGTACAGTGGCTCGTTAAACAGACCCTTGGTAAACAAGAC
GAAAGAATGGCTGAAATGAAAGTAATAGCTTGCCAATATTTTGACAGAAC
GGATAAAAGAGTTGACATTGAATTACGAGAAAATAATAGCTATGATAAAA
CTAAAATATGGAACTGTGATATTTCTCCCTTACAGGATTGCACAAATGTT
GTGGAATACCTTGAGAAAGCTTATTTTCCTCAAAGAAAGTTTAAAAAACC
AAATTCATTGAAAAATGTTTCAGAAGAAGTGTCAGTTATGTCGACACTTC
TAGAATATGGCAGGAAAGAAATTCTGGGCTCAATTTCTAATGCTTCTGGT
AATGCCGGTGATAGGAGCTCGGTTTCTCAAGAAAAACAAGTTGACAGCTT
GGAGGATGTCGTCGACATCAATGTTATCCAGAATCAAATGTCATCCCAGG
TGAAAGAAACCACAAAAATGACGGGCAAATTAGTTAGTCAATTAATGGAA
CGGAAATTCGGTGACGTTCGAGATGCACTTGAAGATTATGAGGCCAAAAG
TACCATTTTGACGCAATCCAGTCCGAAAAAAGTAGACTATTGGAAAAATG
CCACCTCAAACCTTCAATTAAAACTCGAAGAAGTTACTGAAAAATCACTC
GAAGTGGAAACGCAAATCAATTCTGTCAGGGAAAATATTTCGGAAATTAA
AAATAGAATGAAAATTAAATTGGTGGAGTTGAACGAATACAGAGAAAATT
TTGAAGAAAGTATAAAAAACTACCCGGAAGAAATAAAAATTGAAGATGTC
CAAGAAATGGTGACGACATTAGATCGATTGAAAGAAGAAGAACAACAATT
GAAATCAACCTACAAGAAAGAAGACGTCCAATTAAATGAAAAACTATTAA
AATTAAGTAACGAAGACGAACCCATTGAAGACGAAGAACAAGTTTCAGCT
TTGGAGGAGTCATTAAATAATCATAAAAAACGATTACAAAATGGACGATT
GAGATTGGCTACTAAAACCCGAGAATTGAAACAATTAGAATTGTTTCTCG
ATGATATTCCTTCCAAACGTGAGATTCAACAATATCAGAAACGATTTGTA
GAATTAAATACTGAAATCAGTAATGCATTTTCAGAAAATAAACAACTATA
TGACATGTATAACATTTTGGATTCTGTTAAAGATTGCCTAAGTCGAGAGG
TGAACTTGCTGAATTCTATTCATGAGAATTTCAAAGAGTCAATCCAAAAT
TATTCAGCGAAGGAACAGATTTTCCAACAAATGAAAGAAGCGGCCAACAC
AATTCGGGGATTGAAAAAAAATGGTGAAAATCAGAAAGAAAAAACAAAAG
CTGATCGTGATCAAAAAAAAGAAGAATATAATGCAATAGTTGATAAAAGT
CGGCAGTATGCGAAATTGACAAAAAATTTGCAAGAAACCTGGCAATACTA
TGAGAAATTGGATCAGAAATGCAATGAGCTGGGCTTGAAAAGTCAAATTG
AAAATGAGATTTGATTTAACCGGGATTAATTTCCCATTAATTTTTGTAAT
TTAAATTCCCTATTTGTTATTAAATATTAT
back to top

protein sequence of SMED30025543-orf-1

>SMED30025543-orf-1 ID=SMED30025543-orf-1|Name=SMED30025543-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=612bp
MFEEVDSNATEDNEQKNKELLTLQLLVSAGYFRARIKGLSTFNKVVGGMT
WCIQGCSMNIDIDLLFQENWNIGRKIALTEKLVRVLKKMNCPHRIEPHQI
QGSDFIHIYSVVQWLVKQTLGKQDERMAEMKVIACQYFDRTDKRVDIELR
ENNSYDKTKIWNCDISPLQDCTNVVEYLEKAYFPQRKFKKPNSLKNVSEE
VSVMSTLLEYGRKEILGSISNASGNAGDRSSVSQEKQVDSLEDVVDINVI
QNQMSSQVKETTKMTGKLVSQLMERKFGDVRDALEDYEAKSTILTQSSPK
KVDYWKNATSNLQLKLEEVTEKSLEVETQINSVRENISEIKNRMKIKLVE
LNEYRENFEESIKNYPEEIKIEDVQEMVTTLDRLKEEEQQLKSTYKKEDV
QLNEKLLKLSNEDEPIEDEEQVSALEESLNNHKKRLQNGRLRLATKTREL
KQLELFLDDIPSKREIQQYQKRFVELNTEISNAFSENKQLYDMYNILDSV
KDCLSREVNLLNSIHENFKESIQNYSAKEQIFQQMKEAANTIRGLKKNGE
NQKEKTKADRDQKKEEYNAIVDKSRQYAKLTKNLQETWQYYEKLDQKCNE
LGLKSQIENEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039116CCDC93
IPR001148CA_dom
IPR019159CCDC93_CC
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0005769early endosome
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006893Golgi to plasma membrane transport
GO:0015031protein transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 466..486
NoneNo IPR availableCOILSCoilCoilcoord: 374..401
NoneNo IPR availableCOILSCoilCoilcoord: 528..566
NoneNo IPR availableCOILSCoilCoilcoord: 422..442
NoneNo IPR availableCOILSCoilCoilcoord: 316..357
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 547..567
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 543..567
NoneNo IPR availablePANTHERPTHR16441:SF0COILED-COIL DOMAIN-CONTAINING PROTEIN 93coord: 11..601
IPR019159CCDC93, coiled-coil domainPFAMPF09762KOG2701coord: 23..211
e-value: 1.8E-55
score: 187.9
IPR039116Coiled-coil domain-containing protein 93PANTHERPTHR16441FIDIPIDINEcoord: 11..601