DNA replication ATP-dependent helicase/nuclease DNA2

Overview
NameDNA replication ATP-dependent helicase/nuclease DNA2
Smed IDSMED30025533
Length (bp)1483
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA replication ATP-dependent helicase/nuclease DNA2 (SMED30025533) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA replication ATP-dependent helicase/nuclease DNA2 (SMED30025533) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025533

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30025533SMESG000052537.1 PL06005A1F08_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 130.568 bits (327), Expect = 1.142e-31
Identity = 95/303 (31.35%), Postives = 162/303 (53.47%), Query Frame = 3
Query:  483 TKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW----IYRNISQ-------------SEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELA-NYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            T + W I+ + G +++ PD L++ T+I  S+ C R++V    F   S  + + M++GT +H +FQK +   + + +K++++    + + + +   Y    S +EI +E+E Y P   +W    +++N S              S+ +   N +    +DIEESIWS ++G+KGKID+T+        ++   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G   PV  N H +   ++ LRN++A +   R   +          LP ++E  + C  C  +  C
Sbjct:  104 TSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQK-AINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERRADPEAGLLLYLKTGQMYPVPAN-HLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNC 402          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 130.568 bits (327), Expect = 1.142e-31
Identity = 95/303 (31.35%), Postives = 162/303 (53.47%), Query Frame = 3
Query:  483 TKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW----IYRNISQ-------------SEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELA-NYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            T + W I+ + G +++ PD L++ T+I  S+ C R++V    F   S  + + M++GT +H +FQK +   + + +K++++    + + + +   Y    S +EI +E+E Y P   +W    +++N S              S+ +   N +    +DIEESIWS ++G+KGKID+T+        ++   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G   PV  N H +   ++ LRN++A +   R   +          LP ++E  + C  C  +  C
Sbjct:  104 TSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQK-AINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERRADPEAGLLLYLKTGQMYPVPAN-HLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNC 402          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 130.183 bits (326), Expect = 2.121e-31
Identity = 95/303 (31.35%), Postives = 162/303 (53.47%), Query Frame = 3
Query:  483 TKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW----IYRNISQ-------------SEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELA-NYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            T + W I+ + G +++ PD L++ T+I  S+ C R++V    F   S  + + M++GT +H +FQK +   + + +K++++    + + + +   Y    S +EI +E+E Y P   +W    +++N S              S+ +   N +    +DIEESIWS ++G+KGKID+T+        ++   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G   PV  N H +   ++ LRN++A +   R   +          LP ++E  + C  C  +  C
Sbjct:  104 TSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQK-AINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERRADPEAGLLLYLKTGQMYPVPAN-HLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNC 402          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 130.183 bits (326), Expect = 2.639e-31
Identity = 95/303 (31.35%), Postives = 162/303 (53.47%), Query Frame = 3
Query:  483 TKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW----IYRNISQ-------------SEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELA-NYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            T + W I+ + G +++ PD L++ T+I  S+ C R++V    F   S  + + M++GT +H +FQK +   + + +K++++    + + + +   Y    S +EI +E+E Y P   +W    +++N S              S+ +   N +    +DIEESIWS ++G+KGKID+T+        ++   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G   PV  N H +   ++ LRN++A +   R   +          LP ++E  + C  C  +  C
Sbjct:  104 TSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQK-AINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERRADPEAGLLLYLKTGQMYPVPAN-HLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNC 402          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Match: dna-2 (Yeast DNA helicase/endonuclease family [Source:UniProtKB/TrEMBL;Acc:Q9U3F2])

HSP 1 Score: 132.88 bits (333), Expect = 1.116e-32
Identity = 105/331 (31.72%), Postives = 173/331 (52.27%), Query Frame = 3
Query:  366 LTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKE-NWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFL--IQEKQMLSFYES----EFSDNEIMKELEIYFPQILQWIYRN--ISQSEHDKR----TNTKKXXXXXXXXXXXXVKYGMKGKIDMTLQ--SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            L L+  +  G    + L+  W+   I      N+I      + ++ +N++ G++++NPD L+  TA+  + FC RK+V    F      S K+M+LGT +H IFQ           K + + +N L  I  KQ   + E      F+ + +  EL+ YF  I  WI ++  +S S   KR    + ++   + DIEE+IW  K G+KGKID+T++  S   +  LELKTGK+S S +HT QVLLY +M S   +  I  G +LY+KDG+    +  R  +++ ++  RN+L+ +        P  +N    LP   +++RFC +C++ T+C
Sbjct:  117 LDLECIDKEGTTRIVYLQDHWSEMSIEAGSTINLIGAQAWGDRDFLVNDDVGIVILNPDALVPCTAVASATFCARKTVLNDKFK-FGNASNKAMLLGTIMHEIFQ------TAITSKKRPVMENDLMKIWNKQAPKYAEELVALSFTPSCLDAELQPYFSIICGWINKHYPLSNSFFSKREPLPSKSELLEVYDIEENIWDSKLGLKGKIDVTMRTKSRGGMESLELKTGKSSCSSEHTGQVLLYCMMQSSRYEQPIGPGNILYLKDGASH-CVTPRAADLLGVLQQRNKLSVHF-----EDPTTSN----LPDPRQDSRFCDKCDHKTMC 430          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Match: CG2990 (gene:FBgn0030170 transcript:FBtr0112971)

HSP 1 Score: 125.946 bits (315), Expect = 2.528e-30
Identity = 99/288 (34.38%), Postives = 154/288 (53.47%), Query Frame = 3
Query:  495 WKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHD----KRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL-----QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLP---PVLENNRFCGQCEYLTLCFSL 1322
            + ++  QG  V +PDFL++ T +TGSLFC+RKSV Q  F  +   S  SMV+GT +H + QK  +++      I+   +  L         Y S     E+   L  +   I+ ++ + +          +    +   I DIEE++W  + G+KGK+D+++     +  E I+PLELKTG+ SFS +H  Q+LLY LM S A+  D  SGLLLY+K+G  + V + R+     ++MLRN+LA +L+R +  P    +    LP   PV  ++  CG C Y T+C S 
Sbjct:  135 YVVDKEQGYCVSHPDFLISGTTVTGSLFCKRKSVLQERFRGLD--SGNSMVIGTLVHELLQKVLRQKLFDKKHIQSALQEMLASSSLAHLLYASNLIQVEMEDHLMKFIDPIVSFVAQYVKGEPPSVLLPEVYRGQIHEICDIEENLWVPQLGLKGKVDVSVKVKNQRQREEIIPLELKTGRASFSMEHKGQLLLYQLMHS-AQGRDTQSGLLLYLKEGLLREVASGRNEQR-DLLMLRNDLAYWLTREVAIPASKEDPLEQLPLPEPVYHHS-ACGNCAYNTICSSF 417          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Match: CG2990 (gene:FBgn0030170 transcript:FBtr0071415)

HSP 1 Score: 124.02 bits (310), Expect = 1.251e-29
Identity = 100/289 (34.60%), Postives = 155/289 (53.63%), Query Frame = 3
Query:  495 WKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDI-SGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHD----KRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL-----QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLP---PVLENNRFCGQCEYLTLCFSL 1322
            + ++  QG  V +PDFL++ T +TGSLFC+RKSV Q  F  + SG S   MV+GT +H + QK  +++      I+   +  L         Y S     E+   L  +   I+ ++ + +          +    +   I DIEE++W  + G+KGK+D+++     +  E I+PLELKTG+ SFS +H  Q+LLY LM S A+  D  SGLLLY+K+G  + V + R+     ++MLRN+LA +L+R +  P    +    LP   PV  ++  CG C Y T+C S 
Sbjct:  135 YVVDKEQGYCVSHPDFLISGTTVTGSLFCKRKSVLQERFRGLDSGNS--VMVIGTLVHELLQKVLRQKLFDKKHIQSALQEMLASSSLAHLLYASNLIQVEMEDHLMKFIDPIVSFVAQYVKGEPPSVLLPEVYRGQIHEICDIEENLWVPQLGLKGKVDVSVKVKNQRQREEIIPLELKTGRASFSMEHKGQLLLYQLMHS-AQGRDTQSGLLLYLKEGLLREVASGRNEQR-DLLMLRNDLAYWLTREVAIPASKEDPLEQLPLPEPVYHHS-ACGNCAYNTICSSF 418          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: BX530068.2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:559535])

HSP 1 Score: 139.813 bits (351), Expect = 1.093e-34
Identity = 102/348 (29.31%), Postives = 166/348 (47.70%), Query Frame = 3
Query:  342 SRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWI--YRNISQSEHDKRTNTK--------KXXXXXXXXXXXXV---------KYGMKGKIDMTL---------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQC 1295
            SR  + K LT+   + +       L+  W + L+   +I ++     +   W I+ +   +++ PD L++ T+I  S+ C R+ V    F    G SK+ M+ GT +H IFQK +   + S +KI+      L     +   Y  + +  ++ +E+E Y P I +W   Y + S     K+   K        K            V         ++G+KGKID+T          +  E IVPLELKTGK S S +H SQV+LYTL MS AR+ D ++G L+Y+K GS  PV+ N H +   ++ +RN LA+++   L     V   + +  LP ++ + + C  C
Sbjct:  372 SRSCSEKHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVSGL-WTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGSKQ-MLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTL-MSSARRCDPEAGFLVYLKTGSLHPVVGN-HMDRRELIKIRNSLAHHIGNNLIK---VDGKSQMAQLPAIVSDQQTCKYC 712          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: dna2 (DNA replication helicase/nuclease 2 [Source:ZFIN;Acc:ZDB-GENE-090313-71])

HSP 1 Score: 139.813 bits (351), Expect = 1.210e-34
Identity = 102/348 (29.31%), Postives = 166/348 (47.70%), Query Frame = 3
Query:  342 SRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWI--YRNISQSEHDKRTNTK--------KXXXXXXXXXXXXV---------KYGMKGKIDMTL---------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQC 1295
            SR  + K LT+   + +       L+  W + L+   +I ++     +   W I+ +   +++ PD L++ T+I  S+ C R+ V    F    G SK+ M+ GT +H IFQK +   + S +KI+      L     +   Y  + +  ++ +E+E Y P I +W   Y + S     K+   K        K            V         ++G+KGKID+T          +  E IVPLELKTGK S S +H SQV+LYTL MS AR+ D ++G L+Y+K GS  PV+ N H +   ++ +RN LA+++   L     V   + +  LP ++ + + C  C
Sbjct:  375 SRSCSEKHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVSGL-WTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGSKQ-MLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTL-MSSARRCDPEAGFLVYLKTGSLHPVVGN-HMDRRELIKIRNSLAHHIGNNLIK---VDGKSQMAQLPAIVSDQQTCKYC 715          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: BX890597.2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:559535])

HSP 1 Score: 139.428 bits (350), Expect = 1.302e-34
Identity = 102/348 (29.31%), Postives = 166/348 (47.70%), Query Frame = 3
Query:  342 SRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWI--YRNISQSEHDKRTNTK--------KXXXXXXXXXXXXV---------KYGMKGKIDMTL---------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQC 1295
            SR  + K LT+   + +       L+  W + L+   +I ++     +   W I+ +   +++ PD L++ T+I  S+ C R+ V    F    G SK+ M+ GT +H IFQK +   + S +KI+      L     +   Y  + +  ++ +E+E Y P I +W   Y + S     K+   K        K            V         ++G+KGKID+T          +  E IVPLELKTGK S S +H SQV+LYTL MS AR+ D ++G L+Y+K GS  PV+ N H +   ++ +RN LA+++   L     V   + +  LP ++ + + C  C
Sbjct:  372 SRSCSEKHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVSGL-WTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGSKQ-MLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTL-MSSARRCDPEAGFLVYLKTGSLHPVVGN-HMDRRELIKIRNSLAHHIGNNLIK---VDGKSQMAQLPAIVSDQQTCKYC 712          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: BX530068.2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:559535])

HSP 1 Score: 139.428 bits (350), Expect = 1.315e-34
Identity = 102/348 (29.31%), Postives = 166/348 (47.70%), Query Frame = 3
Query:  342 SRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWI--YRNISQSEHDKRTNTK--------KXXXXXXXXXXXXV---------KYGMKGKIDMTL---------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQC 1295
            SR  + K LT+   + +       L+  W + L+   +I ++     +   W I+ +   +++ PD L++ T+I  S+ C R+ V    F    G SK+ M+ GT +H IFQK +   + S +KI+      L     +   Y  + +  ++ +E+E Y P I +W   Y + S     K+   K        K            V         ++G+KGKID+T          +  E IVPLELKTGK S S +H SQV+LYTL MS AR+ D ++G L+Y+K GS  PV+ N H +   ++ +RN LA+++   L     V   + +  LP ++ + + C  C
Sbjct:  372 SRSCSEKHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVSGL-WTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGSKQ-MLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTL-MSSARRCDPEAGFLVYLKTGSLHPVVGN-HMDRRELIKIRNSLAHHIGNNLIK---VDGKSQMAQLPAIVSDQQTCKYC 712          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: BX890597.2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:559535])

HSP 1 Score: 139.428 bits (350), Expect = 1.352e-34
Identity = 102/348 (29.31%), Postives = 166/348 (47.70%), Query Frame = 3
Query:  342 SRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWI--YRNISQSEHDKRTNTK--------KXXXXXXXXXXXXV---------KYGMKGKIDMTL---------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQC 1295
            SR  + K LT+   + +       L+  W + L+   +I ++     +   W I+ +   +++ PD L++ T+I  S+ C R+ V    F    G SK+ M+ GT +H IFQK +   + S +KI+      L     +   Y  + +  ++ +E+E Y P I +W   Y + S     K+   K        K            V         ++G+KGKID+T          +  E IVPLELKTGK S S +H SQV+LYTL MS AR+ D ++G L+Y+K GS  PV+ N H +   ++ +RN LA+++   L     V   + +  LP ++ + + C  C
Sbjct:  372 SRSCSEKHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVSGL-WTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGSKQ-MLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTL-MSSARRCDPEAGFLVYLKTGSLHPVVGN-HMDRRELIKIRNSLAHHIGNNLIK---VDGKSQMAQLPAIVSDQQTCKYC 712          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 130.954 bits (328), Expect = 1.042e-31
Identity = 94/307 (30.62%), Postives = 165/307 (53.75%), Query Frame = 3
Query:  426 WANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTN-TKKXXXXXXXXXXXXVKYGMKGKIDMTLQ--------SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            W    I   +I ++         W I+ + G +++ PD L++ T+I   + C R+SV    F  +  K  + M++GT +H IFQ+ +  +  +   ++++  + +   K +   Y+ + +  ++M E++ Y P   +W    ++   +  + N TK S  +DIEE+IWS ++G+KGKID+T +        S   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G+   V  NR  +   ++ +RNEL+ YL+  +      + +  L  LP ++ + + C  C  +  C
Sbjct:   79 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKF-KVCDKGSRQMLIGTMLHDIFQRATT-RGFTDSVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINATKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGLLLYLKTGNMYSVPGNR-LDRRELLKIRNELSYYLTNVVHKSDNGSKEITLASLPALIADRQACKFCSQMRNC 381          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 129.028 bits (323), Expect = 5.677e-31
Identity = 94/317 (29.65%), Postives = 166/317 (52.37%), Query Frame = 3
Query:  426 WANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYR-----------NISQSEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTLQ--------SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            W    I   +I ++         W I+ + G +++ PD L++ T+I   + C R+SV    F  +  K  + M++GT +H IFQ+ +  +  +   ++++  + +   K +   Y+ + +  ++M E++ Y P   +W              N+++   ++   TK S  +DIEE+IWS ++G+KGKID+T +        S   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G+   V  NR  +   ++ +RNEL+ YL+  +      + +  L  LP ++ + + C  C  +  C
Sbjct:   79 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKF-KVCDKGSRQMLIGTMLHDIFQRATT-RGFTDSVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINVTRDGGNESGATKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGLLLYLKTGNMYSVPGNR-LDRRELLKIRNELSYYLTNVVHKSDNGSKEITLASLPALIADRQACKFCSQMRNC 391          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 127.102 bits (318), Expect = 1.948e-30
Identity = 94/318 (29.56%), Postives = 164/318 (51.57%), Query Frame = 3
Query:  426 WANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQ------------SEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTLQ--------SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            W    I   +I ++         W I+ + G +++ PD L++ T+I   + C R+SV    F  +  K  + M++GT +H IFQ+ +  +  +   ++++  + +   K +   Y+ + +  ++M E++ Y P   +W    ++             +  D    TK S  +DIEE+IWS ++G+KGKID+T +        S   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G+   V  NR  +   ++ +RNEL+ YL+  +      + +  L  LP ++ + + C  C  +  C
Sbjct:   91 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKF-KVCDKGSRQMLIGTMLHDIFQRATT-RGFTDSVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINVTRPTAGDPTEATKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGLLLYLKTGNMYSVPGNR-LDRRELLKIRNELSYYLTNVVHKSDNGSKEITLASLPALIADRQACKFCSQMRNC 404          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 127.102 bits (318), Expect = 2.109e-30
Identity = 101/341 (29.62%), Postives = 175/341 (51.32%), Query Frame = 3
Query:  360 KRLTLKTCENNGYQIKLN-LEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQ------------SEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTLQ--------SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            K LT+ T    G  ++L  L+  W    I   +I ++         W I+ + G +++ PD L++ T+I   + C R+SV    F  +  K  + M++GT +H IFQ+ +  +  +   ++++  + +   K +   Y+ + +  ++M E++ Y P   +W    ++             +  D    TK S  +DIEE+IWS ++G+KGKID+T +        S   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G+   V  NR  +   ++ +RNEL+ YL+  +      + +  L  LP ++ + + C  C  +  C
Sbjct:   69 KHLTI-TASQEGDDLELCILKDDWVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKF-KVCDKGSRQMLIGTMLHDIFQRATT-RGFTDSVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINVTRPTAGDPTEATKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGLLLYLKTGNMYSVPGNRL-DRRELLKIRNELSYYLTNVVHKSDNGSKEITLASLPALIADRQACKFCSQMRNC 404          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 126.716 bits (317), Expect = 2.510e-30
Identity = 86/311 (27.65%), Postives = 155/311 (49.84%), Query Frame = 3
Query:  426 WANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXX-----XVKYGMKGKIDMTLQ--------SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            W    I   +I ++         W I+ + G +++ PD L++ T+I   + C R+SV    F  +  K  + M++GT +H IFQ+ +  +  +   ++++  + +   K +   Y+ + +  ++M E++ Y P   +W    ++   +  + N         E         S ++G+KGKID+T +        S   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G+   V  NR  +   ++ +RNEL+ YL+  +      + +  L  LP ++ + + C  C  +  C
Sbjct:   77 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKF-KVCDKGSRQMLIGTMLHDIFQRATT-RGFTDSVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINVTSFDDSFSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGLLLYLKTGNMYSVPGNR-LDRRELLKIRNELSYYLTNVVHKSDNGSKEITLASLPALIADRQACKFCSQMRNC 383          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Match: Dna2 (DNA replication helicase/nuclease 2 [Source:MGI Symbol;Acc:MGI:2443732])

HSP 1 Score: 134.806 bits (338), Expect = 4.761e-33
Identity = 106/361 (29.36%), Postives = 181/361 (50.14%), Query Frame = 3
Query:  315 YRVVVIEI--DSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW---IYRNISQSE--------------HDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNEL-ANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            Y V+ +E   + R    KRL +   ++  +++   L   W++  +   +I ++     T E W I+++ G  ++ PD +++ T++  S+ C R++V    F   S  + + M++GT +H +FQK   E + + ++++++    L + + +   Y    S +EI+ E+E Y P   +W     R    SE                   N +    +DIEESIWS ++G+KGKID+T+        +    ++PLELKTGK S S +H SQV+LYTL +S  R+ D ++G LLY+K G   PV  N H +   ++ LRN L A+ L R     P      + LP ++E  + C  C  +  C
Sbjct:   48 YLVLAVETSQNERGAEEKRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDC-TSEPWIIDDDFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRG-SDPATRQMLIGTILHEVFQKAISE-SFAPERLQELALQTLREVRHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGWLLYLKTGQMYPVPAN-HLDKRELLKLRNWLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQIGNC 403          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Match: Dna2 (DNA replication helicase/nuclease 2 [Source:MGI Symbol;Acc:MGI:2443732])

HSP 1 Score: 134.806 bits (338), Expect = 5.047e-33
Identity = 106/361 (29.36%), Postives = 181/361 (50.14%), Query Frame = 3
Query:  315 YRVVVIEI--DSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW---IYRNISQSE--------------HDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNEL-ANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            Y V+ +E   + R    KRL +   ++  +++   L   W++  +   +I ++     T E W I+++ G  ++ PD +++ T++  S+ C R++V    F   S  + + M++GT +H +FQK   E + + ++++++    L + + +   Y    S +EI+ E+E Y P   +W     R    SE                   N +    +DIEESIWS ++G+KGKID+T+        +    ++PLELKTGK S S +H SQV+LYTL +S  R+ D ++G LLY+K G   PV  N H +   ++ LRN L A+ L R     P      + LP ++E  + C  C  +  C
Sbjct:   48 YLVLAVETSQNERGAEEKRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDC-TSEPWIIDDDFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRG-SDPATRQMLIGTILHEVFQKAISE-SFAPERLQELALQTLREVRHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGWLLYLKTGQMYPVPAN-HLDKRELLKLRNWLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQIGNC 403          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|Q5ZKG3|DNA2_CHICK (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Gallus gallus OX=9031 GN=DNA2 PE=2 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 1.415e-35
Identity = 107/362 (29.56%), Postives = 180/362 (49.72%), Query Frame = 3
Query:  315 YRVV---VIEIDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXV---------------KYGMKGKIDMTL------QSG--ESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYL--SRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLCF 1316
            YRV+   V+  + RD   K L + +  + G      L+  W +  +   +I ++     +   W IN   G +++ PD LL+ T I+ S+ C RK+V    F      S++++V GT +H IFQ+ S   NLS +K++++ K  +  +K +   Y  +    EIM+E+E Y P   +W    +    +  +   K  S     +   +V               ++G+KGKID+T       Q G    I+PLELK+GK S S +H SQV+LYTL+  + R+ D ++G LLY+K G+  PV   R  +   ++ LRN++A YL  S + +      +    LPP++++++ C  C  +  CF
Sbjct:   17 YRVLEVRVVRGEGRDPE-KHLAVSSDPSLGDTELCVLQNGWESVPVVPGDIVHLEGDCSSG-TWVINEQSGYLILYPDLLLSGTTISSSIRCMRKAVLSERFRGSECGSRQTLV-GTILHEIFQQ-SVTNNLSPEKVEELAKKIVYGQKYLKEMYHLKLKQTEIMQEIEEYLPSFFKWTEDFVRNPANQNKMQLKLPSENKTGDCSSTVEIVDILDIEENIWSPRFGLKGKIDVTARVKIHRQGGIQSRIMPLELKSGKESNSVEHRSQVILYTLLNLE-RRVDPEAGFLLYLKTGTMYPVTGTRM-DRRELIKLRNQVAFYLMHSTYKSAVGRQQSQLAALPPLIDDSQACKYCSQIHNCF 372          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|Q6ZQJ5|DNA2_MOUSE (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus OX=10090 GN=Dna2 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 3.530e-32
Identity = 106/361 (29.36%), Postives = 181/361 (50.14%), Query Frame = 3
Query:  315 YRVVVIEI--DSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW---IYRNISQSE--------------HDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNEL-ANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            Y V+ +E   + R    KRL +   ++  +++   L   W++  +   +I ++     T E W I+++ G  ++ PD +++ T++  S+ C R++V    F   S  + + M++GT +H +FQK   E + + ++++++    L + + +   Y    S +EI+ E+E Y P   +W     R    SE                   N +    +DIEESIWS ++G+KGKID+T+        +    ++PLELKTGK S S +H SQV+LYTL +S  R+ D ++G LLY+K G   PV  N H +   ++ LRN L A+ L R     P      + LP ++E  + C  C  +  C
Sbjct:   48 YLVLAVETSQNERGAEEKRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDC-TSEPWIIDDDFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRG-SDPATRQMLIGTILHEVFQKAISE-SFAPERLQELALQTLREVRHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGWLLYLKTGQMYPVPAN-HLDKRELLKLRNWLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQIGNC 403          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|P51530|DNA2_HUMAN (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3)

HSP 1 Score: 130.183 bits (326), Expect = 1.267e-30
Identity = 95/303 (31.35%), Postives = 162/303 (53.47%), Query Frame = 3
Query:  483 TKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW----IYRNISQ-------------SEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELA-NYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            T + W I+ + G +++ PD L++ T+I  S+ C R++V    F   S  + + M++GT +H +FQK +   + + +K++++    + + + +   Y    S +EI +E+E Y P   +W    +++N S              S+ +   N +    +DIEESIWS ++G+KGKID+T+        ++   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G   PV  N H +   ++ LRN++A +   R   +          LP ++E  + C  C  +  C
Sbjct:  104 TSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQK-AINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERRADPEAGLLLYLKTGQMYPVPAN-HLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNC 402          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|D3ZG52|DNA2_RAT (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Rattus norvegicus OX=10116 GN=Dna2 PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.236e-30
Identity = 102/362 (28.18%), Postives = 183/362 (50.55%), Query Frame = 3
Query:  315 YRVVVIE--IDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQW---IYRNISQSEHDK--------------RTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL--------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            Y V+ +E  ++ R    K L +   +    ++   L   W++  +   +I ++     T E W ++++ G  +++PD L++ T++  S+ C R++V    F  +S  + + M++GT +H +FQK   E + + +K++++    L + + +   Y    S +E+  E+E Y P   +W        +++E  +                N +    +DIEESIWS ++G+KGKID+T+        ++   I+PLELKTGK S S +H  QV+LYTL +S  R+ D ++G LLY+K G   PV  N H +   ++ LRN+LA  L   ++       +  L  LP ++E  + C  C  +  C
Sbjct:   48 YLVLAVETKLNERGAEEKHLLITVSQEGEQEVLCILRNGWSSVPVEPGDIIHIEGDC-TSEPWIVDDDFGYFILSPDMLISGTSVASSIRCLRRAVLSETFR-VSDTATRQMLIGTILHEVFQKAISE-SFAPEKLQELALQTLREVRHLKEMYRLNLSQDEVRCEVEEYLPSFSKWADEFMHKGTKAEFPQMHLSLPSDSSDRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKTKYKIMPLELKTGKESNSIEHRGQVILYTL-LSQERREDPEAGWLLYLKTGQMYPVPAN-HLDKRELLKLRNQLAFSLLHRVSR-AAAGEEARLLALPQIIEEEKTCKYCSQMGNC 403          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|Q8QHA5|DNA2_XENLA (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis OX=8355 GN=dna2 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.890e-30
Identity = 97/341 (28.45%), Postives = 172/341 (50.44%), Query Frame = 3
Query:  360 KRLTLKTCENNGYQIKLN-LEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXX------------XVKYGMKGKIDMTLQ--------SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            K LT+ T    G  ++L  L+  W    I   +I ++         W I+ + G +++ PD L++ T+I   + C R+SV    F  +  K  + M+ GT +H IFQ+ +     +   ++++  + +   K +   Y+ + +  ++M E++ Y P + +W    ++   + ++ N  KS+  D  E+              S ++G+KGKID+T +        +   I+PLELKTGK S S +H SQV+LYTL +S  R+ D ++GLLLY+K G+   V  NR  +   ++ +RNEL+ YL+  L      + +T L  LP ++ + + C  C  +  C
Sbjct:   69 KHLTI-TASQEGDDLELCILKDDWVALQIKPGDIIHLEGNCSVDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKF-KVCDKGSRQMLNGTMLHDIFQRATT-CGFTDSVLQELAHHTVHGPKYLKEMYQLKLNQADVMGEIQEYLPSLSKWATDFMTHPLNQQQINRTKSTAGDPTETTKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKAHLKIMPLELKTGKESNSIEHRSQVVLYTL-LSQERREDPEAGLLLYLKTGNMYTVPGNRL-DRRELLKIRNELSYYLTNVLHKSDNGSKETTLASLPAMIADRQACKYCSQMRNC 404          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: T1IXE8 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 3.903e-46
Identity = 111/324 (34.26%), Postives = 176/324 (54.32%), Query Frame = 3
Query:  372 LKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXV-------KYGMKGKIDMTLQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL---LPPVLENNRFCGQCEYLTLC 1313
            +KTC+         L+  W    +  N+I N+++   + +   I+N  GLI++NPD LL+ T++  SLFC RKSV    F   S  +   MV+G+ IH IFQ+   +Q  +   I  I+KN L+    + + Y +  ++ E+M+E++ + PQIL W  + +         NTKKS        I+ +       +YG+KGKID        ++P+ELKTG++SFS +H  QV+LY++M SD R++D + GLL+Y++DG  K V    H     ++ LRNEL +Y+ +     P   N+  +   LP  L +NR C +C Y T+C
Sbjct:  357 VKTCK---------LKDFWVQTNVKLNDIVNILSTFDSNQVATIDNTNGLIIVNPDHLLSGTSVVSSLFCMRKSVLMEQFRG-SDPANFIMVIGSLIHQIFQEALCKQAFTAQAIGVISKNILMHNSNLHAIYSAGSNETEVMEEIQKFIPQILLWFQQYVP--------NTKKSGDFIKVTDIYDIEENIWSPRYGVKGKID--------VIPIELKTGRSSFSPEHEGQVILYSMMCSD-RRSDPEGGLLVYLRDGKTKEV-KAEHNQKRGLIQLRNELIHYIDQ-----PVNENEIGVVHSLPETLNSNRLCSRCPYATVC 647          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A1S3GZW9 (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Lingula unguis OX=7574 GN=LOC106150783 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.534e-44
Identity = 116/353 (32.86%), Postives = 187/353 (52.97%), Query Frame = 3
Query:  312 FYRVVVIEID-SRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHD--KRTNTKKXXXXXXXXXXXXV---KYGMKGKIDMTL-------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL------LPPVLENNRFCGQCEYLTLC 1313
            F R +V+ +   R+E I  L +++   N  + K  L G W + L+   +I NV+          I++NQGL+VINPD L++ T++ G+++C RK++              +M+ G+ IH++FQ   +++  S DK++ I K  L Q+K ++  Y  + ++  +  E++ Y P +L W  + +    H    R +T    +  + +   ++   +YG+KGKID+T+       Q  E ++PLELKTGK SFS +H  QV LY+LM SD R+ D   GLLLY+KDGS K  I   +     ++ LRNEL +YLS    N   V +++        LP  + N R C +C  L  C
Sbjct:  358 FGRHLVLAVHHERNEVI--LDVESASGNQRR-KCVLSGFWTDTLVQPGDIVNVLGDFDDSGVCHISDNQGLLVINPDVLISGTSVVGTVYCMRKTLLNEKLRGCD-TGNMAMLHGSIIHALFQAVVQQRAFSKDKVEAIVKEILQQKKFLIEMYGQDATEAVVRAEIDKYIPPMLAWTEKYMPPPVHSFGARPSTSDLHVTKVMDIEENIWSPRYGVKGKIDLTVQVKINGKQKCEKVMPLELKTGKPSFSIEHQGQVTLYSLMSSDRRE-DPGGGLLLYLKDGSMK-TITADYAKKRGLLQLRNELVHYLS---LNTEKVESESGTTYHLPKLPRPINNPRSCSKCPQLLNC 701          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A087U8L7 (DNA2-like helicase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_11546 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.686e-43
Identity = 109/322 (33.85%), Postives = 180/322 (55.90%), Query Frame = 3
Query:  372 LKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL--LPPVLENNRFCGQCEYLTLC 1313
            LKTC          L G W + L+N+ +  NV+   K K+   I++N G +V+NPDFL++STA+  +LFC RK+V  +     S      M++G+ +H IFQ+   +   S ++I KI +  + +++ +LS      ++ EI +++  + P I  WI +  + S      + + + I DIE+++W  K+G+KGKID+T+      QS   ++PLELKTG+ +FS +H  QV LY+LM+ + R  ++  GLLLY++DG +  VI + H +   ++ LRNELA Y  ++         D  +  LP  + + R C +C YL  C
Sbjct:  100 LKTCV---------LRGFWMDTLVNDGDFVNVLEDFKNKQA-VIDDNNGFLVVNPDFLVSSTAVVSTLFCMRKAVLNYILPKWS-PGNSIMIIGSLVHDIFQQAVNKHVNSAEEIVKIIEKVMKKQENLLSLCCQNLTEEEIKEKVIKFVPHIYDWIIKYCNFSGKSGSESIQVTEIRDIEDNVWCPKFGIKGKIDLTVNAVLRNQSIPKLMPLELKTGRPTFSAEHVGQVNLYSLMLEE-RTKEVSDGLLLYLRDGVDMKVIQSNHNSRRGLIQLRNELAFYAHKWSACALQENEDIEMCHLPNPINDKRLCEKCPYLLPC 409          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A4Y2AMJ2 (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Araneus ventricosus OX=182803 GN=DNA2 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.928e-42
Identity = 106/307 (34.53%), Postives = 173/307 (56.35%), Query Frame = 3
Query:  414 LEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTL----QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLT---NPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            L+G W + L+N  +  +V+   +      I+N+ G +VINPDFLL+STA+  +LFC RK+   H     S      M++G+ +H IFQ+       S  +I  I +  L + + ++     E S+ EI ++++ Y P I  WI ++ +        + + + +  IE++IWS KYG+KGKIDMT+    Q    I+PLELKTG++++S +H  QV LY LMM + R  ++  GLLLY++D +   ++   H +   ++ LRNELA Y S+++    + P + +    LP  L + +FCG+C YL  C
Sbjct:  410 LKGFWTDSLVNVGDSVHVLKEFENNHTV-IDNHSGFLVINPDFLLSSTAVVSTLFCMRKAALNHILPKWSS-GNNVMMIGSLVHDIFQQAVNNHISSSREINDILEKVLKKRENLICLSCQESSEAEIREKVQEYVPSIANWIQKHCTFKGKVPANSLQVTQVEGIEDNIWSPKYGIKGKIDMTVRTSFQQATKILPLELKTGRSTYSAEHIGQVNLYILMMEE-RTKEMSDGLLLYLRDVANMKLVTADHNSRRGLIQLRNELAFYTSKWMQRNFDAPDIEHCH--LPKPLNSKKFCGKCPYLLPC 711          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A3R7SQB9 (Putative DNA replication ATP-dependent helicase/nuclease DNA2-like OS=Penaeus vannamei OX=6689 GN=C7M84_011059 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 2.162e-41
Identity = 96/309 (31.07%), Postives = 169/309 (54.69%), Query Frame = 3
Query:  414 LEGLWANCLINENEICNVINPIKTKE-NWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTLQSGE----SIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNL----LPPVLENNRFCGQCEYLTLC 1313
            L G W+  +++E +I +++    +++ ++ +NN QGLIVINPDFL++ T++   +FC+RK+V    F  +     + M++G+ +H +FQ+  K++  S ++++ + +  + Q K +   Y    S+  I +E+  + P I  W  R ++   +                     K+G+KGKIDMT+++ +     +VPLELKTG++SFS +H  QV LY++M +D R+ D  +GLLLY++DG+ + V          ++ LRNE+  Y    LT  P    D  L    LP  +++ R C +C +L  C
Sbjct:  483 LGGFWSQSMVSEGDIVHILYTEASEDGHFTVNNTQGLIVINPDFLISGTSVVSGVFCRRKAVLNERFRGLD-PGNQLMLIGSLVHELFQEVVKKKIKSREQLEHLVRELMSQPKMLQEMYGLGVSEAHIYEEMNNFIPHINTWSQRYLATENY---------------------KFGVKGKIDMTVKTNQRGITKVVPLELKTGRSSFSAEHKGQVTLYSMMSAD-RRHDPRAGLLLYLRDGAMEEVPAGEREKR-GLIQLRNEMIYY----LTAKPMKQEDGELKLPSLPEPIDSERACTKCAHLLTC 763          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:103040169])

HSP 1 Score: 138.272 bits (347), Expect = 2.689e-34
Identity = 89/296 (30.07%), Postives = 150/296 (50.68%), Query Frame = 3
Query:  492 NWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWI--YRNISQSEHDKRTNTKKXXXXXXXXXXXXV-----------------KYGMKGKIDMTL---------QSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQC 1295
             W I  + G +V+ PD L++ T+I  S+ C R++V    F    G SK+ M+ GT +H +FQK +   + S  K+ K+    L+    +   Y  + +  ++ +E+E Y P + +W   Y + SQ    K+ + K  S   +     S                  ++G+KGKID+T          +  + +VPLELKTGK S S +H SQV+LYTLM S+ R+ D ++G L+Y+K G+  P++ N H +   ++ LRN LA+++ + +       +    LP V+ + + C  C
Sbjct:  442 TWVIGRDSGFLVLLPDLLISGTSIASSIRCMRRAVLGEMFKSFDGGSKQ-MLNGTIVHDVFQKAAMSMDFSSAKLAKLASEALLSLNYLGQMYSLKLTQADMKQEVEEYLPALSEWAKAYLHTSQHAGKKQLSLKLPSDGQLSRQDSSCSITVTDFVDIEENIWSPRFGLKGKIDVTAGVRIHRKGRKHMDKVVPLELKTGKESNSIEHRSQVILYTLMSSE-RRVDAEAGFLVYLKTGNLHPIVGN-HMDRRELIKLRNLLAHHVGKSIVKENG-KSQMAPLPAVVSDQQTCKYC 733          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 134.806 bits (338), Expect = 5.853e-34
Identity = 95/355 (26.76%), Postives = 164/355 (46.20%), Query Frame = 3
Query:  315 YRVVVIEIDSRDETI------KRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVIN----PIKTKEN----------WKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNIS------QSEHDKRTN---TKKXXXXXXXXXXXXV-------------KYGMKGKIDMT--------LQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPP 1229
            YRVV +    RD  +      + L+L    + G  +   L+  WA   ++  ++ ++      P++  E            ++ N+ G +V+NPD LL+ T +T  + C R++V    F        + M+LGT +H +FQ+ + +++ S   ++      L Q + +   Y+   S  E++ E+E YF  I +W  R +        + H  R     T+++   D      SV             ++G+KGK+D           +     VPLELKTGK S S +H +QV+LYT +++  R  D   G LLY+K G   PV  +R  ++  ++ LRN+LA+ L+  +  PP
Sbjct:   17 YRVVAL----RDLPLGAWRSERHLSLTANPSGGASLTCVLKDDWALAPVSVGDVLHLDGAVEVPLRGGEEATCASVTAAVLEVTNDAGFVVVNPDLLLSGTTVTNGIRCPRRAVLSERFKGGGEWGTRQMLLGTLLHEVFQRAALQRDFSDAALRSAASATLAQLQHLAEMYKLGVSQAELLGEMEEYFSAIGRWASRYLEGGPEPNSASHGLRMPIKITRRAGEGDASACTVSVCHLGDVEESVWSPRFGLKGKVDAMATVRIHRRARCDGKKVPLELKTGKESQSIEHKAQVVLYTTLLTQERWGDPGLGFLLYLKSGGMHPVPASRL-DMRELIKLRNQLAHSLANGVWWPP 366          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Yeast
Match: DNA2 (Tripartite DNA replication factor; single-stranded DNA-dependent ATPase, ATP-dependent nuclease, helicase; tracking protein for flap cleavage during Okazaki fragment maturation; involved in DNA repair/processing of meiotic DNA double strand breaks; component of telomeric chromatin with cell-cycle dependent localization; required for telomerase-dependent telomere synthesis; forms nuclear foci upon DNA replication stress; human homolog DNA2 complements yeast dna2 mutant [Source:SGD;Acc:S000001207])

HSP 1 Score: 83.1889 bits (204), Expect = 2.819e-17
Identity = 81/295 (27.46%), Postives = 138/295 (46.78%), Query Frame = 3
Query:  510 NQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQE-KQMLSFY---------ESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXVK---------YGMKGKIDMTLQSG-----ESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLCFSL 1322
            N  L+V+NPD L ++T++  S+ C R+S+ Q  F D  G+    M LG  +H + Q   K + LS +   KI+   +IQ+   +L  Y         E ++    +MKE   +   IL ++ + +S+S +   T+   +           +          YG+KG +D T+++      + IVPLE+KTGK S S  +  Q L+YTL+++D  +  I+  LL + +D +     +  H ++  I+M RN ++      L      A     LPP+L ++  C  C     C  L
Sbjct:  496 NDNLLVLNPDVLFSATSVGSSVGCLRRSILQMQFQDPRGEPSLVMTLGNIVHELLQDSIKYK-LSHN---KISMEIIIQKLDSLLETYSFSIIICNEEIQYVKELVMKE---HAENILYFVNKFVSKSNYGCYTSISGTRRTQPISISNVIDIEENIWSPIYGLKGFLDATVEANVENNKKHIVPLEVKTGK-SRSVSYEVQGLIYTLLLNDRYEIPIEFFLLYFTRDKNMTKFPSVLH-SIKHILMSRNRMSMNFKHQLQEVFGQAQSRFELPPLLRDSS-CDSCFIKESCMVL 780          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Match: EDO44587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV67])

HSP 1 Score: 93.5893 bits (231), Expect = 3.096e-21
Identity = 69/275 (25.09%), Postives = 125/275 (45.45%), Query Frame = 3
Query:  426 WANCLINENEICNVINPIKTKENWKINNNQG--LIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNI---------SQSEHDKRTNTKKXXXXXXXXXXX--------XVKYGMKGKIDMTLQS-------------------GESIVPLELKTGKTSFSR----DHTSQVLLYTLMMSDARQTDIDSGLLLYIKDG 1124
            W    +   +I +V           I +N     I+++PD L++ T I G+  C R+S+    F   +  + ++M++GT +H +F +  K  + S D +    +  L Q   +  FY    ++ + + +++   P   +W +R +         +    D   +T  + +  +  S          S ++G+KGK+D T++                      + VPLELKTGK  FS+    +H +QV+LYTL++SD  +  ID+GLL Y+K G
Sbjct:   36 WEGTDVEPGDIVHVTGVFDINSGVCILDNTANNYIIVHPDTLISGTTIAGATRCLRRSILNERFR--TEDANEAMLMGTLLHDLFDRAMKSNDFSHDALLCAVQGLLEQFTYLDGFYGLGMTECDALNKVKELLPAFSEWAWRYVCDLPDPDLSTMDYKDGSCDTGGTEMPSVCVSQLRDIEENVWSPRFGLKGKVDATVEVKIDRRPMSRRHRPGMDNHLTTASVPLELKTGKL-FSKLGSVEHRAQVILYTLLLSDRYRHGIDTGLLYYMKSG 307          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Match: dna2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:101165382])

HSP 1 Score: 131.724 bits (330), Expect = 5.008e-32
Identity = 92/296 (31.08%), Postives = 147/296 (49.66%), Query Frame = 3
Query:  495 WKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHD----KRTNTKKXXXXXXXXXXXXV--------------KYGMKGKIDMTLQ-----------SGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQC 1295
            W +  +QGL+V+ PD L++ T+I+ S+ C R++V    F    G SK+ M+ GT +H +FQ  +K ++ S +K+ K+    L   + +   Y    S  E+ +EL  Y P +  W    +S S+      K  N  ++     E +                  ++G+KGKID+T Q             E   PLELKTG+ S S +H SQV+LYTLM     + + ++GLLLY+K GS  PV  + H +   ++ LRN LA++L   +     ++N    LP +L + + C  C
Sbjct:  407 WLVERDQGLLVLQPDSLISGTSISNSIRCMRRAVLGEMFKSFDGGSKQ-MLNGTMVHEVFQGAAKAKDFSSEKLFKLADEALHSPRYLGDMYTLGVSQEEMKQELLDYLPSLENWASEYLSSSKPKSIGLKILNPSRAPGGCQESNAVVTVTDLTDIEENVWSPRFGLKGKIDVTAQVQIQRPRTSRSPEEKTFPLELKTGRESNSIEHRSQVILYTLM--SMERYNPEAGLLLYLKTGSMHPVAPS-HMDRRELLKLRNTLAHHLHNSVEKGADLSN-LQRLPDILTSRQTCQYC 697          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Match: SMESG000052537.1 (SMESG000052537.1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 422/426 (99.06%), Postives = 423/426 (99.30%), Query Frame = 3
Query:   36 MKIKDSQDKEXXXXXXXXXXXXXXXXXXXXLNENKKRISNNNDFLEXXXXXXXXXXXXVEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFYRVVVIEIDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTLQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            MKIKDSQDKENLASSNNSALKSKPIISKIILNENKKRISNNNDFLENKKIKFSNINKSVEKFDFDDSFEFDENL+NEIEKENINPEIIQIQDFYRVVVIEIDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIM ELEIYFPQILQWIYRNISQSEHDKR N KKSSIIDIEESIWSVKYGMKGKIDMTLQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC
Sbjct:    1 MKIKDSQDKENLASSNNSALKSKPIISKIILNENKKRISNNNDFLENKKIKFSNINKSVEKFDFDDSFEFDENLINEIEKENINPEIIQIQDFYRVVVIEIDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMIELEIYFPQILQWIYRNISQSEHDKRINMKKSSIIDIEESIWSVKYGMKGKIDMTLQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 426          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Match: SMESG000005730.1 (SMESG000005730.1)

HSP 1 Score: 332.028 bits (850), Expect = 1.297e-102
Identity = 163/335 (48.66%), Postives = 251/335 (74.93%), Query Frame = 3
Query:  309 DFYRVVVIEIDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKXXXXXXXXXXXXVKYGMKGKIDMTLQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLC 1313
            DFY  VV  ++S    +K+LT+   +N   Q+KL+L+G+W + +++  +IC++++PIK+   W INN++G++V+NP +L+++T++TGSLFCQRK V QH+F+ +SG+S K+MV+G+FIH IFQ+C + ++L ++++++I K    Q  Q+++FYES ++D EI++E+E+YFP+IL+WI RN+S     K+    K  +IDIEE+IWS KYG+KGKID+TLQ+ ES +PLELKTG+T+FSR+HT QVLLY LMMSD  + +ID GLLLYIKDG+E+ + N+  P+VIS + +RNEL N++ +F ++      + + LP V+ N R C  CEYL+LC
Sbjct:  169 DFYYCVVNNVESVC-NVKQLTVTLQDNYKCQVKLHLDGMWEDTVVHVRDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLS-----KKPEISKMQVIDIEENIWSTKYGIKGKIDVTLQTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQ---LTNADCLPSVITNIRLCQSCEYLSLC 494          
The following BLAST results are available for this feature:
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DNA21.142e-3131.35DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
DNA21.142e-3131.35DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
DNA22.121e-3131.35DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
DNA22.639e-3131.35DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dna-21.116e-3231.72Yeast DNA helicase/endonuclease family [Source:Un... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG29902.528e-3034.38gene:FBgn0030170 transcript:FBtr0112971[more]
CG29901.251e-2934.60gene:FBgn0030170 transcript:FBtr0071415[more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX530068.21.093e-3429.31DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
dna21.210e-3429.31DNA replication helicase/nuclease 2 [Source:ZFIN;A... [more]
BX890597.21.302e-3429.31DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
BX530068.21.315e-3429.31DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
BX890597.21.352e-3429.31DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNA21.042e-3130.62DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA25.677e-3129.65DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA21.948e-3029.56DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA22.109e-3029.62DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA22.510e-3027.65DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dna24.761e-3329.36DNA replication helicase/nuclease 2 [Source:MGI Sy... [more]
Dna25.047e-3329.36DNA replication helicase/nuclease 2 [Source:MGI Sy... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZKG3|DNA2_CHICK1.415e-3529.56DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|Q6ZQJ5|DNA2_MOUSE3.530e-3229.36DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|P51530|DNA2_HUMAN1.267e-3031.35DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|D3ZG52|DNA2_RAT2.236e-3028.18DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|Q8QHA5|DNA2_XENLA7.890e-3028.45DNA replication ATP-dependent helicase/nuclease DN... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1IXE83.903e-4634.26Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A1S3GZW95.534e-4432.86DNA replication ATP-dependent helicase/nuclease DN... [more]
A0A087U8L75.686e-4333.85DNA2-like helicase (Fragment) OS=Stegodyphus mimos... [more]
A0A4Y2AMJ22.928e-4234.53DNA replication ATP-dependent helicase/nuclease DN... [more]
A0A3R7SQB92.162e-4131.07Putative DNA replication ATP-dependent helicase/nu... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNA22.689e-3430.07DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNA25.853e-3426.76DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DNA22.819e-1727.46Tripartite DNA replication factor; single-stranded... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445873.096e-2125.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dna25.008e-3231.08DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000052537.10.000e+099.06SMESG000052537.1[more]
SMESG000005730.11.297e-10248.66SMESG000005730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025533 ID=SMED30025533|Name=DNA replication ATP-dependent helicase/nuclease DNA2|organism=Schmidtea mediterranea sexual|type=transcript|length=1483bp
CGAATATTTAATTAAATTTAAAACTTTTATTTAGAATGAAAATTAAAGAT
TCTCAGGACAAAGAAAATTTGGCTTCTTCAAATAATAGTGCTTTGAAATC
AAAACCGATTATTTCTAAAATCATTTTAAATGAAAATAAGAAGCGAATAT
CAAATAATAATGATTTTCTCGAGAATAAGAAAATTAAATTTTCAAATATC
AATAAATCGGTTGAAAAATTTGATTTCGACGATAGCTTTGAATTTGACGA
AAATTTATTAAATGAAATTGAGAAGGAAAATATTAATCCTGAAATCATTC
AAATTCAAGATTTTTACCGAGTTGTTGTAATAGAAATAGATTCTCGAGAT
GAAACCATTAAACGTTTGACATTGAAAACATGTGAGAATAATGGCTATCA
AATAAAATTAAATCTTGAAGGATTATGGGCAAATTGTCTTATAAACGAAA
ATGAAATTTGTAATGTTATAAATCCAATAAAAACGAAAGAGAATTGGAAG
ATAAACAATAACCAAGGATTAATTGTCATAAATCCGGATTTTCTGTTAAA
TAGTACCGCTATCACCGGATCACTATTTTGTCAAAGGAAATCTGTCTTCC
AGCATTATTTTACTGATATTTCCGGTAAAAGCAAAAAGTCCATGGTTTTA
GGAACATTTATTCATTCCATTTTCCAAAAATGTTCCAAAGAACAAAATTT
AAGCATTGACAAAATTAAAAAAATAACTAAAAATTTCTTGATTCAAGAAA
AGCAAATGCTCTCGTTTTACGAATCGGAATTCTCCGATAATGAAATAATG
AAAGAATTGGAAATATATTTCCCTCAGATTCTTCAATGGATTTATCGGAA
TATCAGCCAATCAGAACACGATAAGAGAACAAACACGAAAAAGTCCTCAA
TAATCGATATTGAAGAAAGCATTTGGTCGGTAAAATACGGAATGAAAGGA
AAAATCGATATGACTCTGCAATCGGGAGAATCGATAGTGCCGTTGGAATT
GAAAACTGGGAAAACCTCATTTTCCCGGGATCACACGAGTCAAGTGCTGC
TGTACACGCTAATGATGAGCGACGCCCGGCAAACCGATATCGATTCTGGA
TTGCTGCTGTACATCAAGGACGGATCAGAGAAACCGGTAATCAATAACAG
GCACCCGAATGTAATCAGCATAGTGATGCTGAGAAATGAATTAGCGAATT
ATCTCTCGAGATTTCTCACCAATCCGCCGCCAGTGGCAAATGACACAAAT
CTGCTGCCGCCCGTTCTGGAAAACAATCGATTCTGTGGCCAGTGCGAGTA
TCTGACATTGTGTTTTAGCCTGTTTTAGGGGCAATTGTTCTTGGGCTCGT
TTGCCCCTTTCTAACACTACTTATATGTTTATATACAGTTAATCGTACAT
TGTATTATTATCGAAATATTACTATTTTTATTACTAGGTTATACCCGGGA
TAATTTCAAATGCATTCTTTACTTATATTATTT
back to top

protein sequence of SMED30025533-orf-1

>SMED30025533-orf-1 ID=SMED30025533-orf-1|Name=SMED30025533-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=431bp
MKIKDSQDKENLASSNNSALKSKPIISKIILNENKKRISNNNDFLENKKI
KFSNINKSVEKFDFDDSFEFDENLLNEIEKENINPEIIQIQDFYRVVVIE
IDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKT
KENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSK
KSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFS
DNEIMKELEIYFPQILQWIYRNISQSEHDKRTNTKKSSIIDIEESIWSVK
YGMKGKIDMTLQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQT
DIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPV
ANDTNLLPPVLENNRFCGQCEYLTLCFSLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0017116single-stranded DNA-dependent ATP-dependent DNA helicase activity
GO:0004386helicase activity
GO:00171085'-flap endonuclease activity
GO:0043142single-stranded DNA-dependent ATPase activity
Vocabulary: biological process
TermDefinition
GO:0032508DNA duplex unwinding
GO:0030071regulation of mitotic metaphase/anaphase transition
GO:0031145anaphase-promoting complex-dependent catabolic process
GO:0033567DNA replication, Okazaki fragment processing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR011604Exonuc_phg/RecB_C
IPR014808DNA_replication_fac_Dna2_N
IPR011335Restrct_endonuc-II-like
Vocabulary: cellular component
TermDefinition
GO:0005680anaphase-promoting complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 28..48
IPR014808DNA replication factor Dna2, N-terminalPFAMPF08696Dna2coord: 118..312
e-value: 9.5E-44
score: 149.6
IPR011604Exonuclease, phage-type/RecB, C-terminalGENE3DG3DSA:3.90.320.10coord: 261..403
e-value: 5.3E-7
score: 31.4
IPR011335Restriction endonuclease type II-likeSUPERFAMILYSSF52980Restriction endonuclease-likecoord: 199..347