Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30025532
Length (bp)1933
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30025532) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30025532) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30025532) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30025532) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025532

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025532SMESG000004031.1 SmedASXL_010354SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30025532SMESG000004031.1 Contig41447newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025532SMESG000004031.1 Contig41447uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30025532SMESG000004031.1 dd_Smed_v4_11039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025532SMESG000004031.1 dd_Smed_v4_11039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025532SMESG000004031.1 dd_Smed_v4_11039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025532SMESG000004031.1 dd_Smed_v4_11039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025532SMESG000004031.1 dd_Smed_v4_45188_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025532SMESG000004031.1 dd_Smed_v6_45188_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025532SMESG000004031.1 dd_Smed_v6_11039_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30025532SMESG000004031.1 SMED30025532smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30025532SMESG000004031.1 Contig30333newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025532SMESG000004031.1 Contig30333uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025532SMESG000004031.1 Contig41447newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025532SMESG000004031.1 Contig41447uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025532SMESG000004031.1 Contig44856newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025532SMESG000004031.1 Contig44856uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30025532SMESG000004031.1 dd_Smed_v4_11039_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE1C (phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:8776])

HSP 1 Score: 452.21 bits (1162), Expect = 4.556e-151
Identity = 214/460 (46.52%), Postives = 308/460 (66.96%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ----------------------------------MAQNNKEPIQN---DEDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++ +E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                          PI N     D+   +  W + ++ N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALK-DVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE1C (phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:8776])

HSP 1 Score: 452.21 bits (1162), Expect = 4.556e-151
Identity = 214/460 (46.52%), Postives = 308/460 (66.96%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ----------------------------------MAQNNKEPIQN---DEDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++ +E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                          PI N     D+   +  W + ++ N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALK-DVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE1C (phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:8776])

HSP 1 Score: 451.44 bits (1160), Expect = 8.944e-150
Identity = 214/460 (46.52%), Postives = 308/460 (66.96%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ----------------------------------MAQNNKEPIQN---DEDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++ +E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                          PI N     D+   +  W + ++ N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALK-DVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE1C (phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:8776])

HSP 1 Score: 451.44 bits (1160), Expect = 8.944e-150
Identity = 214/460 (46.52%), Postives = 308/460 (66.96%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ----------------------------------MAQNNKEPIQN---DEDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++ +E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                          PI N     D+   +  W + ++ N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALK-DVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE1B (phosphodiesterase 1B [Source:HGNC Symbol;Acc:HGNC:8775])

HSP 1 Score: 443.736 bits (1140), Expect = 1.295e-149
Identity = 214/436 (49.08%), Postives = 307/436 (70.41%), Query Frame = 3
Query:  576 VLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDF--------TKVQRP----------WIQCINENKEAWKIRA 1826
            +LE+ YI+E ++I + +D+     + +VP EVR+WL++TFT++  +   + +EKPKFRS+ +A++AGI VER++RR  +S G      V+  +K  LD W F+VF +++A+++H+L+ + +EL  ++N++++FKI +V L +FL  LE GY K+ NPYH+  HAADV QT H  + ++G+   ++++E+LA++FAA IHDYEHTGTTN FH+ + S+ A++YNDR VLENHHISSVFRL++++   IF  LTK+E+ ELR LVIE+VL TDMS HFQQ+K MKT L   E ++K KA SLL+H ADISHPTKQW +H +WT  L+EEFFRQGD+E ELGL  SPLCDR +T+VAQSQIGFIDFIVEP+F +L D+ ++ +Q   +     +N   F         +V  P          W++ I ENK+ WK RA
Sbjct:   25 LLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLK-NLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERA 459          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-1 (Probable 3',5'-cyclic phosphodiesterase pde-1 [Source:UniProtKB/Swiss-Prot;Acc:O18696])

HSP 1 Score: 462.611 bits (1189), Expect = 6.632e-157
Identity = 217/383 (56.66%), Postives = 288/383 (75.20%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ 1715
            A LVLE+AY++E +RIC+EDDD       +VPDEVREWL+ TFTR+ +    K +KPKF+SVANAIR GI  E+++R+       PIPP +  LMK  + +W+F+ F+++E SE H+LKY+G+ELF++Y  M +FK+    LEN+L  LE GY+K +NPYH+  HAADV Q+ H ++SQ+GL+  + DLE+LAVLF ALIHDYEHTG TN FH+ S S  A+LYNDR VLENHH+SS FRL++E+   I   LT++EYKELR +VIEIVL TDMS HF Q+K MK++L++PE ++K KA  L+VH  DISHP K W+LHE+WT  ++EEFFRQGD E  +GL  SPLCDR+T  VA SQIGFIDFIVEP+ V+ G++L +M++
Sbjct:   46 AALVLETAYMDETRRICDEDDDLAEVTPETVPDEVREWLAATFTRQNA--GKKRDKPKFKSVANAIRTGIFFEKLFRK-QQVVQCPIPPEIAELMKE-VCTWSFSPFQLNEVSEGHALKYVGFELFNRYGFMDRFKVPLTALENYLSALEVGYSKHNNPYHNVVHAADVTQSSHFMLSQTGLANSLGDLELLAVLFGALIHDYEHTGHTNNFHIQSQSQFAMLYNDRSVLENHHVSSCFRLMKEDDKNILTHLTRDEYKELRNMVIEIVLATDMSTHFMQIKTMKSMLSLPEGIDKNKALCLIVHACDISHPAKPWNLHERWTEGVLEEFFRQGDLEASMGLPYSPLCDRHTVHVADSQIGFIDFIVEPTMVVCGELLVKMVE 424          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-1 (Probable 3',5'-cyclic phosphodiesterase pde-1 [Source:UniProtKB/Swiss-Prot;Acc:O18696])

HSP 1 Score: 464.537 bits (1194), Expect = 7.246e-156
Identity = 217/383 (56.66%), Postives = 288/383 (75.20%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ 1715
            A LVLE+AY++E +RIC+EDDD       +VPDEVREWL+ TFTR+ +    K +KPKF+SVANAIR GI  E+++R+       PIPP +  LMK  + +W+F+ F+++E SE H+LKY+G+ELF++Y  M +FK+    LEN+L  LE GY+K +NPYH+  HAADV Q+ H ++SQ+GL+  + DLE+LAVLF ALIHDYEHTG TN FH+ S S  A+LYNDR VLENHH+SS FRL++E+   I   LT++EYKELR +VIEIVL TDMS HF Q+K MK++L++PE ++K KA  L+VH  DISHP K W+LHE+WT  ++EEFFRQGD E  +GL  SPLCDR+T  VA SQIGFIDFIVEP+ V+ G++L +M++
Sbjct:  177 AALVLETAYMDETRRICDEDDDLAEVTPETVPDEVREWLAATFTRQNA--GKKRDKPKFKSVANAIRTGIFFEKLFRKQQV-VQCPIPPEIAELMKE-VCTWSFSPFQLNEVSEGHALKYVGFELFNRYGFMDRFKVPLTALENYLSALEVGYSKHNNPYHNVVHAADVTQSSHFMLSQTGLANSLGDLELLAVLFGALIHDYEHTGHTNNFHIQSQSQFAMLYNDRSVLENHHVSSCFRLMKEDDKNILTHLTRDEYKELRNMVIEIVLATDMSTHFMQIKTMKSMLSLPEGIDKNKALCLIVHACDISHPAKPWNLHERWTEGVLEEFFRQGDLEASMGLPYSPLCDRHTVHVADSQIGFIDFIVEPTMVVCGELLVKMVE 555          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 240.736 bits (613), Expect = 2.557e-71
Identity = 116/291 (39.86%), Postives = 186/291 (63.92%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE----NV-------EKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            LD W  +VF++DE S+NHSL  + + L  + N+   F+I    L  +L  LE  Y   +N YH+F HAADVAQ+ H+++    L+   TDLE+LA +FA  +HD +H G TN + +NS+++LA++YND  VLE HH++  F+L+++ +      L++++  + R +VI++VL TDMS H   L ++KT++   +    NV       +KI+    ++H AD+S+PTK   L+++W   ++EE++RQGD+EKELGL  SP+CDR    + +SQ+GFID+IV P +    D++
Sbjct:  222 LDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHYR--NNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLV 510          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 241.121 bits (614), Expect = 8.618e-71
Identity = 116/291 (39.86%), Postives = 186/291 (63.92%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE----NV-------EKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            LD W  +VF++DE S+NHSL  + + L  + N+   F+I    L  +L  LE  Y   +N YH+F HAADVAQ+ H+++    L+   TDLE+LA +FA  +HD +H G TN + +NS+++LA++YND  VLE HH++  F+L+++ +      L++++  + R +VI++VL TDMS H   L ++KT++   +    NV       +KI+    ++H AD+S+PTK   L+++W   ++EE++RQGD+EKELGL  SP+CDR    + +SQ+GFID+IV P +    D++
Sbjct:  285 LDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHYR--NNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLV 573          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 240.736 bits (613), Expect = 8.732e-71
Identity = 116/291 (39.86%), Postives = 186/291 (63.92%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE----NV-------EKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            LD W  +VF++DE S+NHSL  + + L  + N+   F+I    L  +L  LE  Y   +N YH+F HAADVAQ+ H+++    L+   TDLE+LA +FA  +HD +H G TN + +NS+++LA++YND  VLE HH++  F+L+++ +      L++++  + R +VI++VL TDMS H   L ++KT++   +    NV       +KI+    ++H AD+S+PTK   L+++W   ++EE++RQGD+EKELGL  SP+CDR    + +SQ+GFID+IV P +    D++
Sbjct:  272 LDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHYR--NNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLV 560          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde1c (gene:FBgn0264815 transcript:FBtr0334135)

HSP 1 Score: 468.003 bits (1203), Expect = 1.257e-153
Identity = 222/384 (57.81%), Postives = 290/384 (75.52%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE-NVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  VLE+ +I+E++R+ +EDD+       +VP EVREWL++TFTR+ +++  K DEKPKFRSVA+AIRAGI V+R+YRR+SSSA    PP+V+ L+K  LD W F+VF + EA+    +KY+ YELF++Y  + KFKI   ILE FL ++E+GY ++ NPYH+  HA DV QT H  +  +GL  W+TDLEI A L AAL+HDYEHTGTTN FHV S S+ ALLYNDR VLENHH S+ FRL+RE+ Y I   L++EE++ELR LVIE+VL TDM+ HFQQ+K M+ LL + E  ++K K  SL++HC DISHP KQW +H +WT+LL+EEFFRQGD EKELGL  SPLCDRN T+VA+SQI FIDFIVEPS  ++ DML+ ++
Sbjct:  427 AARVLEAVFIDESRRLADEDDELSEVQPDAVPPEVREWLASTFTRQMATSRRKSDEKPKFRSVAHAIRAGIFVDRMYRRVSSSALTAFPPDVVRLLK-NLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHRVEEGYCRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFHVMSGSETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHFQQMKAMRQLLTLQEATIDKQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLEKELGLPFSPLCDRNNTLVAESQICFIDFIVEPSMGVMSDMLELIL 809          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde1c (gene:FBgn0264815 transcript:FBtr0334137)

HSP 1 Score: 455.677 bits (1171), Expect = 4.203e-153
Identity = 219/379 (57.78%), Postives = 284/379 (74.93%), Query Frame = 3
Query:  606 KRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE-NVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ-MAQNNK 1733
            +R+ +EDD+       +VP EVREWL++TFTR+ +++  K DEKPKFRSVA+AIRAGI V+R+YRR+SSSA    PP+V+ L+K  LD W F+VF + EA+    +KY+ YELF++Y  + KFKI   ILE FL ++E+GY ++ NPYH+  HA DV QT H  +  +GL  W+TDLEI A L AAL+HDYEHTGTTN FHV S S+ ALLYNDR VLENHH S+ FRL+RE+ Y I   L++EE++ELR LVIE+VL TDM+ HFQQ+K M+ LL + E  ++K K  SL++HC DISHP KQW +H +WT+LL+EEFFRQGD EKELGL  SPLCDRN T+VA+SQI FIDFIVEPS  ++ DML+ ++  +A  NK
Sbjct:   93 RRLADEDDELSEVQPDAVPPEVREWLASTFTRQMATSRRKSDEKPKFRSVAHAIRAGIFVDRMYRRVSSSALTAFPPDVVRLLK-NLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHRVEEGYCRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFHVMSGSETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHFQQMKAMRQLLTLQEATIDKQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLEKELGLPFSPLCDRNNTLVAESQICFIDFIVEPSMGVMSDMLELILAPIAPMNK 470          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde1c (gene:FBgn0264815 transcript:FBtr0334136)

HSP 1 Score: 454.136 bits (1167), Expect = 1.237e-149
Identity = 216/370 (58.38%), Postives = 279/370 (75.41%), Query Frame = 3
Query:  609 RICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE-NVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            R+ +EDD+       +VP EVREWL++TFTR+ +++  K DEKPKFRSVA+AIRAGI V+R+YRR+SSSA    PP+V+ L+K  LD W F+VF + EA+    +KY+ YELF++Y  + KFKI   ILE FL ++E+GY ++ NPYH+  HA DV QT H  +  +GL  W+TDLEI A L AAL+HDYEHTGTTN FHV S S+ ALLYNDR VLENHH S+ FRL+RE+ Y I   L++EE++ELR LVIE+VL TDM+ HFQQ+K M+ LL + E  ++K K  SL++HC DISHP KQW +H +WT+LL+EEFFRQGD EKELGL  SPLCDRN T+VA+SQI FIDFIVEPS  ++ DML+ ++
Sbjct:  323 RLADEDDELSEVQPDAVPPEVREWLASTFTRQMATSRRKSDEKPKFRSVAHAIRAGIFVDRMYRRVSSSALTAFPPDVVRLLK-NLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHRVEEGYCRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFHVMSGSETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHFQQMKAMRQLLTLQEATIDKQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLEKELGLPFSPLCDRNNTLVAESQICFIDFIVEPSMGVMSDMLELIL 691          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde1c (gene:FBgn0264815 transcript:FBtr0334140)

HSP 1 Score: 454.136 bits (1167), Expect = 1.237e-149
Identity = 216/370 (58.38%), Postives = 279/370 (75.41%), Query Frame = 3
Query:  609 RICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE-NVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            R+ +EDD+       +VP EVREWL++TFTR+ +++  K DEKPKFRSVA+AIRAGI V+R+YRR+SSSA    PP+V+ L+K  LD W F+VF + EA+    +KY+ YELF++Y  + KFKI   ILE FL ++E+GY ++ NPYH+  HA DV QT H  +  +GL  W+TDLEI A L AAL+HDYEHTGTTN FHV S S+ ALLYNDR VLENHH S+ FRL+RE+ Y I   L++EE++ELR LVIE+VL TDM+ HFQQ+K M+ LL + E  ++K K  SL++HC DISHP KQW +H +WT+LL+EEFFRQGD EKELGL  SPLCDRN T+VA+SQI FIDFIVEPS  ++ DML+ ++
Sbjct:  323 RLADEDDELSEVQPDAVPPEVREWLASTFTRQMATSRRKSDEKPKFRSVAHAIRAGIFVDRMYRRVSSSALTAFPPDVVRLLK-NLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHRVEEGYCRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFHVMSGSETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHFQQMKAMRQLLTLQEATIDKQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLEKELGLPFSPLCDRNNTLVAESQICFIDFIVEPSMGVMSDMLELIL 691          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde1c (gene:FBgn0264815 transcript:FBtr0334142)

HSP 1 Score: 459.144 bits (1180), Expect = 1.708e-149
Identity = 218/380 (57.37%), Postives = 285/380 (75.00%), Query Frame = 3
Query:  579 LESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPE-NVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            + S+ +E  +R+ +EDD+       +VP EVREWL++TFTR+ +++  K DEKPKFRSVA+AIRAGI V+R+YRR+SSSA    PP+V+ L+K  LD W F+VF + EA+    +KY+ YELF++Y  + KFKI   ILE FL ++E+GY ++ NPYH+  HA DV QT H  +  +GL  W+TDLEI A L AAL+HDYEHTGTTN FHV S S+ ALLYNDR VLENHH S+ FRL+RE+ Y I   L++EE++ELR LVIE+VL TDM+ HFQQ+K M+ LL + E  ++K K  SL++HC DISHP KQW +H +WT+LL+EEFFRQGD EKELGL  SPLCDRN T+VA+SQI FIDFIVEPS  ++ DML+ ++
Sbjct:  488 IASSSVESEERLADEDDELSEVQPDAVPPEVREWLASTFTRQMATSRRKSDEKPKFRSVAHAIRAGIFVDRMYRRVSSSALTAFPPDVVRLLK-NLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHRVEEGYCRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFHVMSGSETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHFQQMKAMRQLLTLQEATIDKQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLEKELGLPFSPLCDRNNTLVAESQICFIDFIVEPSMGVMSDMLELIL 866          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 445.662 bits (1145), Expect = 2.535e-149
Identity = 202/383 (52.74%), Postives = 290/383 (75.72%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  VLE+ YI+E +R+ + +D+       SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+ AGL  PP+V+  +K  +D W+F+VF++ EAS +H+LK+L YEL  +Y+++++F+I    L +F++ LE GY+K  NPYH+  HAADV QT H ++  +G+  W+T+LEILA++FAA IHD+EHTGTTN FH+ + S++A+LYNDR VLENHH+S+ +RL++E+   I   L+K++++ELR LVIE+V++TDMS HFQQ+K M+  L  PE ++K KA SL++H ADISHP K W LH +WT  L+EEFFRQGD+E ELGL  SPLCDR  T++AQSQIGFIDFIVEP+F +L D  ++++
Sbjct:   43 AASVLEAVYIDETRRLLDTEDELSDIQADSVPMEVRDWLASTFTRKMGVVRRRPEEKPRFRSIVHAVQAGIFVERMYRRTSNMAGLTYPPSVITALK-DVDKWSFDVFKLQEASSDHALKFLVYELLTRYDLISRFRIPVSSLVSFVEALEIGYSKHRNPYHNLIHAADVTQTAHYLMLHTGVMHWLTELEILAMVFAAAIHDFEHTGTTNNFHIQTRSEVAILYNDRSVLENHHVSAAYRLMQEDEMNILVNLSKDDWRELRTLVIEMVMSTDMSCHFQQIKTMRNSLQQPEGIDKAKALSLMLHAADISHPAKGWKLHYRWTQALMEEFFRQGDKEAELGLPFSPLCDRKATMIAQSQIGFIDFIVEPTFSVLVDTTEKII 424          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 446.047 bits (1146), Expect = 4.334e-149
Identity = 202/383 (52.74%), Postives = 290/383 (75.72%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  VLE+ YI+E +R+ + +D+       SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+ AGL  PP+V+  +K  +D W+F+VF++ EAS +H+LK+L YEL  +Y+++++F+I    L +F++ LE GY+K  NPYH+  HAADV QT H ++  +G+  W+T+LEILA++FAA IHD+EHTGTTN FH+ + S++A+LYNDR VLENHH+S+ +RL++E+   I   L+K++++ELR LVIE+V++TDMS HFQQ+K M+  L  PE ++K KA SL++H ADISHP K W LH +WT  L+EEFFRQGD+E ELGL  SPLCDR  T++AQSQIGFIDFIVEP+F +L D  ++++
Sbjct:   67 AASVLEAVYIDETRRLLDTEDELSDIQADSVPMEVRDWLASTFTRKMGVVRRRPEEKPRFRSIVHAVQAGIFVERMYRRTSNMAGLTYPPSVITALK-DVDKWSFDVFKLQEASSDHALKFLVYELLTRYDLISRFRIPVSSLVSFVEALEIGYSKHRNPYHNLIHAADVTQTAHYLMLHTGVMHWLTELEILAMVFAAAIHDFEHTGTTNNFHIQTRSEVAILYNDRSVLENHHVSAAYRLMQEDEMNILVNLSKDDWRELRTLVIEMVMSTDMSCHFQQIKTMRNSLQQPEGIDKAKALSLMLHAADISHPAKGWKLHYRWTQALMEEFFRQGDKEAELGLPFSPLCDRKATMIAQSQIGFIDFIVEPTFSVLVDTTEKII 448          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: CABZ01067973.1 (phosphodiesterase 1C, calmodulin-dependent b [Source:NCBI gene;Acc:100536162])

HSP 1 Score: 443.351 bits (1139), Expect = 4.497e-148
Identity = 204/384 (53.12%), Postives = 289/384 (75.26%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREES-YQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  VLES YIEE +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PPNV+ ++K  +D W+F+VF ++E+S +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K+ NPYH+  HAADV QT H ++ ++G+  WMT+LEI A++FAA IHDYEHTGTTN FH+ + SD A+LYNDR VLE+HH+S+ +RL++++    I   L+K++++E R LV+E+VL TDMS HFQQ+K MK  L  PE ++K KA SLL+H ADISHP K W LH +WT  L+EEFF QGD+E ELGL  SPLCDR +T+VAQSQIGFIDFIV P+F +L DM ++++
Sbjct:   68 AATVLESVYIEETRRLVDTEDELSDIQSDSVPSEVRDWLASTFTRQMGLMLRRTEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPNVIAVLK-NVDRWSFDVFALNESSGDHALKFIFYELLTRYDLISRFKIPVSALVSFVEALEVGYSKYKNPYHNLIHAADVTQTVHYLLLKTGMVHWMTELEIFAMIFAAAIHDYEHTGTTNNFHIQTRSDAAILYNDRSVLESHHVSASYRLLQDDDEMNILYNLSKDDWREFRALVVEMVLATDMSCHFQQVKAMKNYLQQPEGIDKPKAISLLLHAADISHPAKTWDLHHRWTTSLLEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVVPTFTVLTDMTEKIV 450          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4d (phosphodiesterase 4D, cAMP-specific [Source:ZFIN;Acc:ZDB-GENE-081105-16])

HSP 1 Score: 249.98 bits (637), Expect = 2.027e-73
Identity = 124/291 (42.61%), Postives = 185/291 (63.57%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTL-----------LAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            ++ W  NVF+V E S N  L  + Y +F + +++  FKI       +L  LED Y      YH+  HAADV Q+ H+++S   L    TDLEILA +FA+ IHD +H G +N F +N++S+LAL+YND  VLENHH++  F+L++EE+  IF+ LTK++ + LR +VI+IVL TDMS H   L ++KT+           L +    ++I+    +VHCAD+S+PTK   L+ +WT  ++EEFF QGDRE+E G+  SP+CD++   V +SQ+GFID+IV P +    D++
Sbjct:  252 VNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHA-DVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLV 541          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4d (phosphodiesterase 4D, cAMP-specific [Source:ZFIN;Acc:ZDB-GENE-081105-16])

HSP 1 Score: 250.366 bits (638), Expect = 3.051e-73
Identity = 123/291 (42.27%), Postives = 185/291 (63.57%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENV-----------EKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            ++ W  NVF+V E S N  L  + Y +F + +++  FKI       +L  LED Y      YH+  HAADV Q+ H+++S   L    TDLEILA +FA+ IHD +H G +N F +N++S+LAL+YND  VLENHH++  F+L++EE+  IF+ LTK++ + LR +VI+IVL TDMS H   L ++KT++   +             ++I+    +VHCAD+S+PTK   L+ +WT  ++EEFF QGDRE+E G+  SP+CD++   V +SQ+GFID+IV P +    D++
Sbjct:  271 VNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHA-DVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLV 560          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: arhgef39 (Rho guanine nucleotide exchange factor 39 [Source:Xenbase;Acc:XB-GENE-6257690])

HSP 1 Score: 452.981 bits (1164), Expect = 1.119e-152
Identity = 220/459 (47.93%), Postives = 311/459 (67.76%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------QMAQNNKEPIQNDE-------------------------DFTKVQRPWIQCINENKEAWK 1817
            A  VLE+ YI+E +R+ + +D+       SVP EVR+WL++TFTR+      + +EKPKFRS+ +A++AGI VER+YRR S+ AGL  P +V+  MK  +D W FNVF ++EAS  H+LK++ YELF +Y++  +FKI    L +F++ LE GY+K+ NPYH+  HAADV QT H II  +G+  W+T+LEILA++FAA IHD+EHTGTTN FH+ + SD+A+LYNDR VLENHH+S+ +R+++++   IF  L+K+++++LR LVIE+VL+TDMS HFQQLK M++ L  PE ++K KA SL++H ADISHP K W +H +WT LL+EEFFRQGD+E  LGL  SPLCDR +T+VAQSQIGFIDFIVEP+F LL D  ++++                + +QNN E ++  +                         D    ++  ++ I +NKE WK
Sbjct:   59 AASVLEAVYIDETRRLLDTEDELSDIHTDSVPLEVRDWLASTFTRKMGMRKRRPEEKPKFRSIVHAVQAGIFVERMYRRSSNIAGLTYPSSVIASMK-DVDRWAFNVFTLNEASGEHALKFMVYELFTRYDLTNRFKIPVSNLVSFVEALEVGYSKYKNPYHNLVHAADVTQTVHYIILHTGIMHWLTELEILAMIFAAAIHDFEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRIMQDDEMNIFINLSKDDWRDLRTLVIEMVLSTDMSGHFQQLKTMRSTLQQPEGIDKAKAMSLILHAADISHPAKPWDMHLRWTNLLMEEFFRQGDKEAALGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFTLLTDSTEKIVFPLIEEAAKSDNSVFDKSSQNNSEVVRGTDTPRKPSVRTSQMDGSSPSEYSLATVDLHHFKKNLVEIIQQNKERWK 516          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: arhgef39 (Rho guanine nucleotide exchange factor 39 [Source:Xenbase;Acc:XB-GENE-6257690])

HSP 1 Score: 452.595 bits (1163), Expect = 1.801e-152
Identity = 220/459 (47.93%), Postives = 311/459 (67.76%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------QMAQNNKEPIQNDE-------------------------DFTKVQRPWIQCINENKEAWK 1817
            A  VLE+ YI+E +R+ + +D+       SVP EVR+WL++TFTR+      + +EKPKFRS+ +A++AGI VER+YRR S+ AGL  P +V+  MK  +D W FNVF ++EAS  H+LK++ YELF +Y++  +FKI    L +F++ LE GY+K+ NPYH+  HAADV QT H II  +G+  W+T+LEILA++FAA IHD+EHTGTTN FH+ + SD+A+LYNDR VLENHH+S+ +R+++++   IF  L+K+++++LR LVIE+VL+TDMS HFQQLK M++ L  PE ++K KA SL++H ADISHP K W +H +WT LL+EEFFRQGD+E  LGL  SPLCDR +T+VAQSQIGFIDFIVEP+F LL D  ++++                + +QNN E ++  +                         D    ++  ++ I +NKE WK
Sbjct:   59 AASVLEAVYIDETRRLLDTEDELSDIHTDSVPLEVRDWLASTFTRKMGMRKRRPEEKPKFRSIVHAVQAGIFVERMYRRSSNIAGLTYPSSVIASMK-DVDRWAFNVFTLNEASGEHALKFMVYELFTRYDLTNRFKIPVSNLVSFVEALEVGYSKYKNPYHNLVHAADVTQTVHYIILHTGIMHWLTELEILAMIFAAAIHDFEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRIMQDDEMNIFINLSKDDWRDLRTLVIEMVLSTDMSGHFQQLKTMRSTLQQPEGIDKAKAMSLILHAADISHPAKPWDMHLRWTNLLMEEFFRQGDKEAALGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFTLLTDSTEKIVFPLIEEAAKSDNSVFDKSSQNNSEVVRGTDTPRKPSVRTSQMDGSSPSEYSLATVDLHHFKKNLVEIIQQNKERWK 516          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE1C (phosphodiesterase 1C [Source:NCBI gene;Acc:100495383])

HSP 1 Score: 449.514 bits (1155), Expect = 1.272e-151
Identity = 207/384 (53.91%), Postives = 287/384 (74.74%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  VLES YI+E +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PP V+ ++K  +D W+F+VF +++AS +H LK++ YEL  +Y+++ +FKI    L +F++ LE GY K  NPYH+  HAADV QT H  + +SGL  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++ +E   I   L+K++++E R LVIE+VL TDMS HF Q+K MK  L  PE ++K KA SLL+H ADISHP K W LH +WT+ L+EEFFRQGD+E ELGL  SPLCDRN+T+VAQSQIGFIDFIVEP+F +L DM+++++
Sbjct:   59 AATVLESVYIDETRRLLDTEDELSDIQSDSVPSEVRDWLASTFTRQMGMMLKRTEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIAVLK-NVDKWSFDVFALNDASGDHGLKFIFYELLTRYDLINRFKIPISALVSFVEALEVGYTKHKNPYHNLIHAADVTQTVHYFLFKSGLVHWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDSAILYNDRSVLENHHVSAAYRLLQDDEEMNILYNLSKDDWREFRALVIEMVLATDMSCHFHQIKQMKNALQQPEGIDKPKALSLLLHTADISHPAKNWDLHHRWTMSLLEEFFRQGDKEAELGLPFSPLCDRNSTMVAQSQIGFIDFIVEPTFTVLTDMIEKIV 441          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE1C (phosphodiesterase 1C [Source:NCBI gene;Acc:100495383])

HSP 1 Score: 449.514 bits (1155), Expect = 1.287e-151
Identity = 207/384 (53.91%), Postives = 287/384 (74.74%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  VLES YI+E +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PP V+ ++K  +D W+F+VF +++AS +H LK++ YEL  +Y+++ +FKI    L +F++ LE GY K  NPYH+  HAADV QT H  + +SGL  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++ +E   I   L+K++++E R LVIE+VL TDMS HF Q+K MK  L  PE ++K KA SLL+H ADISHP K W LH +WT+ L+EEFFRQGD+E ELGL  SPLCDRN+T+VAQSQIGFIDFIVEP+F +L DM+++++
Sbjct:   59 AATVLESVYIDETRRLLDTEDELSDIQSDSVPSEVRDWLASTFTRQMGMMLKRTEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIAVLK-NVDKWSFDVFALNDASGDHGLKFIFYELLTRYDLINRFKIPISALVSFVEALEVGYTKHKNPYHNLIHAADVTQTVHYFLFKSGLVHWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDSAILYNDRSVLENHHVSAAYRLLQDDEEMNILYNLSKDDWREFRALVIEMVLATDMSCHFHQIKQMKNALQQPEGIDKPKALSLLLHTADISHPAKNWDLHHRWTMSLLEEFFRQGDKEAELGLPFSPLCDRNSTMVAQSQIGFIDFIVEPTFTVLTDMIEKIV 441          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE1C (phosphodiesterase 1C [Source:NCBI gene;Acc:100495383])

HSP 1 Score: 445.277 bits (1144), Expect = 1.409e-149
Identity = 207/384 (53.91%), Postives = 287/384 (74.74%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  VLES YI+E +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PP V+ ++K  +D W+F+VF +++AS +H LK++ YEL  +Y+++ +FKI    L +F++ LE GY K  NPYH+  HAADV QT H  + +SGL  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL+++ E   I   L+K++++E R LVIE+VL TDMS HF Q+K MK  L  PE ++K KA SLL+H ADISHP K W LH +WT+ L+EEFFRQGD+E ELGL  SPLCDRN+T+VAQSQIGFIDFIVEP+F +L DM+++++
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDSVPSEVRDWLASTFTRQMGMMLKRTEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIAVLK-NVDKWSFDVFALNDASGDHGLKFIFYELLTRYDLINRFKIPISALVSFVEALEVGYTKHKNPYHNLIHAADVTQTVHYFLFKSGL-HWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDSAILYNDRSVLENHHVSAAYRLLQDDEEMNILYNLSKDDWREFRALVIEMVLATDMSCHFHQIKQMKNALQQPEGIDKPKALSLLLHTADISHPAKNWDLHHRWTMSLLEEFFRQGDKEAELGLPFSPLCDRNSTMVAQSQIGFIDFIVEPTFTVLTDMIEKIV 449          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde1c (phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:108413])

HSP 1 Score: 456.062 bits (1172), Expect = 4.556e-153
Identity = 215/460 (46.74%), Postives = 309/460 (67.17%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------------------------QMAQNNKEPIQND---EDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++E E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                      +   PI N     D+   +  W + +  N+E W+ + P
Sbjct:   40 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALK-DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVP 498          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde1c (phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:108413])

HSP 1 Score: 455.292 bits (1170), Expect = 1.066e-152
Identity = 215/460 (46.74%), Postives = 309/460 (67.17%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------------------------QMAQNNKEPIQND---EDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++E E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                      +   PI N     D+   +  W + +  N+E W+ + P
Sbjct:   31 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALK-DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVP 489          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde1c (phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:108413])

HSP 1 Score: 454.907 bits (1169), Expect = 1.983e-152
Identity = 215/460 (46.74%), Postives = 309/460 (67.17%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------------------------QMAQNNKEPIQND---EDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++E E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                      +   PI N     D+   +  W + +  N+E W+ + P
Sbjct:   59 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALK-DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVP 517          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde1c (phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:108413])

HSP 1 Score: 454.907 bits (1169), Expect = 2.280e-152
Identity = 215/460 (46.74%), Postives = 309/460 (67.17%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------------------------QMAQNNKEPIQND---EDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++E E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                      +   PI N     D+   +  W + +  N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALK-DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde1c (phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:108413])

HSP 1 Score: 454.907 bits (1169), Expect = 2.280e-152
Identity = 215/460 (46.74%), Postives = 309/460 (67.17%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------------------------QMAQNNKEPIQND---EDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++E E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                      +   PI N     D+   +  W + +  N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALK-DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|O18696|PDE1_CAEEL (Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans OX=6239 GN=pde-1 PE=1 SV=2)

HSP 1 Score: 464.537 bits (1194), Expect = 9.217e-155
Identity = 217/383 (56.66%), Postives = 288/383 (75.20%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ 1715
            A LVLE+AY++E +RIC+EDDD       +VPDEVREWL+ TFTR+ +    K +KPKF+SVANAIR GI  E+++R+       PIPP +  LMK  + +W+F+ F+++E SE H+LKY+G+ELF++Y  M +FK+    LEN+L  LE GY+K +NPYH+  HAADV Q+ H ++SQ+GL+  + DLE+LAVLF ALIHDYEHTG TN FH+ S S  A+LYNDR VLENHH+SS FRL++E+   I   LT++EYKELR +VIEIVL TDMS HF Q+K MK++L++PE ++K KA  L+VH  DISHP K W+LHE+WT  ++EEFFRQGD E  +GL  SPLCDR+T  VA SQIGFIDFIVEP+ V+ G++L +M++
Sbjct:  177 AALVLETAYMDETRRICDEDDDLAEVTPETVPDEVREWLAATFTRQNA--GKKRDKPKFKSVANAIRTGIFFEKLFRKQQV-VQCPIPPEIAELMKE-VCTWSFSPFQLNEVSEGHALKYVGFELFNRYGFMDRFKVPLTALENYLSALEVGYSKHNNPYHNVVHAADVTQSSHFMLSQTGLANSLGDLELLAVLFGALIHDYEHTGHTNNFHIQSQSQFAMLYNDRSVLENHHVSSCFRLMKEDDKNILTHLTRDEYKELRNMVIEIVLATDMSTHFMQIKTMKSMLSLPEGIDKNKALCLIVHACDISHPAKPWNLHERWTEGVLEEFFRQGDLEASMGLPYSPLCDRHTVHVADSQIGFIDFIVEPTMVVCGELLVKMVE 555          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q01061|PDE1B_BOVIN (Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Bos taurus OX=9913 GN=PDE1B PE=1 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 1.995e-150
Identity = 214/435 (49.20%), Postives = 306/435 (70.34%), Query Frame = 3
Query:  576 VLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDF--------TKVQRP----------WIQCINENKEAWKIRA 1826
            +LE+ YI+E ++I + +D+     + +VP EVR+WL++TFT++T +    +EKPKFRS+ +A++AGI VER++RR  +S G      V+  +K  +D W F+VF ++ A+++H+L+ + +EL  ++N++++FKI +V L  FL  LE GY K+ NPYH+  HAADV QT H  + ++G+   ++++E+LA++FAA IHDYEHTGTTN FH+ + S+ A+LYNDR VLENHHISSVFR+++++   IF  LTK+E+ ELR LVIE+VL TDMS HFQQ+K+MKT L   E ++K KA SLL+H ADISHPTKQW +H +WT  L+EEFFRQGD+E ELGL  SPLCDR +T+VAQSQIGFIDFIVEP+F +L D+ ++ +Q   ++    +N   F         +V  P          W + I ENK+ WK RA
Sbjct:   65 LLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQTRAKGPSEEKPKFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLK-NVDLWCFDVFSLNRAADDHALRTIVFELLTRHNLISRFKIPTVFLMTFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVFRMMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKSMKTALQQLERIDKSKALSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPTGDDDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWTKYIQENKQKWKERA 498          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q64338|PDE1C_MOUSE (Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Mus musculus OX=10090 GN=Pde1c PE=1 SV=2)

HSP 1 Score: 454.521 bits (1168), Expect = 2.193e-150
Identity = 215/460 (46.74%), Postives = 309/460 (67.17%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------------------------QMAQNNKEPIQND---EDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++E E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                      +   PI N     D+   +  W + +  N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALK-DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDESSQTGGTGQRRSSLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P14100|PDE1A_BOVIN (Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Bos taurus OX=9913 GN=PDE1A PE=1 SV=3)

HSP 1 Score: 445.277 bits (1144), Expect = 4.262e-149
Identity = 216/452 (47.79%), Postives = 304/452 (67.26%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----------------QMAQNNKEPIQNDE-----------DFTKVQRPWIQCINENKEAWKIRAPKKE 1838
            A  VLE+ YI+E +R+ + DD+     + SVP EVR+WL++TFTR+      K +EKP+FRS+ + ++AGI VER+YR+     GL  P  V++ +K  +D W+F+VF ++EAS  HSLK++ YELF +Y+++ +FKI    L  F + LE GY+K+ NPYH+  HAADV QT H I+  +G+  W+T+LEILA++FAA IHDYEHTGTTN FH+ + SD+A+LYNDR VLENHH+S+ +RL++EE   +   L+K+++++LR LVIE+VL+TDMS HFQQ+KN++  L  PE ++K K  SL++H ADISHP K W LH +WT+ L+EEFF QGD+E ELGL  SPLCDR +T+VAQSQIGFIDFIVEP+F LL D  ++++                   ++N +   ND            D    +   +  I +NKE WK  A + E
Sbjct:   59 AASVLEAVYIDETRRLLDTDDELSDIQSDSVPSEVRDWLASTFTRKMGMMKKKSEEKPRFRSIVHVVQAGIFVERMYRKSYHMVGLAYPEAVIVTLK-DVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIPVSCLIAFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQEEEMNVLINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGLDKAKTMSLILHAADISHPAKSWKLHHRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFSLLTDSTEKIIIPLIEEDSKTKTPSYGASRRSNMKGTTNDGTYSPDYSLASVDLKSFKNSLVDIIQQNKERWKELAAQGE 509          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q14123|PDE1C_HUMAN (Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Homo sapiens OX=9606 GN=PDE1C PE=1 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 4.295e-149
Identity = 214/460 (46.52%), Postives = 308/460 (66.96%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ----------------------------------MAQNNKEPIQN---DEDFTKVQRPWIQCINENKEAWKIRAP 1829
            A  VLES YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + DEKP+F+S+ +A++AGI VER+YRR S+  GL  PP V+  +K  +D W+F+VF ++EAS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G++ W+T+LEI A++F+A IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++ +E   I   L+K++++E R LVIE+V+ TDMS HFQQ+K MKT L  PE +EK KA SL++H ADISHP K W LH +WT+ L+EEFFRQGDRE ELGL  SPLCDR +T+VAQSQ+GFIDFIVEP+F +L DM ++++                                          PI N     D+   +  W + ++ N+E W+ + P
Sbjct:   68 AATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALK-DVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVP 526          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A267EIK0 (Phosphodiesterase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011124g2 PE=3 SV=1)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 267/435 (61.38%), Postives = 349/435 (80.23%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM--------QMAQNNKE--------PIQ---NDEDFTKVQRPWIQCINENKEAW 1814
            A+ VLES Y++E +R+CNEDDD P      VP+EVR+WL++TFTR  +S     EKP+FRSVANAIRAGI+VERIYRR+SSS+ + +PPNV+IL+KAGLD W F++FE++EAS+NH++K++GYEL HKY+++TKFKI++ +LENFL KLE+GY+K++NPYH+  H ADVAQTCH I+S S L  W+TDLEI A + AAL+HDYEHTGTTN FHVN+ SDLALLYND+GVLEN+H+S+VFRL+REE Y I  GL++EEYKE R LVI++VLNTDMSLHFQQ+KNMK LL++PEN++K KA +L++HCADISHP K+W+LH +WT+ L+EEFFRQGDREK L L CSPLCDR++T+VAQSQ+GFIDFI+EPSF +LGDML++++        Q+++N  E        P++    D  F  + RPW   I EN+  W
Sbjct:  286 AVKVLESVYVDETRRLCNEDDDLPEVPPNEVPNEVRDWLASTFTRSQTSLKQSREKPRFRSVANAIRAGIMVERIYRRLSSSSNISVPPNVLILLKAGLDDWCFDIFELNEASDNHAMKFVGYELLHKYDLITKFKINTNVLENFLYKLEEGYSKWANPYHNLVHGADVAQTCHFIMSSSKLVNWLTDLEIFATIVAALVHDYEHTGTTNSFHVNTGSDLALLYNDKGVLENYHVSAVFRLLREEDYNILTGLSREEYKEFRALVIDMVLNTDMSLHFQQIKNMKQLLSMPENIDKEKALALMLHCADISHPGKRWNLHHRWTMSLLEEFFRQGDREKALDLPCSPLCDRSSTMVAQSQVGFIDFIMEPSFAVLGDMLEKILTPLFEQQKQLSKNPSEEAGARISRPVRKWHGDGGFC-LPRPWNDIIKENRSQW 719          

HSP 2 Score: 69.3218 bits (168), Expect = 2.336e-8
Identity = 46/142 (32.39%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  200 GTCALGTQVHASTKLNGDNLKD----QSKSIQKKSFSESKPKTDE-----------------NEWDSKICD-EELDLPLTSQVLYNSLANSPSTLYAKSTTEIEELPNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLKH 559
            G  A  +Q+ AS   NG ++      Q + + + + +  +P+TD                   E  + + + E+L+    S +LYNSLA + S  YA S  E+E++P  G+PE+ Y+CSVRL  I KL++ ++ISKE L+K+
Sbjct:  144 GDTAASSQLPAS---NGGSVSRTRVVQVRPVPRPTAAAEEPRTDAMQRREEMRSSNATKPSGGEAGAAVTEAEDLEAEPLSGLLYNSLAKADSARYADSEVEVEKMPAAGTPEASYTCSVRLKKIAKLVESDEISKEMLIKN 282          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A267EML7 (Phosphodiesterase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011124g1 PE=3 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 266/435 (61.15%), Postives = 348/435 (80.00%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM--------QMAQNNKE--------PIQ---NDEDFTKVQRPWIQCINENKEAW 1814
            A+ VLES Y++E +R+CNEDDD P      VP+EVR+WL++TFTR  +S     EKP+FRSVANAIRAGI+VERIYRR+SSS+ + +PPNV+IL+KAGLD W F++FE++EAS+NH++K++GYEL HKY+++ KFKI++ +LENFL KLE+GY+K++NPYH+  H ADVAQTCH I+S S L  W+TDLEI A + AAL+HDYEHTGTTN FHVN+ SDLALLYND+GVLEN+H+S+VFRL+REE Y I  GL++EEYKE R LVI++VLNTDMSLHFQQ+KNMK LL++PEN++K KA +L++HCADISHP K+W+LH +WT+ L+EEFFRQGDREK L L CSPLCDR++T+VAQSQ+GFIDFI+EPSF +LGDML++++        Q+++N  E        P++    D  F  + RPW   I EN+  W
Sbjct:  286 AVKVLESVYVDETRRLCNEDDDLPEVPPNEVPNEVRDWLASTFTRSQTSLKQSREKPRFRSVANAIRAGIMVERIYRRLSSSSNISVPPNVLILLKAGLDDWCFDIFELNEASDNHAMKFVGYELLHKYDLINKFKINTNVLENFLYKLEEGYSKWANPYHNLVHGADVAQTCHFIMSSSKLVNWLTDLEIFATIVAALVHDYEHTGTTNSFHVNTGSDLALLYNDKGVLENYHVSAVFRLLREEDYNILTGLSREEYKEFRALVIDMVLNTDMSLHFQQIKNMKQLLSMPENIDKEKALALMLHCADISHPGKRWNLHHRWTMSLLEEFFRQGDREKALDLPCSPLCDRSSTMVAQSQVGFIDFIMEPSFAVLGDMLEKILTPLFEQQKQLSKNPSEEAGARISRPVRKWHGDGGFC-LPRPWNDIIKENRSQW 719          

HSP 2 Score: 68.9366 bits (167), Expect = 2.459e-8
Identity = 46/142 (32.39%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  200 GTCALGTQVHASTKLNGDNLKD----QSKSIQKKSFSESKPKTDE-----------------NEWDSKICD-EELDLPLTSQVLYNSLANSPSTLYAKSTTEIEELPNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLKH 559
            G  A  +Q+ AS   NG ++      Q + + + + +  +P+TD                   E  + + + E+L+    S +LYNSLA + S  YA S  E+E++P  G+PE+ Y+CSVRL  I KL++ ++ISKE L+K+
Sbjct:  144 GDTAASSQLPAS---NGGSVSRTRVVQVRPVPRPTAAAEEPRTDAMQRREEMRSSNATKPSGGEAGAAVTEAEDLEAEPLSGLLYNSLAKADSARYADSEVEVEKMPAAGTPEASYTCSVRLKKIAKLVESDEISKEMLIKN 282          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A267DMU5 (Phosphodiesterase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013692g2 PE=3 SV=1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 262/434 (60.37%), Postives = 340/434 (78.34%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM-------QMAQNNKEPIQNDEDFT-------KVQRPWIQCINENKEAWKIRA 1826
            A+ VLE+ Y +E KR+CNEDDD P  +   VP EVR+WL++TFTR  +S     EKP FRSVANAIRAGI+VERIYRR+SSS+ + +PPNV++L+KAGLD W F+VFE++E SENH++K++G+EL HKY++++KFKI+S +LENFL K E+GY+K+ NPYH+  H ADVAQTCH I+  S L  W+TDLEI A + AALIHDYEHTGTTN FH+N++SDLALLYND+GVLEN+H+S++F L+RE+ Y I  GLT+EEYKE R LVI++VLNTDMSLHFQQ+KNMK LL++PE ++K KA +L++HCADISHP K+W LH +WTL L+EEFFRQGDRE+ L L CSPLCDR  T+VAQSQ+GFIDFI+EPSF +LGDML++++       + A  +  P   D+D +        ++RPW   I EN+  WK RA
Sbjct:  183 AVQVLEAVYEDETKRLCNEDDDLPEVSPNEVPSEVRDWLASTFTRSQTSLKQNKEKPHFRSVANAIRAGIMVERIYRRLSSSSSISVPPNVLLLLKAGLDEWCFDVFELNEVSENHAMKFVGFELLHKYDLISKFKINSSVLENFLYKCEEGYSKWGNPYHNLVHGADVAQTCHFIMHDSKLVNWLTDLEIFATIIAALIHDYEHTGTTNNFHINTNSDLALLYNDKGVLENYHVSAIFTLMREDDYNILTGLTREEYKEFRALVIDMVLNTDMSLHFQQIKNMKQLLSMPEKIDKEKALALMLHCADISHPGKRWDLHYRWTLGLLEEFFRQGDRERALDLPCSPLCDRTVTMVAQSQVGFIDFIMEPSFNVLGDMLEKILGPLFEQQRKAGGSAGP---DDDGSASESGSPSIRRPWADVIKENRATWKARA 613          

HSP 2 Score: 63.5438 bits (153), Expect = 1.236e-6
Identity = 37/87 (42.53%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  311 KTDENEWDSKICDEELDLPLTSQVLYNSLANSPSTLYAKSTTEIEELPNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLKHKLRH 571
            KT  NE D +        PL S ++YNSL  +PST YA+S    E +P+ G+PE+ ++CSVRL  I +L++++ I+KE LL   LR+
Sbjct:   98 KTKNNEMDDQSEKNAGSEPL-SGLMYNSLQKAPSTQYAESELGTERMPSVGTPEASFACSVRLKKIARLVEEDTINKE-LLVQNLRY 182          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A267DMF6 (Phosphodiesterase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013692g1 PE=3 SV=1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 263/438 (60.05%), Postives = 341/438 (77.85%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM-------QMAQNNKEPIQNDEDFT-------KVQRPWIQCINENKEAWKIRAPKKE 1838
            A+ VLE+ Y +E KR+CNEDDD P  +   VP EVR+WL++TFTR  +S     EKP FRSVANAIRAGI+VERIYRR+SSS+ + +PPNV++L+KAGLD W F+VFE++E SENH++K++G+EL HKY++++KFKI+S +LENFL K E+GY+K+ NPYH+  H ADVAQTCH I+  S L  W+TDLEI A + AALIHDYEHTGTTN FH+N +SDLALLYND+GVLEN+H+S++F L+RE+ Y I  GLT+EEYKE R LVI++VLNTDMSLHFQQ+KNMK LL++PE ++K KA +L++HCADISHP K+W LH +WTL L+EEFFRQGDRE+ L L CSPLCDR  T+VAQSQ+GFIDFI+EPSF +LGDML++++       + A  +  P   D+D +        ++RPW   I EN+  WK RA  +E
Sbjct:   80 AVQVLEAVYEDETKRLCNEDDDLPEVSPNEVPSEVRDWLASTFTRSQTSLKQNKEKPHFRSVANAIRAGIMVERIYRRLSSSSSISVPPNVLLLLKAGLDEWCFDVFELNEVSENHAMKFVGFELLHKYDLISKFKINSSVLENFLYKCEEGYSKWGNPYHNLVHGADVAQTCHFIMHDSKLVNWLTDLEIFATIIAALIHDYEHTGTTNNFHINMNSDLALLYNDKGVLENYHVSAIFTLMREDDYNILTGLTREEYKEFRALVIDMVLNTDMSLHFQQIKNMKQLLSMPEKIDKEKALALMLHCADISHPGKRWDLHYRWTLGLLEEFFRQGDRERALDLPCSPLCDRTVTMVAQSQVGFIDFIMEPSFNVLGDMLEKILGPLFEQQRKAGGSAGP---DDDGSASESGSPSIRRPWADVIKENRATWKARAEIEE 514          

HSP 2 Score: 61.2326 bits (147), Expect = 5.582e-6
Identity = 36/86 (41.86%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  365 PLTSQVLYNSLANSPSTLYAKSTTEIEELPNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLKHKLRHFSFRV--SIYRRSKKNL 616
            PL S ++YNSL  +PST YA+S    E +P+ G+PE+ ++CSVRL  I +L++++ I+KE LL   LR ++ +V  ++Y    K L
Sbjct:   13 PL-SGLMYNSLQKAPSTQYAESELGTERMPSVGTPEASFACSVRLKKIARLVEEDTINKE-LLVQNLR-YAVQVLEAVYEDETKRL 95          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A4E0RAI1 (Phosphodiesterase OS=Fasciola hepatica OX=6192 GN=D915_004560 PE=3 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 261/432 (60.42%), Postives = 338/432 (78.24%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSR-WMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDFTK-----------VQRPWIQCINENKEAWKIRA 1826
            AI V+E+AY+ E KRI +E++D    A   VPDEVR+WL++TFTR  ++ +  D+KP+FRSVANAIRAGI VERIYRRMSS + L IPPNV++ +KA LD+W+F+VF ++EASENH+LK++GYELFHKYN++ KF+I++  LE+F  +LE GY+K+ NPYH+  HAADV QTCH+++  + L + W+TDL++ AVLFAA+IHDYEHTGTTN FH+ + S+LAL+YNDRGVLENHH+S+VFRL+++  + IF GL K+++KE R LVI++VL TDMSLHFQQLKNMK+++A+PENV+K KA SL+VHCADI HP K W LHE+WT +L EEFFRQGDREKEL L  SPLCDRNT VV QSQIGFIDFIVEPSF +LGDM++R++   Q   +    DE  ++           V RPW+ C  ENKEAW   A
Sbjct:  172 AINVMETAYVSEKKRIRDEEEDLSEAATEYVPDEVRDWLASTFTRTQNNVSIGDQKPRFRSVANAIRAGIFVERIYRRMSSCSNLIIPPNVLLFLKAELDTWSFDVFGLNEASENHALKFVGYELFHKYNLINKFQINTTNLESFFIQLEIGYSKYGNPYHNLVHAADVMQTCHMVLLMNELRQNWLTDLDVFAVLFAAVIHDYEHTGTTNSFHIATKSELALIYNDRGVLENHHVSAVFRLMQDPEFDIFTGLDKDQFKEFRQLVIDMVLCTDMSLHFQQLKNMKSMIAMPENVDKTKALSLIVHCADIGHPAKTWSLHEQWTKVLCEEFFRQGDREKELNLPVSPLCDRNTVVVPQSQIGFIDFIVEPSFQVLGDMIERIVSPKQIPADGTVEDEGKSEAKSSEKSEPPNVPRPWVTCFKENKEAWAALA 603          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: PDE1C (phosphodiesterase 1C [Source:NCBI gene;Acc:103040750])

HSP 1 Score: 453.366 bits (1165), Expect = 4.863e-153
Identity = 216/446 (48.43%), Postives = 312/446 (69.96%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREES-YQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQ----------MAQNNKEPIQNDE----------DFTKVQRPWIQCINENKEAWKIRAPKKE 1838
            A  VLES YIEE +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PP+V+ ++K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++ +FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ +SG+  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR V ENHH+S+ +RL++++    I   L+K++++ELR LV+E+VL TDMS HFQQ+K MK  L  PE ++K KA SLL+H ADISHP K+W LH  WT  L+EEFFRQGD+E +LGL  SPLCDR +T+VAQSQIGFIDFIVEP+F +L DM ++++           +A   +  +++            DF   +  W   +++N+E WK +A K E
Sbjct:   66 AASVLESVYIEETRRLVDTEDELSDIQSDSVPSEVRDWLASTFTRQMGLMLRRSEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPSVITVLK-HVDTWSFDVFALNEASGDHALKFIFYELLTRYDLINRFKIPISALVSFVEALEVGYSKHKNPYHNLIHAADVTQTVHYLLLKSGMVHWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDAAILYNDRAVQENHHVSAAYRLLQDDDEMNILYNLSKDDWRELRTLVVEMVLATDMSCHFQQIKAMKNFLQQPEAIDKPKALSLLLHTADISHPAKRWDLHHHWTTSLLEEFFRQGDKESDLGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFTVLTDMTEKIVTPLIDEASSSGLAGFRRSSVKSTGSEGSTSLLSVDFKSFKATWNDEVHQNREKWKAQAAKGE 510          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: PDE1C (phosphodiesterase 1C [Source:NCBI gene;Acc:103040750])

HSP 1 Score: 448.743 bits (1153), Expect = 3.469e-149
Identity = 216/456 (47.37%), Postives = 309/456 (67.76%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREES-YQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM---------------------QMAQNNKEPIQNDE-----------DFTKVQRPWIQCINENKEAWKIRAPK 1832
            A  VLES YIEE +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PP+V+ ++K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++ +FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ +SG+  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR V ENHH+S+ +RL++++    I   L+K++++ELR LV+E+VL TDMS HFQQ+K MK  L  PE ++K KA SLL+H ADISHP K+W LH  WT  L+EEFFRQGD+E +LGL  SPLCDR +T+VAQSQIGFIDFIVEP+F +L DM ++++                      +  + K P                DF   +  W   +++N+E WK +A K
Sbjct:   78 AASVLESVYIEETRRLVDTEDELSDIQSDSVPSEVRDWLASTFTRQMGLMLRRSEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPSVITVLK-HVDTWSFDVFALNEASGDHALKFIFYELLTRYDLINRFKIPISALVSFVEALEVGYSKHKNPYHNLIHAADVTQTVHYLLLKSGMVHWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDAAILYNDRAVQENHHVSAAYRLLQDDDEMNILYNLSKDDWRELRTLVVEMVLATDMSCHFQQIKAMKNFLQQPEAIDKPKALSLLLHTADISHPAKRWDLHHHWTTSLLEEFFRQGDKESDLGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFTVLTDMTEKIVTPLIDEASSSGLAGFRRSSLNNIPADGKRPSVKSTGSEGSTSLLSVDFKSFKATWNDEVHQNREKWKAQAAK 532          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: PDE1C (phosphodiesterase 1C [Source:NCBI gene;Acc:103040750])

HSP 1 Score: 449.514 bits (1155), Expect = 4.070e-149
Identity = 216/456 (47.37%), Postives = 309/456 (67.76%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREES-YQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM---------------------QMAQNNKEPIQNDE-----------DFTKVQRPWIQCINENKEAWKIRAPK 1832
            A  VLES YIEE +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PP+V+ ++K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++ +FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ +SG+  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR V ENHH+S+ +RL++++    I   L+K++++ELR LV+E+VL TDMS HFQQ+K MK  L  PE ++K KA SLL+H ADISHP K+W LH  WT  L+EEFFRQGD+E +LGL  SPLCDR +T+VAQSQIGFIDFIVEP+F +L DM ++++                      +  + K P                DF   +  W   +++N+E WK +A K
Sbjct:  126 AASVLESVYIEETRRLVDTEDELSDIQSDSVPSEVRDWLASTFTRQMGLMLRRSEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPSVITVLK-HVDTWSFDVFALNEASGDHALKFIFYELLTRYDLINRFKIPISALVSFVEALEVGYSKHKNPYHNLIHAADVTQTVHYLLLKSGMVHWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDAAILYNDRAVQENHHVSAAYRLLQDDDEMNILYNLSKDDWRELRTLVVEMVLATDMSCHFQQIKAMKNFLQQPEAIDKPKALSLLLHTADISHPAKRWDLHHHWTTSLLEEFFRQGDKESDLGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFTVLTDMTEKIVTPLIDEASSSGLAGFRRSSLNNIPADGKRPSVKSTGSEGSTSLLSVDFKSFKATWNDEVHQNREKWKAQAAK 580          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: PDE1C (phosphodiesterase 1C [Source:NCBI gene;Acc:103040750])

HSP 1 Score: 449.129 bits (1154), Expect = 1.033e-148
Identity = 216/456 (47.37%), Postives = 309/456 (67.76%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREES-YQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM---------------------QMAQNNKEPIQNDE-----------DFTKVQRPWIQCINENKEAWKIRAPK 1832
            A  VLES YIEE +R+ + +D+     + SVP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR S+  GL  PP+V+ ++K  +D+W+F+VF ++EAS +H+LK++ YEL  +Y+++ +FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ +SG+  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR V ENHH+S+ +RL++++    I   L+K++++ELR LV+E+VL TDMS HFQQ+K MK  L  PE ++K KA SLL+H ADISHP K+W LH  WT  L+EEFFRQGD+E +LGL  SPLCDR +T+VAQSQIGFIDFIVEP+F +L DM ++++                      +  + K P                DF   +  W   +++N+E WK +A K
Sbjct:  126 AASVLESVYIEETRRLVDTEDELSDIQSDSVPSEVRDWLASTFTRQMGLMLRRSEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPSVITVLK-HVDTWSFDVFALNEASGDHALKFIFYELLTRYDLINRFKIPISALVSFVEALEVGYSKHKNPYHNLIHAADVTQTVHYLLLKSGMVHWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDAAILYNDRAVQENHHVSAAYRLLQDDDEMNILYNLSKDDWRELRTLVVEMVLATDMSCHFQQIKAMKNFLQQPEAIDKPKALSLLLHTADISHPAKRWDLHHHWTTSLLEEFFRQGDKESDLGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFTVLTDMTEKIVTPLIDEASSSGLAGFRRSSLNNIPADGKRPSVKSTGSEGSTSLLSVDFKSFKATWNDEVHQNREKWKAQAAK 580          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: ENSAMXT00000048550.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:4377033:4466642:1 gene:ENSAMXG00000041175.1 transcript:ENSAMXT00000048550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 419.853 bits (1078), Expect = 2.207e-139
Identity = 192/371 (51.75%), Postives = 278/371 (74.93%), Query Frame = 3
Query:  606 KRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREES-YQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            +R+ + +D+     + SVP EVR+WL++TFTR+      K +EKP+FRS+ +A++AGI VER+YRR S+  GL  P +V+ ++K  +D W+F+VF +++AS +H+LK++ YEL  +Y+++++FKI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G+  W+T+LEI A++FAA +HDYEHTGTTN FH+ + SD A+LYNDR VLE+HH+S+ +RL++++    I   L+K++++E R LV+E+VL TDMS HFQQ+K MK  L  PE ++K KA SLL+H ADISHP K W LH +WT  L+EEFF QGD+E ELGL  SPLCDR +T+VAQSQIGFIDFIV P+F +L DM ++++
Sbjct:   43 RRLVDTEDELSDIQSDSVPSEVRDWLASTFTRQMGLMLRKTEEKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPASVITVLKH-VDKWSFDVFALNDASGDHALKFIFYELLTRYDLISRFKIPISSLVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLLKTGMVHWLTELEIFAMIFAAAVHDYEHTGTTNNFHIQTRSDTAILYNDRSVLESHHVSAAYRLLQDDDEMNILYNLSKDDWREFRALVVEMVLATDMSCHFQQVKAMKNFLQQPEGIDKSKALSLLLHTADISHPAKNWDLHHRWTASLLEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVVPTFTVLTDMTEKIV 412          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 459.914 bits (1182), Expect = 1.746e-156
Identity = 222/456 (48.68%), Postives = 315/456 (69.08%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDE-KPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKA-GLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM----QMAQNNKEP------------------IQNDEDFTKV--------QRPWIQCINENKEAWKIRAPKKE 1838
            A  VLE+ YI+E +R+ + +D+    ++ +VP EVR+WL++TFTRR   TA + E KP+FRS+ +A++AGI VER+YRR S+  GL  PPNV++ +K      W+F+VF ++EAS  H+LK++ +EL  +Y +++++KI    L +F++ LE GY+K  NPYH+  HAADV QT H ++ QSGL  W+++LE LAV+FAA IHD EHTGTTN FH+ + SD+ALLYNDR VLENHH+S+ +RL++++   IF  L+K++++ELR LV+E+VL TDMS HFQQ+K MK+ L  PE+++K KA SLL+H  DISHPTK+W LH++WT  L+EEFFRQGDRE +LGL  SPLCDRN+T+VAQSQIGF+DFIVEP+F +L DM ++++    + A     P                    +D   T +        +  W  C++ NKE WK +A   E
Sbjct:   50 AASVLEALYIDETRRLLDSEDELGDISSEAVPAEVRDWLASTFTRRMGVTARRPEDKPRFRSIVHAVQAGIFVERMYRRTSNMVGLSYPPNVLVALKNWTCHKWSFDVFVLNEASGEHALKFVMHELLTRYELISRYKIPVAALVSFVEALEAGYSKHKNPYHNLAHAADVTQTVHYLLLQSGLMHWLSELETLAVIFAAAIHDLEHTGTTNNFHIQTRSDVALLYNDRAVLENHHVSAAYRLMQDDDMNIFINLSKDDWRELRALVVEMVLATDMSCHFQQIKTMKSALQQPESIDKSKAMSLLLHAGDISHPTKEWPLHQRWTEALMEEFFRQGDREAKLGLPFSPLCDRNSTMVAQSQIGFMDFIVEPTFSVLTDMAEKVVVPLAEEAARAGTPGVPRRGSAATVEWHRGKRAASDGSVTSICTVDLLQFRALWQNCLSSNKERWKEQAAASE 505          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: PDE1C (phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:8776])

HSP 1 Score: 443.736 bits (1140), Expect = 2.380e-151
Identity = 206/379 (54.35%), Postives = 285/379 (75.20%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIRE-ESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDM 1697
            A  VLE+ YI+E +R+ + +D+     + +VP EVR+WL++TFTR+      + +EKP+FRS+ +A++AGI VER+YRR SS  GL  PP V+ ++K  +D W+F+VF + EAS  H+LK++ YELF +Y+++ +FKI    + +F++ LE GY+K  NPYH+  HAADV QT H ++ ++G   W+ +LEIL+++FAA IHDYEHTGTTN FH+ + SD A+LYNDR VLENHH+S+ +RL++E E   I   L+K++++ELR LV+E VL TDMS HF QLK++K LL  PE VEK KA SL++H ADISHP K W+LH +WT+ L+EEFFRQGD+E ELGLS SPLCDRN T+V QSQIGFID+IVEP+F +L D+
Sbjct:   43 AASVLEAVYIDETRRLLDTEDELSDLRSDTVPSEVRDWLASTFTRQMGLMLKRSEEKPRFRSIVHAVQAGIFVERMYRRTSSMVGLSYPPAVISVLKE-VDKWSFDVFALHEASGEHALKFIVYELFTRYDLIARFKIPVSSVVSFVEALEAGYSKHKNPYHNSVHAADVTQTVHYLMLKTGTIHWLNELEILSMIFAAAIHDYEHTGTTNNFHIQTRSDSAILYNDRSVLENHHVSAAYRLMQEDEEMNILINLSKDDWRELRALVVETVLATDMSCHFHQLKSIKNLLQQPEGVEKPKAMSLMLHTADISHPAKNWNLHRRWTMSLMEEFFRQGDKEAELGLSFSPLCDRNATMVPQSQIGFIDYIVEPTFTVLTDL 420          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003038.1 (pep scaffold:Pmarinus_7.0:GL476485:41:13228:1 gene:ENSPMAG00000002763.1 transcript:ENSPMAT00000003038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.756 bits (517), Expect = 3.220e-61
Identity = 94/187 (50.27%), Postives = 133/187 (71.12%), Query Frame = 3
Query: 1155 AALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIR-EESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            +A IHD EHTGTTN FH+ + SD+A+LYNDR V+ENHH+S+ +R+++ +E   I   L+  +Y+     +I  VL    +  ++QL   K +   P  ++K KA SL+VH +DISHP K+W LH +WT  L+EEFF+QGDRE+ELGL  SPLCDR +T+V QSQ+GFIDFIVEP+  +L DM++ ++
Sbjct:    1 SAAIHDLEHTGTTNNFHIQTRSDVAILYNDRSVMENHHVSTAYRIMQADEDANILINLSNRDYRIFLTQLINYVLMPIFNCAYKQLHFQKKIYKEPRVIDKPKAMSLIVHTSDISHPAKEWRLHRRWTESLLEEFFQQGDREEELGLPFSPLCDRKSTMVPQSQVGFIDFIVEPTLSVLTDMVEGIV 187          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007435.1 (pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 gene:ENSPMAG00000006710.1 transcript:ENSPMAT00000007435.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 1.455e-53
Identity = 88/191 (46.07%), Postives = 133/191 (69.63%), Query Frame = 3
Query: 1125 TDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTL-----------LAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQ-IGFIDF 1661
            TDLEILA +FA+ IHD +H G +N F +N++S+LAL+YND  VLENHH++  F+L++EE+  IF+ L+K++ + LR +VI++VL TDMS H   L ++KT+           L +    ++I+    +VHCAD+S+PTK   ++ +WT  ++EEFFRQGDRE+E G+  SP+CD+++  V +SQ I  IDF
Sbjct:    9 TDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKKQRQTLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLQNMVHCADLSNPTKPLDVYRQWTERIMEEFFRQGDRERERGMEISPMCDKHSASVEKSQRINAIDF 199          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde7a (phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031222-10])

HSP 1 Score: 170.244 bits (430), Expect = 7.234e-48
Identity = 100/285 (35.09%), Postives = 155/285 (54.39%), Query Frame = 3
Query:  843 ILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLL-----AVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFV 1682
            +LMKA   SW+F++F  D  +  +SL  L   LF+ + ++  F++D V L  FL  +++ Y    NPYH+  HAADV Q  H  + +  L+  +T  +I+  L AA  HD +H G    F + +   LA LY++  VLENHH  S   ++RE    +F  L  +E  ++   +  ++L TD+S   + L   K+ L      + E   +     + + CADI +P + W   ++W+  + EEFF+QGD E++  L  SPLCDR T  V   QIGF+ F+VEP F+
Sbjct:    1 MLMKAA--SWSFDMFLFDRLTNGNSLVSLTCHLFNFHGLIQHFQLDMVKLRGFLVMVQEDYHN-QNPYHNAVHAADVTQAMHCYLREPKLAVHLTRRDIMLGLLAASAHDVDHPGVNQPFLIKTHHHLASLYHNSSVLENHHWRSTVGMLRESG--LFAHLPMDERLQMERDLGSLILATDISRQNEFLSQFKSHLDKGDLCLEEAPHRHFILQIALKCADICNPCRVWDTSKRWSEKVCEEFFKQGDMERKWRLEISPLCDRYTQTVPNIQIGFMTFVVEPLFM 280          
BLAST of Phosphodiesterase vs. Ensembl Yeast
Match: PDE2 (High-affinity cyclic AMP phosphodiesterase; component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon [Source:SGD;Acc:S000005887])

HSP 1 Score: 69.707 bits (169), Expect = 5.664e-13
Identity = 63/236 (26.69%), Postives = 107/236 (45.34%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQT----CHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEF 1556
            L +W+F    +        L + G+ L  K +   K  I    L   L  LE  Y +  N +H+F HA DV Q     C  ++  + +       + L +  AA+ HD  H GT N    N  S++A  + +  +LEN H   +F+ +  E +     ++K+++      + E +L TDM+LH Q     +  L     +++I   SL++  ADIS+ T+   +  +W  L+  EF
Sbjct:  208 LSTWDFCALSL----STQELIWCGFTLIKKLSKDAKVLIADNKLLLLLFTLESSYHQV-NKFHNFRHAIDVMQATWRLCTYLLKDNPV-------QTLLLCMAAIGHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFH-RELFQQLLSEHWPQLLSISKKKFD----FISEAILATDMALHSQ----YEDRLMHENPMKQITLISLIIKAADISNVTRTLSISARWAYLITLEF 422          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO37301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA1])

HSP 1 Score: 352.058 bits (902), Expect = 1.295e-116
Identity = 164/352 (46.59%), Postives = 236/352 (67.05%), Query Frame = 3
Query:  654 SVPDEVREWLSNTFTRRTSSTAGKD--EKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLD 1703
            SV +EVREW++ TF R   +   K    +  FR V +A++A + V ++ +  +    + +P NV    +     W F+VF + E+ E H L+Y+GYE+ H+ +M+  FKI ++ L+ FLQ +E GY + SNPYH+  HAADV  T H  +   G+S++++DLE+  +L +A+IHD EHTGTTN FH+NS SDLALLYNDR VLENHH+S  FR+++++   I  GL  E+Y ++R L+I+ VL TDMS HF+QL+ MK  L     +E  +   LL+H ADIS+PTK W +H +WT  ++EEFF QGD E ELGL  SPLCDR+TT++ +SQIGFIDFIV P+  +  ++L+
Sbjct:   12 SVNEEVREWIATTFARGPGAARRKSMVRRHTFRGVVHAVKASLYVNKMLKNATERYKMHVPENVQKAFE-----WTFDVFALSESCEGHPLRYIGYEVLHRRDMLRNFKIHAMTLDRFLQDVETGYKRHSNPYHNDCHAADVTHTVHYFLECMGVSKYLSDLEVFGLLLSAIIHDLEHTGTTNAFHINSRSDLALLYNDRSVLENHHVSCAFRILQDDEKNILSGLNLEQYADVRSLMIDTVLATDMSSHFEQLRLMKVALVAGSPIENREVVQLLLHVADISNPTKDWTIHRQWTTKIMEEFFTQGDMEIELGLDVSPLCDRSTTLIPESQIGFIDFIVSPALEVCSEVLE 358          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO46133 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM4])

HSP 1 Score: 231.106 bits (588), Expect = 3.766e-68
Identity = 130/393 (33.08%), Postives = 224/393 (57.00%), Query Frame = 3
Query:  606 KRICNED-DDFPTQANGSVPDEVREWLSNTFTRR-----TSSTAGKDE--KPKFRSVANAIRAGILVERIYRRMSSSAGLP------IPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTL-------------LAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKEL-GLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            KR+ N +  DF ++AN S  ++V  W+ NTFT +     T+ +  K +  + + RS+ N +R      ++ R  S S  +P         + +  +   ++ W+F+ F + EA+  H +  + Y +    +++  FKI      N++  +E+ Y K   P+H+  HAADV QT H+++S        TDLEIL+ + A+ +HD +H G  N F V ++S++AL+YND  VLENHH++  F+L++ E   IF+ L+K+E +  R ++IE+VL TD + H   L ++KT+             L +    ++++    LVHCAD+S+PTK   ++ KW   L+EEFFRQGD+E+++ G+  SP+ DR+   + +SQ+ FIDF+ +P +   G+++
Sbjct:  118 KRLLNRELKDF-SEANQS-GNQVSAWVYNTFTDKQLEVETAQSKTKRDCIRARSRSMVNGVR------KLTRLHSFSGSVPRFGVEVQNESELATILENVNKWDFDAFALGEATNGHPMLAVSYTILQARDLLKIFKIKPTTFINYMTLVENHYLK-DVPFHNCIHAADVTQTAHVLLSAQAFDNVFTDLEILSAIIASAVHDVDHPGVNNHFLVATNSEMALMYNDESVLENHHLAVAFQLLQHEDCDIFENLSKQERQTARRMIIEMVLATDNAKHMSLLASLKTMVETKKVAGTGSGVLCLENYTDRMQVLKSLVHCADLSNPTKPLPIYRKWVDRLMEEFFRQGDKERDIDGMEISPMMDRHNASIEKSQVVFIDFVAQPLWETWGELV 501          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32142 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVX8])

HSP 1 Score: 182.57 bits (462), Expect = 9.469e-49
Identity = 106/305 (34.75%), Postives = 171/305 (56.07%), Query Frame = 3
Query:  819 LP-IPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLI-REESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLK-------------------NMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCS-PLCDRNTTVVAQSQIGFIDFIV 1667
            LP IP  V   M    D W+F++ ++++AS +  L +LG ++ +++ +  K  I    ++N+LQ +E  Y +  N YH+ THAADV     + +++  +   +  L+ +A L AA++HD +H G TN F  N+ S+LA+LYND  VLE+HH +  F+L  R++   IF  L  EE++ +R  +I++V+ T+M+ HF+ L                    +  T L  PEN   IK   +L+ CADI++P +  +L ++W   + EE+F Q D EK  GL    P+ DR T  V +SQ+ FID+ V
Sbjct:  506 LPEIPAEVSNAMVDEAD-WDFDILKLEKASNHRPLYFLGLKILNRFRVCEKLNISEDYVKNWLQLIEANYHR-KNAYHNSTHAADVLHATAVFLAKERVKAVLEPLDEVASLIAAIVHDVDHPGYTNSFLCNAGSELAILYNDIAVLESHHAALAFKLTARDDKSNIFSNLDVEEFRTVRQAIIDMVMATEMTRHFEHLSKFVNSINKRRSSSTPDSNTSTSTALNTPENRTLIK--RMLIKCADIANPARPRYLCKEWAYRIAEEYFSQTDEEKRRGLPVVMPVFDRATCNVPRSQVWFIDYFV 806          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO43748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ4])

HSP 1 Score: 150.214 bits (378), Expect = 3.819e-40
Identity = 101/324 (31.17%), Postives = 144/324 (44.44%), Query Frame = 3
Query:  870 WNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQ-------SGLSRWMTD-----------------------------------------LEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLI-REESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLA-----VPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSF 1679
            WNF +F  D     + L  + Y +F        FKI      N+   LE GY   S PYH+  HA+DV Q  + + +         G  + + D                                         LE+L++  AA +HDY+H G TN F V + S  ALLYNDR VLENHH ++ F L+  +  Y     L+  E+K  R L IE +L TD+  HF  L +     A          +++      +  +DIS P+K+  +H  WT  +VEEF+ QGD E+  G++ SP  DR    VAQ Q  FI+ +V P +
Sbjct:   26 WNFPIF--DACEHGNILVQVSYRIFQNAGFFEIFKIPERKFLNYFFALESGY--HSIPYHNSIHASDVLQGVYFLTTAKIPGFCPPGTPQKLGDNESDSDSDSGITSGVLGEGEEDKKDDDGGGDYGALVDVIPLLELLSLYTAAAMHDYDHPGRTNAFLVATLSHQALLYNDRSVLENHHAAAAFTLLMSDPKYNFLCELSPAEFKRFRFLAIEAILATDLKRHFDILSDFNAKTAEGGVNWDSEADRLLTLQFCIKMSDISGPSKRRDIHTLWTERIVEEFYEQGDDERARGMAVSPYMDRQQPHVAQLQDSFINHLVAPLY 345          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS5])

HSP 1 Score: 149.443 bits (376), Expect = 7.491e-39
Identity = 83/269 (30.86%), Postives = 147/269 (54.65%), Query Frame = 3
Query:  906 ENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLL----AVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            E   + YL  +++    ++ +FKI+   L++FL ++   Y     P+H+F HA  V Q  + +I  + +   +T  ++L +L +AL HD +H G  N + +N+ ++LAL YND   LENHH +  F +++++   I + ++ E +K++R  +I+ +L+TDM+ H   L   K LL       +   K     +++  +D+S+  +   + E W   L++EFF Q D EK  GL  +P  DR+      +QIGFI F++ P F  LG++ 
Sbjct:  180 EEAEMLYLLQQMYIDLGLLDEFKIERSKLQHFLFEVYRHYN--PTPFHNFRHAFCVTQMMYGLIWLTEIFNKITKQDLLIMLTSALCHDLDHPGYNNAYQINARTELALRYNDISPLENHHCAVAFDIMKQDKSNILQNVSAETFKKIREGMIKCILSTDMARHSDILNKFKELLKSGFKFDDEAHKSMLMQIMIKVSDVSNEARPMDVAEPWLDCLLQEFFIQSDVEKLEGLPVAPFMDRDKVTKPSAQIGFIKFVLVPLFEALGELF 446          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde1a (calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A [Source:NCBI gene;Acc:101168903])

HSP 1 Score: 426.017 bits (1094), Expect = 3.652e-142
Identity = 194/383 (50.65%), Postives = 280/383 (73.11%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTS-STAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMM 1712
            A  +L++ Y +E +R+ + +D+       SVP EVR+WL+ TF+RRT  S    +EKP+FRS+ +A++AGI VER+YRR S+ AGL  PP  +  +K  +D W+F+VF   +A+  H+LK++ Y+L  +Y+++ +F+I    L  F++ LE GY+K  NPYH+  HAADV QT H ++  +GL  W+++LEILA++FAA IHD+EHTGTTN FH+++ S++A+LYNDR VLENHH+S+ ++L+ EE   I   L K++++ELR LVIE+V++TDMS HFQQ+K M+  L   ++++K+K  SL++H ADISHP K W LH  WT  L+EEFFRQGD+E ELGL  SPLCDR  T++AQSQIGFIDFIVEP+F +L D  D+++
Sbjct:   18 AAAMLDAVYTDETRRLLDTEDELSDLQAESVPSEVRDWLACTFSRRTGLSKRRPEEKPRFRSIVHAVQAGIFVERMYRRTSNMAGLTYPPTALNALKE-VDQWSFDVFTFHDATGEHALKFIVYDLLTRYDLINRFRIPVQALVQFVEALESGYSKHRNPYHNLIHAADVTQTAHFLMLHTGLMHWLSELEILAMVFAAAIHDFEHTGTTNNFHIHTRSEVAILYNDRSVLENHHVSAAYKLMAEEDMNILVNLNKDDWRELRSLVIEMVMSTDMSCHFQQIKTMRNSLTQTDSIDKVKVLSLMLHAADISHPAKAWPLHYHWTHSLMEEFFRQGDKEVELGLPFSPLCDRKATMIAQSQIGFIDFIVEPTFSVLIDTTDKVI 399          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: ENSORLT00000022279.2 (pep primary_assembly:ASM223467v1:20:1384867:1412384:1 gene:ENSORLG00000017798.2 transcript:ENSORLT00000022279.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 408.297 bits (1048), Expect = 3.414e-137
Identity = 196/393 (49.87%), Postives = 277/393 (70.48%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSST-AGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLI-REESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEP 1739
            A  +LE    EE +++ + +D+       SVP EVR+WL+ TFT++       +++K +FRS+ +A++AGI VER++RR S+   L    NV+  +K  +D W+F+VF ++E S NH+LK++ +EL  +YN++  FKI    L +F+  LE GY+   NPYH+  HAADV QT H ++ ++G+  W+++LEI AV+FAA IHDYEHTGTTN FH+ + SD ALLYNDR V ENHHIS+ +RL+ R++   IF  L+K+E+++LR LV+++VL TDMS HFQQ+K MK L+   E+ +K KA SLL+H ADISHP KQW LH +WT  L+EEFFRQGD+E ELGL  SPLCDR +T+VAQSQIGFIDFIVEP+F ++ +M++ +         P
Sbjct:   22 AASLLEYMCSEETRQLVDPEDELDDIKTDSVPVEVRDWLTVTFTQQKGLVLTRREDKQRFRSIVHAVQAGIFVERMFRRTSNITSLSYSQNVITALK-HVDMWSFDVFALNEVSGNHALKFVFHELLTRYNLINVFKIPVSALISFVDSLEVGYSSHKNPYHNLVHAADVTQTLHYLLIKTGILHWLSELEIFAVIFAAAIHDYEHTGTTNNFHIQTRSDTALLYNDRAVQENHHISAAYRLLQRDDEKNIFLNLSKDEWRDLRSLVVDMVLATDMSCHFQQIKGMKNLMMQREHPDKPKALSLLLHTADISHPAKQWGLHHRWTTFLLEEFFRQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFTVVTEMIETITTALAQETPP 413          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: ENSORLT00000006203.2 (phosphodiesterase 1B [Source:NCBI gene;Acc:101159577])

HSP 1 Score: 409.453 bits (1051), Expect = 5.254e-135
Identity = 196/391 (50.13%), Postives = 274/391 (70.08%), Query Frame = 3
Query:  573 LVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGK-DEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRM-MQMAQNNKEP 1739
            L+LE  Y++  ++  + +DD     +  VP EV +WL++TFT+R      + DEKPKFRS+ +A++AGI VER+++R + +A +P  P  ++     +D W F+VF ++  S +H+L+ L +EL  +Y + T+FKI    L  FL  LE GY K +NPYH+  HAADV QT H ++ +SGL  W+T+LE+L  LFAA IHD+EHTGTTN FH+++ SDLAL+YNDR V E+HH+S+ FRL+++E   IF  LT+EE+ ELR LVI++VL TDM+ H  Q+K MK+ L   E ++K KA SLL+H ADISHP+K W LH +WT  L+EEFFRQGDRE  L L  SPLCDR TT++A+SQIGFIDFIV P+F LL DM +++ + + + N  P
Sbjct:   45 LLLEGIYLDGTRQYLDSEDDLQQLQSDGVPSEVTDWLASTFTQRIRQPPRRVDEKPKFRSIVHAVQAGIFVERMFKR-AYTAAMPDQPAAVVNCLRDVDRWGFDVFALNSTSSDHALQALFFELITRYELNTRFKIPISCLTKFLSTLERGYCKHNNPYHNHIHAADVTQTLHCLLLRSGLVHWLTELEVLGSLFAAAIHDFEHTGTTNNFHIHTKSDLALIYNDRSVQESHHLSAAFRLLQDEQVNIFVHLTREEWMELRSLVIDMVLATDMTFHLVQVKAMKSCLQQQERIDKPKALSLLLHTADISHPSKPWALHSRWTKALMEEFFRQGDREAALDLPFSPLCDRKTTLIAESQIGFIDFIVYPTFSLLTDMAEKIVIPLVEENPGP 434          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4cb (phosphodiesterase 4C [Source:NCBI gene;Acc:101163965])

HSP 1 Score: 244.202 bits (622), Expect = 1.267e-70
Identity = 119/291 (40.89%), Postives = 182/291 (62.54%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTL-----------LAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            +D W  ++F++ E S N  L  + Y +F + +++  FKI +     F+  LED Y      YH+  HAADV Q+ H+++S   L    TDLEI+A LFA+ IHD +H G TN F +N+SS+LAL+YND  VLENHH++  F+L++EE+  IF+ L+K++   LR +VI++VL TDMS H   L +MKT+           L +    ++I+    +VHCAD+S+PTK   L+ KWT  ++ E F QGDRE+E G+  SP+CD+    + ++Q+GFID++V P +    D++
Sbjct:  308 IDRWGMDIFKIAEYSGNRPLTVIMYSIFQERDLLKTFKIQADTFITFMMTLEDHYHA-DVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEIMAALFASAIHDVDHPGVTNQFLINTSSELALMYNDASVLENHHLAVGFKLLQEENCDIFENLSKKQKDSLRKMVIDMVLATDMSKHINFLADMKTMVETKKVTNLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRKWTDRIMVELFTQGDREREKGMEISPMCDKQNASIEKTQVGFIDYVVHPLWETWADLV 597          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4cb (phosphodiesterase 4C [Source:NCBI gene;Acc:101163965])

HSP 1 Score: 244.202 bits (622), Expect = 1.777e-70
Identity = 119/291 (40.89%), Postives = 182/291 (62.54%), Query Frame = 3
Query:  861 LDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTL-----------LAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML 1700
            +D W  ++F++ E S N  L  + Y +F + +++  FKI +     F+  LED Y      YH+  HAADV Q+ H+++S   L    TDLEI+A LFA+ IHD +H G TN F +N+SS+LAL+YND  VLENHH++  F+L++EE+  IF+ L+K++   LR +VI++VL TDMS H   L +MKT+           L +    ++I+    +VHCAD+S+PTK   L+ KWT  ++ E F QGDRE+E G+  SP+CD+    + ++Q+GFID++V P +    D++
Sbjct:  326 IDRWGMDIFKIAEYSGNRPLTVIMYSIFQERDLLKTFKIQADTFITFMMTLEDHYHA-DVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEIMAALFASAIHDVDHPGVTNQFLINTSSELALMYNDASVLENHHLAVGFKLLQEENCDIFENLSKKQKDSLRKMVIDMVLATDMSKHINFLADMKTMVETKKVTNLGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRKWTDRIMVELFTQGDREREKGMEISPMCDKQNASIEKTQVGFIDYVVHPLWETWADLV 615          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000004031.1 (SMESG000004031.1)

HSP 1 Score: 890.567 bits (2300), Expect = 0.000e+0
Identity = 424/424 (100.00%), Postives = 424/424 (100.00%), Query Frame = 3
Query:  567 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDFTKVQRPWIQCINENKEAWKIRAPKKE 1838
            AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDFTKVQRPWIQCINENKEAWKIRAPKKE
Sbjct:  125 AILVLESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDFTKVQRPWIQCINENKEAWKIRAPKKE 548          

HSP 2 Score: 244.202 bits (622), Expect = 1.330e-72
Identity = 120/121 (99.17%), Postives = 121/121 (100.00%), Query Frame = 2
Query:  197 MGTCALGTQVHASTKLNGDNLKDQSKSIQKKSFSESKPKTDENEWDSKICDEELDLPLTSQVLYNSLANSPSTLYAKSTTEIEELPNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLKH 559
            MGTCALGTQVHASTKLNGDNLKDQSKSIQKKSFSESKPKTDENEWDSKICDEELDLPLTSQVLYNSLANSPSTLYAKSTTEIEELPNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLK+
Sbjct:    1 MGTCALGTQVHASTKLNGDNLKDQSKSIQKKSFSESKPKTDENEWDSKICDEELDLPLTSQVLYNSLANSPSTLYAKSTTEIEELPNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLKN 121          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000070067.1 (SMESG000070067.1)

HSP 1 Score: 445.662 bits (1145), Expect = 5.770e-151
Identity = 214/414 (51.69%), Postives = 290/414 (70.05%), Query Frame = 3
Query:  612 ICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQM--AQNNKEPIQNDEDFTK-----------VQRPWIQCINENKEAW 1814
            +C +++ FP  A   +P+ V++W+SNTFT RT  T  K  + + +S+   ++AGI  +RIYRR+S S+   +PP+VM  MK  L+SW F++F  +    NHSLK +GYEL H  NM+++F ID   LE+FL K+E+GY+  +NPYH+  HAADVAQTC I+IS+S L  WMTD+E+LA+L AA+IHDYEHTGTTN +HV +SSDLAL+YNDR VLEN+H+SS F L+++  Y I   L KEEYK+ R +VIE+VL TDMS+HF QL+ MK  + +PEN++KI   S ++H ADISHPTK W LH++WT L+VEEFF+QGDRE+  GL CSPLCDR+TT++ QSQIGFI+FIVEP F  L DM D ++ +     +K+ I +D    +             RPW   I +NK  W
Sbjct:   57 VCPDEEIFP-DAESDLPENVQDWISNTFTSRT--TQYKQHRTRLKSLVKLVQAGIYFDRIYRRVSISSDNFVPPSVMSYMKDKLNSWEFDMFHFNTLCRNHSLKAIGYELMHHTNMISRFLIDLTRLESFLSKMEEGYSLHNNPYHNLIHAADVAQTCFILISKSKLISWMTDIEVLAILIAAIIHDYEHTGTTNNYHVVTSSDLALIYNDRSVLENYHVSSAFTLLQQTQYNILNSLNKEEYKQFRTIVIEMVLATDMSIHFNQLQTMKDAIMLPENLQKINILSFVLHSADISHPTKSWDLHQQWTNLVVEEFFQQGDRERTEGLPCSPLCDRHTTLIPQSQIGFINFIVEPCFQTLSDMFDAVVILFPIDESKKEIVDDSILERPSNPTPSRVIISDRPWFVHIFDNKLNW 467          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000009966.1 (SMESG000009966.1)

HSP 1 Score: 439.499 bits (1129), Expect = 2.563e-148
Identity = 201/422 (47.63%), Postives = 301/422 (71.33%), Query Frame = 3
Query:  579 LESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDFTKVQR---------PWIQCINENKEAWK 1817
            L  A   E +   NEDD+     + +VP E+REWL++TF+  ++S   + EKPKFR+VANAIRAGI+VE+I+++ +  A L IP ++   +++ ++ W+F++F++D+ S  H+L+++G +LF +YN + K+KI+    +NF Q LEDGY+K+ NPYH+  H ADVAQT H +I    L+ W+TD++I A +FAALIHD+EHTGTTN FHVN++SDL +LYND+GVLENHH+S+ FRL+++    + K + KE+Y+E R +VIE+VLNTDMS HF+Q+K+MK++LA+ EN++K  A S ++HCADISHP K W LH +WT  L+EEFFRQGD+E +L +  SPLCDR + ++ +SQ+GF +FIVEPSF +LG+ML+ ++ M + +   ++  E+ +  Q          PW   I  N+  W+
Sbjct:   62 LMDAIANEEQININEDDEINVNTD-AVPGEIREWLTSTFST-SASRVSRIEKPKFRAVANAIRAGIMVEKIFKKSNEIAALKIPNDISKFLRSDINEWSFDIFKLDDMSGGHALRFIGLDLFLRYNFIHKYKINLQYFDNFFQALEDGYSKYGNPYHNLVHGADVAQTVHFMIYTYQLNNWLTDIQIFAAIFAALIHDFEHTGTTNNFHVNTNSDLTILYNDKGVLENHHVSACFRLMQQPHMNLMKNVDKEDYREFRSIVIEMVLNTDMSTHFKQMKSMKSMLALEENIDKGSALSTILHCADISHPAKDWDLHYRWTTQLLEEFFRQGDQESQLEIPFSPLCDRKSIMIPESQVGFSNFIVEPSFNILGNMLEFIIGMMKKDGIKLEIAENISIAQNAPVKGSIHFPWEAKIVNNRSTWQ 481          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000009966.1 (SMESG000009966.1)

HSP 1 Score: 430.639 bits (1106), Expect = 1.408e-144
Identity = 201/436 (46.10%), Postives = 301/436 (69.04%), Query Frame = 3
Query:  579 LESAYIEEAKRICNEDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVER--------------IYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQNNKEPIQNDEDFTKVQR---------PWIQCINENKEAWK 1817
            L  A   E +   NEDD+     + +VP E+REWL++TF+  ++S   + EKPKFR+VANAIRAGI+VE+              I+++ +  A L IP ++   +++ ++ W+F++F++D+ S  H+L+++G +LF +YN + K+KI+    +NF Q LEDGY+K+ NPYH+  H ADVAQT H +I    L+ W+TD++I A +FAALIHD+EHTGTTN FHVN++SDL +LYND+GVLENHH+S+ FRL+++    + K + KE+Y+E R +VIE+VLNTDMS HF+Q+K+MK++LA+ EN++K  A S ++HCADISHP K W LH +WT  L+EEFFRQGD+E +L +  SPLCDR + ++ +SQ+GF +FIVEPSF +LG+ML+ ++ M + +   ++  E+ +  Q          PW   I  N+  W+
Sbjct:   62 LMDAIANEEQININEDDEINVNTD-AVPGEIREWLTSTFST-SASRVSRIEKPKFRAVANAIRAGIMVEKGNYSYKIHLRVSLKIFKKSNEIAALKIPNDISKFLRSDINEWSFDIFKLDDMSGGHALRFIGLDLFLRYNFIHKYKINLQYFDNFFQALEDGYSKYGNPYHNLVHGADVAQTVHFMIYTYQLNNWLTDIQIFAAIFAALIHDFEHTGTTNNFHVNTNSDLTILYNDKGVLENHHVSACFRLMQQPHMNLMKNVDKEDYREFRSIVIEMVLNTDMSTHFKQMKSMKSMLALEENIDKGSALSTILHCADISHPAKDWDLHYRWTTQLLEEFFRQGDQESQLEIPFSPLCDRKSIMIPESQVGFSNFIVEPSFNILGNMLEFIIGMMKKDGIKLEIAENISIAQNAPVKGSIHFPWEAKIVNNRSTWQ 495          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000044267.1 (SMESG000044267.1)

HSP 1 Score: 419.853 bits (1078), Expect = 9.832e-141
Identity = 188/404 (46.53%), Postives = 283/404 (70.05%), Query Frame = 3
Query:  621 EDDDFPTQANGSVPDEVREWLSNTFTRRTSSTAGKDEKPKFRSVANAIRAGILVERIYRRMSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHKYNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIISQSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRGVLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHFQQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVEEFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDMLDRMMQMAQN----NKEPIQND--EDFTKVQRPWIQCINENKEAW 1814
            +D+D  ++ +  +P+ V+EW+S+TFT+R         + + RS+ NA+R G+  +R +R++S    +  PPN MI +K  +++W F++F  +  + NHSLK +GYEL H   ++++F ID  +LE FL KLE+GY+   NPYH+  HAADVA TC +I+S+S L  W++DLE+ ++L +ALIHD+EHTGT+N +HVN +S+LAL+YNDR VLENHH+S+ FRL++++ Y I + L   EY+ELR +VIE+VL TDMS HF Q++ MK  + +PE++ KI   S ++H ADISHP K W +H +WT ++VEEFFRQGD EKE GL+CSPLCDR++T++ +SQIGFI+FIVEP F++LGD+   +  +  +    + +P +N       ++Q PW+  +  NK  W
Sbjct:   66 KDEDIFSETDSELPENVQEWISSTFTKR--QKVSPPPRQRLRSLINAVRVGMYFDRAFRKVSLPGSISAPPNAMIYLKQHINNWTFDIFHFNNLANNHSLKIMGYELLHSNQLISRFSIDINVLEAFLDKLEEGYSLHQNPYHNLIHAADVAHTCFLIVSKSRLFNWLSDLELFSILISALIHDFEHTGTSNNYHVNLNSNLALIYNDRSVLENHHLSAAFRLMKDDRYNIVQSLNANEYRELRNMVIEMVLATDMSAHFNQVQVMKEGVLLPESLRKINILSYVLHSADISHPCKPWEMHHQWTNMVVEEFFRQGDNEKEFGLTCSPLCDRDSTLIPESQIGFINFIVEPCFLVLGDIQKAISILCPDETLLSDDPSENSTVNGEKQIQTPWMDNLGNNKVKW 467          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE1C4.556e-15146.52phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE1C4.556e-15146.52phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE1C8.944e-15046.52phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE1C8.944e-15046.52phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE1B1.295e-14949.08phosphodiesterase 1B [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde-16.632e-15756.66Probable 3',5'-cyclic phosphodiesterase pde-1 [So... [more]
pde-17.246e-15656.66Probable 3',5'-cyclic phosphodiesterase pde-1 [So... [more]
pde-42.557e-7139.86Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-48.618e-7139.86Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-48.732e-7139.86Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde1c1.257e-15357.81gene:FBgn0264815 transcript:FBtr0334135[more]
Pde1c4.203e-15357.78gene:FBgn0264815 transcript:FBtr0334137[more]
Pde1c1.237e-14958.38gene:FBgn0264815 transcript:FBtr0334136[more]
Pde1c1.237e-14958.38gene:FBgn0264815 transcript:FBtr0334140[more]
Pde1c1.708e-14957.37gene:FBgn0264815 transcript:FBtr0334142[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde1a2.535e-14952.74phosphodiesterase 1A, calmodulin-dependent [Source... [more]
pde1a4.334e-14952.74phosphodiesterase 1A, calmodulin-dependent [Source... [more]
CABZ01067973.14.497e-14853.13phosphodiesterase 1C, calmodulin-dependent b [Sour... [more]
pde4d2.027e-7342.61phosphodiesterase 4D, cAMP-specific [Source:ZFIN;A... [more]
pde4d3.051e-7342.27phosphodiesterase 4D, cAMP-specific [Source:ZFIN;A... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef391.119e-15247.93Rho guanine nucleotide exchange factor 39 [Source:... [more]
arhgef391.801e-15247.93Rho guanine nucleotide exchange factor 39 [Source:... [more]
PDE1C1.272e-15153.91phosphodiesterase 1C [Source:NCBI gene;Acc:1004953... [more]
PDE1C1.287e-15153.91phosphodiesterase 1C [Source:NCBI gene;Acc:1004953... [more]
PDE1C1.409e-14953.91phosphodiesterase 1C [Source:NCBI gene;Acc:1004953... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde1c4.556e-15346.74phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:10... [more]
Pde1c1.066e-15246.74phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:10... [more]
Pde1c1.983e-15246.74phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:10... [more]
Pde1c2.280e-15246.74phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:10... [more]
Pde1c2.280e-15246.74phosphodiesterase 1C [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O18696|PDE1_CAEEL9.217e-15556.66Probable 3',5'-cyclic phosphodiesterase pde-1 OS=C... [more]
sp|Q01061|PDE1B_BOVIN1.995e-15049.20Calcium/calmodulin-dependent 3',5'-cyclic nucleoti... [more]
sp|Q64338|PDE1C_MOUSE2.193e-15046.74Calcium/calmodulin-dependent 3',5'-cyclic nucleoti... [more]
sp|P14100|PDE1A_BOVIN4.262e-14947.79Calcium/calmodulin-dependent 3',5'-cyclic nucleoti... [more]
sp|Q14123|PDE1C_HUMAN4.295e-14946.52Calcium/calmodulin-dependent 3',5'-cyclic nucleoti... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EIK02.336e-861.38Phosphodiesterase OS=Macrostomum lignano OX=282301... [more]
A0A267EML72.459e-861.15Phosphodiesterase OS=Macrostomum lignano OX=282301... [more]
A0A267DMU51.236e-660.37Phosphodiesterase OS=Macrostomum lignano OX=282301... [more]
A0A267DMF65.582e-660.05Phosphodiesterase OS=Macrostomum lignano OX=282301... [more]
A0A4E0RAI10.000e+060.42Phosphodiesterase OS=Fasciola hepatica OX=6192 GN=... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE1C4.863e-15348.43phosphodiesterase 1C [Source:NCBI gene;Acc:1030407... [more]
PDE1C3.469e-14947.37phosphodiesterase 1C [Source:NCBI gene;Acc:1030407... [more]
PDE1C4.070e-14947.37phosphodiesterase 1C [Source:NCBI gene;Acc:1030407... [more]
PDE1C1.033e-14847.37phosphodiesterase 1C [Source:NCBI gene;Acc:1030407... [more]
ENSAMXT00000048550.12.207e-13951.75pep primary_assembly:Astyanax_mexicanus-2.0:17:437... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde1a1.746e-15648.68phosphodiesterase 1A, calmodulin-dependent [Source... [more]
PDE1C2.380e-15154.35phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSPMAT00000003038.13.220e-6150.27pep scaffold:Pmarinus_7.0:GL476485:41:13228:1 gene... [more]
ENSPMAT00000007435.11.455e-5346.07pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 ge... [more]
pde7a7.234e-4835.09phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDE25.664e-1326.69High-affinity cyclic AMP phosphodiesterase; compon... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373011.295e-11646.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461333.766e-6833.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321429.469e-4934.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437483.819e-4031.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321797.491e-3930.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde1a3.652e-14250.65calcium/calmodulin-dependent 3',5'-cyclic nucleoti... [more]
ENSORLT00000022279.23.414e-13749.87pep primary_assembly:ASM223467v1:20:1384867:141238... [more]
ENSORLT00000006203.25.254e-13550.13phosphodiesterase 1B [Source:NCBI gene;Acc:1011595... [more]
pde4cb1.267e-7040.89phosphodiesterase 4C [Source:NCBI gene;Acc:1011639... [more]
pde4cb1.777e-7040.89phosphodiesterase 4C [Source:NCBI gene;Acc:1011639... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004031.11.330e-72100.00SMESG000004031.1[more]
SMESG000070067.15.770e-15151.69SMESG000070067.1[more]
SMESG000009966.12.563e-14847.63SMESG000009966.1[more]
SMESG000009966.11.408e-14446.10SMESG000009966.1[more]
SMESG000044267.19.832e-14146.53SMESG000044267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025532 ID=SMED30025532|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=1933bp
TGTAGACACACATTTCTATCTATGTGTGCGCGCTTGTGTGTGCGCACGTG
TGTGTGCGCCAGTGTGCGTGAGCCCTCATTTTCAGTTCATCTTTACTGAA
TGTCAACTCTGTTTCTACACAATTATCTACTACAATTATTTTCTGGCGTT
ATTATATAAAATCTCGAATATTATTGGAAATTTCAAATTTCAGATTATGG
GAACATGTGCTCTGGGAACTCAGGTACATGCTTCAACAAAATTAAATGGA
GATAATTTGAAAGATCAATCAAAATCCATTCAAAAGAAAAGTTTTTCGGA
ATCGAAACCGAAAACTGATGAAAATGAATGGGATTCCAAGATTTGTGATG
AAGAATTAGATCTTCCATTGACTAGTCAGGTATTATACAATAGCTTGGCT
AATTCTCCCAGTACTTTATACGCAAAAAGTACAACTGAAATTGAAGAATT
ACCAAATCCTGGAAGTCCAGAATCGATATATAGTTGTTCTGTTAGATTGT
TGTGTATTATTAAACTAATACAAAAAAATAAAATATCTAAAGAAGATTTA
CTGAAACATAAATTACGCCATTTTAGTTTTAGAGTCAGCATATATCGAAG
AAGCAAAAAGAATTTGCAACGAAGATGATGACTTTCCAACTCAAGCTAAT
GGCTCAGTTCCTGATGAAGTTCGAGAATGGCTTTCAAATACTTTTACTAG
ACGAACTTCATCTACTGCCGGAAAAGATGAGAAACCTAAATTTCGAAGTG
TAGCAAATGCTATTAGAGCGGGAATTCTCGTTGAAAGAATATATAGAAGA
ATGTCGAGTAGTGCTGGTCTTCCTATTCCACCAAACGTGATGATTTTAAT
GAAGGCAGGTCTTGATTCTTGGAATTTCAATGTATTCGAAGTAGATGAAG
CAAGCGAAAATCACTCTCTCAAATATTTAGGATACGAATTGTTTCACAAG
TATAACATGATGACAAAATTTAAGATTGATTCAGTGATATTGGAAAACTT
CCTTCAAAAACTGGAAGATGGATATGCAAAATTTTCTAATCCCTATCATA
GTTTTACTCATGCAGCAGATGTTGCTCAAACATGCCATATCATTATATCA
CAAAGTGGCCTTTCACGATGGATGACAGATTTAGAAATTCTAGCAGTTTT
ATTTGCTGCATTAATCCATGATTACGAGCATACTGGTACAACTAATGGCT
TTCATGTAAATTCAAGTTCAGATTTAGCCTTGTTATATAATGATAGAGGA
GTTCTTGAAAACCACCACATTTCATCTGTATTTCGACTTATCCGTGAAGA
AAGCTATCAAATTTTCAAAGGTTTAACCAAAGAGGAATATAAAGAGCTTC
GATTACTTGTTATCGAAATAGTGCTTAATACAGACATGTCTCTACACTTT
CAACAACTAAAAAATATGAAAACGTTATTAGCTGTGCCAGAAAACGTAGA
AAAAATAAAAGCTTTTTCCTTGTTGGTTCACTGTGCTGATATTTCTCATC
CTACGAAACAGTGGCATTTGCATGAAAAATGGACCCTTTTATTAGTTGAA
GAATTTTTCAGACAGGGAGATAGAGAAAAAGAATTGGGGCTTTCATGTTC
GCCTTTGTGTGACAGAAACACAACTGTTGTCGCTCAGTCCCAAATAGGTT
TCATTGATTTTATTGTTGAACCAAGTTTTGTACTTCTGGGGGATATGTTA
GATAGAATGATGCAAATGGCTCAAAACAACAAAGAACCAATTCAAAACGA
TGAAGATTTCACTAAGGTACAGCGGCCATGGATTCAATGCATTAATGAAA
ACAAAGAAGCCTGGAAAATCAGAGCACCGAAAAAGGAATAATGCATTATA
TAGATTCTGTATTTATAACTATTAACTAAATGGAAAAGTAAACAGACGAT
TATATGTATAATTAGAAGAAACTTAATAGATCC
back to top

protein sequence of SMED30025532-orf-1

>SMED30025532-orf-1 ID=SMED30025532-orf-1|Name=SMED30025532-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=347bp
MSSSAGLPIPPNVMILMKAGLDSWNFNVFEVDEASENHSLKYLGYELFHK
YNMMTKFKIDSVILENFLQKLEDGYAKFSNPYHSFTHAADVAQTCHIIIS
QSGLSRWMTDLEILAVLFAALIHDYEHTGTTNGFHVNSSSDLALLYNDRG
VLENHHISSVFRLIREESYQIFKGLTKEEYKELRLLVIEIVLNTDMSLHF
QQLKNMKTLLAVPENVEKIKAFSLLVHCADISHPTKQWHLHEKWTLLLVE
EFFRQGDREKELGLSCSPLCDRNTTVVAQSQIGFIDFIVEPSFVLLGDML
DRMMQMAQNNKEPIQNDEDFTKVQRPWIQCINENKEAWKIRAPKKE*
back to top

protein sequence of SMED30025532-orf-2

>SMED30025532-orf-2 ID=SMED30025532-orf-2|Name=SMED30025532-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
VDTHFYLCVRACVCARVCAPVCVSPHFQFIFTECQLCFYTIIYYNYFLAL
LYKISNIIGNFKFQIMGTCALGTQVHASTKLNGDNLKDQSKSIQKKSFSE
SKPKTDENEWDSKICDEELDLPLTSQVLYNSLANSPSTLYAKSTTEIEEL
PNPGSPESIYSCSVRLLCIIKLIQKNKISKEDLLKHKLRHFSFRVSIYRR
SKKNLQRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR023088PDEase
IPR003607HD/PDEase_dom
IPR002073PDEase_catalytic_dom
IPR013706PDEase_N
IPR023174PDEase_CS
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 195..205
NoneNo IPR availableTMHMMTMhelixcoord: 32..54