coiled-coil domain-containing protein 105

Overview
Namecoiled-coil domain-containing protein 105
Smed IDSMED30025527
Length (bp)1383
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein 105 (SMED30025527) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 105 (SMED30025527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein 105 (SMED30025527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 105 (SMED30025527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025527SMESG000077974.1 SmedASXL_009148SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025527SMESG000077974.1 dd_Smed_v4_14773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025527SMESG000077974.1 dd_Smed_v6_14773_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025527SMESG000077974.1 OX_Smed_1.0.04891ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025527SMESG000077974.1 dd_Smed_v4_14773_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Human
Match: CCDC105 (coiled-coil domain containing 105 [Source:HGNC Symbol;Acc:HGNC:26866])

HSP 1 Score: 110.153 bits (274), Expect = 1.915e-25
Identity = 96/358 (26.82%), Postives = 164/358 (45.81%), Query Frame = 2
Query:  215 HAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPT-----------DPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKSQEMHC 1255
            HAR  R     L  +  Q N  +++L   ++     L  ++    IN++S  +R  RP++EK + D AD++L  EK +L +++  +E  ++  +  L  +   R  L    KER + +DL+ Q    +L+              +    +NL   PT           DP+  Y PAC  A+  A  +  +S+    ++A N   +++ + + S  V +S   K SET ++K +L M     R    +  ++      T    +GP     L   E+LDRP+++++QRH GTQLPEA  L Q  +KL+  +     N+D L A    L   +  K+   +VD + +R R  + Q   C
Sbjct:  129 HARGARLTAARLGRAQHQINGRVRQLLRQREVTDHRLSEVRKGLLINQQSVKLRGYRPKSEK-VPDKADSMLTWEKEELKSMKRKMERDMEKSEVLLKTLASCRDTLNFCFKERLQAVDLMNQPLDKVLEQA------------RRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKRLLVESKDTLVEMAKNEVDVREQQLQISDRVCASLAQKASETLELKERLNMTLGLMRGTILRCTKYNQELYTTHGLIKGPLSKVHLETAEKLDRPLVRMYQRHVGTQLPEAARLAQGTDKLQCHITYLEKNLDELLATHKNLSWGLNCKNIGHEVDGNVVRLRLRQRQPHVC 473          
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Zebrafish
Match: ccdc105 (coiled-coil domain containing 105 [Source:ZFIN;Acc:ZDB-GENE-131121-219])

HSP 1 Score: 117.087 bits (292), Expect = 3.805e-28
Identity = 88/343 (25.66%), Postives = 159/343 (46.36%), Query Frame = 2
Query:  185 AGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKS 1213
            A +S   A  + R VR +   L++   +  +E  K+   ++   K L +++    +N++S + R  RP T +   DGAD+LL+ E+  L  ++  LE+ L+        +  +  +L      R+ V +LL Q G  +   +                P++L+  P  P   +TP CK+A+ ++  V ++SQQ RE I   +  + + +    +  + + + K++ET  ++  L ++    R A  + QR    A  ++    GP    DL  RERL+RP+ +++ RH    LPE+  L Q D  LR  +  +   I  L+    +L  D+  K  A  VD +
Sbjct:  115 AVVSTGLAADYMRSVREVEGHLRKQTGRVTQEATKVEHQRERLEKLLRSLRKALLVNQQSANGRTFRPATTETGRDGADDLLQTERRGLNMLKQELESMLRKTLAQQQALADSSKQLLDCAFLRSSVTELLPQHGSLLAGVKTYP------------SPLSLKPDPAGP---FTPECKQALDSSSAVLQESQQLRENITQVMSDVIRKQTDMHRSASEALLRKITETINLEQHLTLSSAATRQAIYRKQRQMQCAGYSLGRALGPVCRADLFCRERLNRPMTQLYGRHSSVGLPESDLLAQGDTMLRKHLESSGKEIAALQDAHQQLEDDMYGKRAAAGVDSA 442          
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Xenopus
Match: fam207a (family with sequence similarity 207 member A [Source:Xenbase;Acc:XB-GENE-954075])

HSP 1 Score: 110.538 bits (275), Expect = 5.674e-26
Identity = 94/354 (26.55%), Postives = 170/354 (48.02%), Query Frame = 2
Query:  170 HKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRR 1231
            H+D+IA  SN  A  + R+ ++++  L++ + +    I++L  ++    +   NI+ D   NRE+  +R  RP+ E +  D AD LL+ EK  L+ ++   E  L+ I   L  +   R  L++  KE++RVL+++ +                   +   QE   +       L+     C   I +A   C   Q+      N +++IQ  +E  ++ +N     K  E+ QI+  + +A    R+   K  +  +  + +     GP    DL VRERLDRP+IK+ QRHPGTQ+PE+  +++    L  ++ K+   ID      ++L +D +SK     +D++ +R R+
Sbjct:   62 HRDVIAETSNILARGYMRDTKHLMMHLRQVLGEIGRNIQRLQTMRHMLERTHANIRRDILTNRETIQLRTARPKKEMQ-HDKADTLLQDEKNGLMEVKKGSEQQLQEISRQLQVLYHHRQILSEFCKEKSRVLEIVNETASP---------------YAPGQETTRMNQF----LNQRNADCLTEINSAFVTCEMLQKMLPLKLNRVKEIQDLKESVTKGLNI----KADESLQIRENVILALGETRNYIQKQHKLRDEIKTSYISQMGPVSTLDLSVRERLDRPLIKVLQRHPGTQVPESTLILKGTAVLEQAVEKSQRKIDFQEIARSKLEQDAKSKLWGEKIDRTAVRMRK 391          
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Xenopus
Match: fam207a (family with sequence similarity 207 member A [Source:Xenbase;Acc:XB-GENE-954075])

HSP 1 Score: 108.612 bits (270), Expect = 4.022e-25
Identity = 100/368 (27.17%), Postives = 176/368 (47.83%), Query Frame = 2
Query:  170 HKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLL------------CQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTP--TDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRR 1231
            H+D+IA  SN  A  + R+ ++++  L++ + +    I++L  ++    +   NI+ D   NRE+  +R  RP+ E +  D AD LL+ EK  L+ ++   E  L+ I   L  +   R  L++  KE++RVL+++              R    L+ R +  +     F     PI L   P    P   +   C   I +A   C   Q+      N +++IQ  +E  ++ +N     K  E+ QI+  + +A    R+   K  +  +  + +     GP    DL VRERLDRP+IK+ QRHPGTQ+PE+  +++    L  ++ K+   ID      ++L +D +SK     +D++ +R R+
Sbjct:   62 HRDVIAETSNILARGYMRDTKHLMMHLRQVLGEIGRNIQRLQTMRHMLERTHANIRRDILTNRETIQLRTARPKKEMQ-HDKADTLLQDEKNGLMEVKKGSEQQLQEISRQLQVLYHHRQILSEFCKEKSRVLEIVNETASPYAPGQETTRMNQFLNQRNAGNSILKTEFKIMSIPI-LSFFPIIAHPFLCFL-DCLTEINSAFVTCEMLQKMLPLKLNRVKEIQDLKESVTKGLNI----KADESLQIRENVILALGETRNYIQKQHKLRDEIKTSYISQMGPVSTLDLSVRERLDRPLIKVLQRHPGTQVPESTLILKGTAVLEQAVEKSQRKIDFQEIARSKLEQDAKSKLWGEKIDRTAVRMRK 422          
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Mouse
Match: Ccdc105 (coiled-coil domain containing 105 [Source:MGI Symbol;Acc:MGI:1918226])

HSP 1 Score: 116.701 bits (291), Expect = 9.243e-28
Identity = 97/356 (27.25%), Postives = 169/356 (47.47%), Query Frame = 2
Query:  167 VHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEP--INLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWR 1228
            +H+D  A  + +    HAR  R     L  +  Q N +++ L   ++   + L  ++    IN++S  +R  RP+ EK I D AD+LL  EK +L +++  +E  ++  ++ L  +   R  L    +ER + ++L+ Q    +L+        +     +   P    L+  P DP+  YTPAC +A+  A  +  +S+    ++A N   IQ  +++ S  V SS   K+ ET ++K ++ M     R   ++  ++      T    +GP    +L  RE+L+RP+++++QRH GTQLPEA  L Q  + L    +    N+  LR     L   +  K    DVD   +R R
Sbjct:  113 MHRDARAQQTAEVVHAHARGARLTAARLGRAQHQINGQLRLLLRQREATDRRLSEVRKGLLINQQSVKLRGYRPKCEK-IPDKADSLLVWEKKELKSMKRKMEKDMEISEDLLKALASCRDTLDFYCQERLQAVELMNQPLDKVLEQAGRHSWVD---ITRPPTPRTQGLKTPPPDPIGTYTPACAKALFEAKRLLMESKDILTEMAKNEVDIQNQQQEISNRVCSSLAQKMRETLELKERMTMTLGLMRGTIHRCMKFNQEMYVTRGIIKGPLLKRNLEAREKLNRPLVRMYQRHVGTQLPEATRLAQGTDLLTRHNLHMEKNLKELRTTHDNLAWGLNCKKIGHDVDYDVVRLR 464          
BLAST of coiled-coil domain-containing protein 105 vs. UniProt/SwissProt
Match: sp|Q2YDN4|CC105_BOVIN (Coiled-coil domain-containing protein 105 OS=Bos taurus OX=9913 GN=CCDC105 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.519e-30
Identity = 98/354 (27.68%), Postives = 176/354 (49.72%), Query Frame = 2
Query:  167 VHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWR 1228
            +H+D  A  + +    HAR  R     L  +  Q N +++ L   ++   + L  ++    IN++S  +R  RP++E  ISD AD++L  EK +L +++  +E  ++  +  L  +   R  L    KER + ++L+ Q    +L+        N +  + +     L+  P DP+  YTP C +A+  A  +  +S+     +A N E I++ +++ S  V +S   K+ ET ++K++L M     R   ++  ++      T    +GP   + L  RE+LDRP+++++QRH GTQLPEA  L Q  +KL+  +     N+D L ++  +L      K    +VD S +R R
Sbjct:  113 MHRDARALQTAEVVQAHARGARLTAARLGRAQHQINGQLRLLQRQREATDRRLSEVRKALLINQQSVKLRGYRPKSET-ISDKADSMLTWEKEELKSMKRKMEADMEKSEALLKTLASCRDALVFCCKERLQAVELMNQPLDKVLEQAGRHSWVNISR-VPTPRTQGLKTPPPDPVGTYTPECAKALYEAKRLLMESKDTLLDMAKNEEDIREQQQQISDRVCASLAQKMRETLELKDRLNMTLGLMRGTIHRCTKFNQEMYITRGLIKGPLSKSHLETREKLDRPLVRMYQRHVGTQLPEAARLAQGTDKLQRHISHVEKNLDELLSMRKKLTWSFNCKKIGHNVDYSVVRLR 464          
BLAST of coiled-coil domain-containing protein 105 vs. UniProt/SwissProt
Match: sp|Q9D4K7|CC105_MOUSE (Coiled-coil domain-containing protein 105 OS=Mus musculus OX=10090 GN=Ccdc105 PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 6.465e-27
Identity = 97/356 (27.25%), Postives = 169/356 (47.47%), Query Frame = 2
Query:  167 VHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEP--INLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWR 1228
            +H+D  A  + +    HAR  R     L  +  Q N +++ L   ++   + L  ++    IN++S  +R  RP+ EK I D AD+LL  EK +L +++  +E  ++  ++ L  +   R  L    +ER + ++L+ Q    +L+        +     +   P    L+  P DP+  YTPAC +A+  A  +  +S+    ++A N   IQ  +++ S  V SS   K+ ET ++K ++ M     R   ++  ++      T    +GP    +L  RE+L+RP+++++QRH GTQLPEA  L Q  + L    +    N+  LR     L   +  K    DVD   +R R
Sbjct:  113 MHRDARAQQTAEVVHAHARGARLTAARLGRAQHQINGQLRLLLRQREATDRRLSEVRKGLLINQQSVKLRGYRPKCEK-IPDKADSLLVWEKKELKSMKRKMEKDMEISEDLLKALASCRDTLDFYCQERLQAVELMNQPLDKVLEQAGRHSWVD---ITRPPTPRTQGLKTPPPDPIGTYTPACAKALFEAKRLLMESKDILTEMAKNEVDIQNQQQEISNRVCSSLAQKMRETLELKERMTMTLGLMRGTIHRCMKFNQEMYVTRGIIKGPLLKRNLEAREKLNRPLVRMYQRHVGTQLPEATRLAQGTDLLTRHNLHMEKNLKELRTTHDNLAWGLNCKKIGHDVDYDVVRLR 464          
BLAST of coiled-coil domain-containing protein 105 vs. UniProt/SwissProt
Match: sp|Q4V7B5|CC105_RAT (Coiled-coil domain-containing protein 105 OS=Rattus norvegicus OX=10116 GN=Ccdc105 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.609e-26
Identity = 95/356 (26.69%), Postives = 167/356 (46.91%), Query Frame = 2
Query:  167 VHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEP--INLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWR 1228
            +H+D  A  + +    HAR  R     L  +  Q N +++ L   ++   + L  ++    IN +S  +R  RP+ EK I D AD++L  E+ +L +++  +E  ++  +  L  +   R  L    +ER + + L+ Q    +L+        +     +   P    L+  P DP+  YTPAC +A+  A  +  +S+    ++A N   IQ  +++ S  V +S   K+ ET ++K ++ M     R   ++  ++      T    +GP    DL  RE+L+RP+++++QRH GTQLPEA  L Q  + L    ++   N+  LR     L   +  K    DVD   +R R
Sbjct:  113 MHRDARAQQTAEVVHAHARGARLTAARLGRAQHQINGQLRLLLRQREATDRRLSEVRKGLLINEQSVKLRGYRPKCEK-IPDKADSMLVWEREELKSMKRKMEKDMERSEALLKALASCRDTLDFYCQERLQAVGLMNQPLDKVLEQAGRHSWVD---ITRPPTPRTQGLKTPPPDPVGAYTPACAKALFEAKRLLMESKDILAELAKNEVDIQNQQQEISDRVCNSLAQKMRETLELKERMTMTLGLMRGTIHRCMKFNQEMYVTRGLIKGPLLKRDLEAREKLNRPLVRMYQRHVGTQLPEATRLAQGTDLLTRHNLQMEKNLKELRTTHDNLAWSLNCKKIGHDVDYDVVRLR 464          
BLAST of coiled-coil domain-containing protein 105 vs. UniProt/SwissProt
Match: sp|Q8IYK2|CC105_HUMAN (Coiled-coil domain-containing protein 105 OS=Homo sapiens OX=9606 GN=CCDC105 PE=1 SV=3)

HSP 1 Score: 110.153 bits (274), Expect = 9.195e-25
Identity = 96/358 (26.82%), Postives = 164/358 (45.81%), Query Frame = 2
Query:  215 HAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPT-----------DPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKSQEMHC 1255
            HAR  R     L  +  Q N  +++L   ++     L  ++    IN++S  +R  RP++EK + D AD++L  EK +L +++  +E  ++  +  L  +   R  L    KER + +DL+ Q    +L+              +    +NL   PT           DP+  Y PAC  A+  A  +  +S+    ++A N   +++ + + S  V +S   K SET ++K +L M     R    +  ++      T    +GP     L   E+LDRP+++++QRH GTQLPEA  L Q  +KL+  +     N+D L A    L   +  K+   +VD + +R R  + Q   C
Sbjct:  129 HARGARLTAARLGRAQHQINGRVRQLLRQREVTDHRLSEVRKGLLINQQSVKLRGYRPKSEK-VPDKADSMLTWEKEELKSMKRKMERDMEKSEVLLKTLASCRDTLNFCFKERLQAVDLMNQPLDKVLEQA------------RRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKRLLVESKDTLVEMAKNEVDVREQQLQISDRVCASLAQKASETLELKERLNMTLGLMRGTILRCTKYNQELYTTHGLIKGPLSKVHLETAEKLDRPLVRMYQRHVGTQLPEAARLAQGTDKLQCHITYLEKNLDELLATHKNLSWGLNCKNIGHEVDGNVVRLRLRQRQPHVC 473          
BLAST of coiled-coil domain-containing protein 105 vs. TrEMBL
Match: A0A2C9JWN2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106070943 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.699e-74
Identity = 147/416 (35.34%), Postives = 227/416 (54.57%), Query Frame = 2
Query:   23 MFEISNSKKSIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAIL-----DXXXXXXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKSQEMHC 1255
            M   + +  +IGP  WK RS   ++  Q  I N + +    +  D   + +D++A LSN E  K+ REVR IV  L+ES+++TNEEIK L   K+   + L + + D ++N++SK +R  RP  EK   DGAD+LL  E + L+N +  LE  LK++Q+HL  +   R +     +ER+RVLD+LCQ   A+L     +  L    S     L   +P  + +   DP   YTP     +  A +    S   R+++ N ++++ K ++ + + VN     K++ET  +K  L +     R A ++AQRW +  EK   +  GP KY+DL   E  DRP+++++QRHPGTQLPEAQE+I+  + L  S+   + NI  L+ ++  L  D RSKS A D+D S +R RR K     C
Sbjct:    1 MSTAAKAPVTIGPESWKNRSLRGMKLGQTVISNSDRNCDIGRSTDALPLIRDVLATLSNDEIRKYMREVRVIVAKLRESLIETNEEIKALTRGKEALERALEHTRKDIQLNKDSKFVRLTRPPIEKD-HDGADDLLNAEYSHLVNCKKTLEIQLKSVQQHLQCLESVRKQTFANLQERSRVLDILCQSLSAVLRPERDNLVLKPNRSQVEGRLSMVDPSKMGSDKIDPFGPYTPQVDTVLGDATDARNQSAYLRQELRNTIDRVDKLKQAAHKSVNDGLTRKVAETVTLKQHLNLGLGENRHAVHRAQRWYDSTEKAFGYTLGPVKYSDLKTSEHFDRPLVRLYQRHPGTQLPEAQEIIKSGDGLLQSLTATSRNIGMLKVVEKRLQDDKRSKSAAADIDSSVIRMRRSKHDHRWC 415          
BLAST of coiled-coil domain-containing protein 105 vs. TrEMBL
Match: A0A2T7NK32 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17316 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.418e-66
Identity = 141/408 (34.56%), Postives = 226/408 (55.39%), Query Frame = 2
Query:   53 IGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKS-------QEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKSQEMHC 1255
            IGP  W+  S + ++  Q  ++  + S    + LD     +D++A LSN+E  ++ R+VR +V  L+ESI+ TNEEIK L   K+   K L +I+ D ++N++S++IR  RP  E+   DGAD+LL  E+  LIN +  LE  L+ +Q+ L  ++ AR  L  + +ER RV+DLLC    +I+++  +   S+    L +        +   L    TD L  YTP   +A+  AD     S   R+ I   ++ I++ +  + ++VN   + K+SETE +K  L++     R A ++AQRW +  E    +  GP   +DL+ RERLDRP++++FQRH GTQLP+A+E+I+  + L  S+   + NI  +R  + +L  DIRSKS    +D      RR K+    C
Sbjct:    9 IGPANWRNNSIKTVKLSQTIVQKSDKSNDLGRSLDPLPHMRDIVASLSNEEVRRYTRDVRVVVAKLRESILDTNEEIKSLTRGKEALEKCLEHIRKDIQLNKDSQAIRTTRPPRERD-HDGADDLLNAERAHLINSKKQLEIQLRLVQQQLQVLDAARKRLFAVHQERARVVDLLCHADSSIVNAAANAEISDKKRALSALDGRVSVVDSSRLGVAMTDALGPYTPETDQALGEADEARSRSAYLRQGIRETIDTIERLQRAAHKLVNDGLVKKISETETLKQHLRVCHGENRHAIHRAQRWYDATELAWGYTLGPVMSSDLMTRERLDRPLVRVFQRHVGTQLPDAREIIKSGDGLLQSLNATSRNIGLMRLTEQKLLDDIRSKSAGSHIDSQVFHLRRSKANHRWC 415          
BLAST of coiled-coil domain-containing protein 105 vs. TrEMBL
Match: R7VCB3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_194748 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.927e-65
Identity = 149/405 (36.79%), Postives = 225/405 (55.56%), Query Frame = 2
Query:   53 IGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLEN---------TPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKS 1240
            IGP+KW+  + ++I+  ++ I   + +    +  D     +D++A LSN EA ++ REVR +V  L+ES++ TNEEIK L   ++   K L +I+ D ++NR+S+S+R  RP  EK I DGAD+LL  E   L N++  LET L+T Q  L  +N AR  L+ + +ER+RV DL+C    AI  S  +   S  +   +S    ++E           PTDPL  YTP  + A+  A +    S   R  I+N ++K  K ++ + + VN     K++ET  +K  L +A    + A N+A RW    EK   + +GP    D   RERL RP+I++FQRHPGT LPEAQE+I+ ++ L  S+   + NI  L+    +L  DI  K   MD+D + LR RR K+
Sbjct:   13 IGPSKWRNNTLKEIKLSENVIHRSDRNCDLGRSSDPLPNLRDVVAELSNDEAHRYFREVRVVVSILRESLIDTNEEIKSLTRGREALEKTLEHIRKDIKLNRDSRSVRVSRPPREKNI-DGADDLLHAEGMHLNNLKKSLETQLQTTQRQLQWLNSARRRLSAVLQERSRVQDLIC---AAIPSSSANATRSMFSGGRQSGMGFSMEREKTDFMTNAPPTDPLGPYTPESESALLEAKDARSHSASLRHDISNLIDKANKTQKSAHKSVNYGLTSKIAETAGLKQHLDVAHAENQHAQNRANRWYESTEKAWGYAKGPASSADFACRERLTRPVIRVFQRHPGTNLPEAQEIIRSNDGLLQSLHNTSRNIGLLKLAQLKLKDDISDKRSGMDIDSNVLRMRRRKA 413          
BLAST of coiled-coil domain-containing protein 105 vs. TrEMBL
Match: K1QIQ6 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10018075 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.966e-63
Identity = 144/416 (34.62%), Postives = 221/416 (53.12%), Query Frame = 2
Query:   50 SIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLL-----------------CQRGGAILDXXXX--XXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKS 1240
            +IGP  W+  + + I+  Q  ++  + S    + LD     +D +A LSN E  ++ REVR IV  L+ES++ TNEEIK LN  K+   K L + + D  +N++S+ IR  RP  E++  DGAD+LL  E+  L+N +  LE  L+++Q+ L  ++ AR  L  +  ER+RV+DLL                   R    +D RLS     S    F+   +P        DPL  YTP   +A+  A+     S   R ++ + +++ +K ++ + + VN     K++ET  +K  L +     R   ++AQRW +  +K   +  GP  Y+D+  RERLDRP++K+FQRHPGTQLPEAQE+I+  + L  S+   + NI  L+     L  DI+ K  A  VD S +R RR KS
Sbjct:    9 TIGPESWRNSTLKGIKLSQTIVQKSDKSCDVGRSLDPLPHLRDTVAQLSNDEIHRYTREVRVIVAKLRESLLDTNEEIKALNRGKEALEKALEHTRKDIALNKDSQEIRVSRPSRERE-HDGADDLLNAERAHLLNCKKALEAQLRSVQQQLQVLDAARRRLFNVLNERSRVMDLLNHALSAANAGSQSAPIGVGRSRTSMDGRLSRLQDMSGKLGFMSLGQP--------DPLGPYTPEADQALVDAEEARARSAYLRRELKDAIDRTEKLQKAAHKSVNDGITQKVAETITLKQHLGVGLGENRHGIHRAQRWYDATDKARGYTMGPVAYSDIATRERLDRPMVKVFQRHPGTQLPEAQEIIRSGDGLLQSLSATSRNIGLLKLSQLRLRNDIKGKGLASSVDSSIIRLRRRKS 415          
BLAST of coiled-coil domain-containing protein 105 vs. TrEMBL
Match: A0A210PSX9 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT03950 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.868e-62
Identity = 136/401 (33.92%), Postives = 219/401 (54.61%), Query Frame = 2
Query:   35 SNSKKSIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVH-KDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQ-----EPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTL 1219
            + +  +IGP  W+  + + I+  Q  ++  + S  ++ ++   L H +D +A LSN E  ++ REVR +V  L+ES++ TNEEIK L+  ++   K L + + D R+N++S+ IR  RP  E++  DGAD+LL  E+  L+N +  LE  LK++Q+ L  ++ AR  L    +ER+RVLDLL     +I ++        +    K+        + L  T  DPL  +TP   +++  A+     S   R ++   +E+ +K +E + + VN     KLSET  +K  L +     R   ++AQRW +  EK   +  GP    D+  RERLDRP++++F RHPGTQLPEAQE+I+    L  S+   + NI  L   + +L +DI+SK  A  VD S +
Sbjct:    4 TKAATTIGPESWRNSTLKGIKISQTIVQKSDKS-CDVGRVFDPLPHLRDTVAQLSNDEIHRYTREVRIVVARLRESLLDTNEEIKALSRGREALEKSLEHTRKDIRLNKDSQDIRVSRPSKERE-HDGADDLLNAERAHLLNCKKALEAQLKSVQQQLQVLDAARRRLFATLQERSRVLDLLNHALSSISNTASCMAGPGSLHRSKTSLDGRLSRLALATTQADPLGPFTPEADQSLLDAEEARSRSGYLRRELKEAIERTEKLKEAAHKSVNDGITQKLSETITLKQHLGVTLGENRHGIHRAQRWYDATEKARGYTLGPVTSADMTTRERLDRPLVRVFHRHPGTQLPEAQEVIKNGGGLLQSLTATSRNIGLLNLANIKLREDIKSKGVASSVDASII 402          
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Cavefish
Match: ccdc105 (coiled-coil domain containing 105 [Source:ZFIN;Acc:ZDB-GENE-131121-219])

HSP 1 Score: 112.079 bits (279), Expect = 1.425e-26
Identity = 106/436 (24.31%), Postives = 182/436 (41.74%), Query Frame = 2
Query:   23 MFEISNSKKSIGPNKWKERSYEKIRR-----LQHHIENIENS----------------------PWNIQKLDVTLVH------------KDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKS 1213
            +F    +  S+G  KW++RS   I+R     LQ H++ +++                       P   +    TL              +D  A +S   A K+ R VR +  +L+    +  +E  KL   ++   K L++ +    +N++S   R  RP T +   DGAD LL  E+  L  ++  ++  LK        +     +L     ER+ V++LL Q G             + N    S  P++++     P   YTP CKE + ++    + SQQ RE I   +      ++      N   + K++ET  +++ L ++    + A N+ QR    A  +     GP    DL  RE+LDRP+++++ RH    LPE+  L Q +  L+  +  A   ++ L+     L +D   K  A  VD S
Sbjct:    5 VFSAPAAPVSVGDQKWRDRSLSSIQRAQRLVLQTHMDALQSPARYRRAPLSSRLSNSIRLETLDPIRPKSTGTTLYSLGVGGPFPSPALRDQSAEVSISLAGKYMRGVREVEGWLRREAGKVTQEATKLQHQRERLEKLLWSFRKALLVNQQSTDGRKCRPATTETGRDGADLLLSHERKGLNKLKQKMDIILKDTLTQEQALAHCSRQLLDCALERSSVIELLPQLGSP-----------SKNVHTSSSSPLSMKPDSAGP---YTPECKEVLESSAAELQKSQQLRESIKQLMCDAIIKQKNLHYSANEGLLKKIAETVNLQHHLTLSSAATKQAINRKQRQMQSASYSHGRVLGPVSSEDLFCREKLDRPVMQVYGRHQSWLLPESNLLTQGNVTLKQHLESAEKAVEELQVARLHLDEDTYLKRAAASVDSS 426          
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Nematostella
Match: EDO30555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0F2])

HSP 1 Score: 194.512 bits (493), Expect = 1.733e-57
Identity = 131/400 (32.75%), Postives = 199/400 (49.75%), Query Frame = 2
Query:   50 SIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQ-----RGGAILDXXXXXXXXXXXXFLKSQEPINLENTP-TDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRR 1231
            +IG + WK  S   IR  Q  +   + +    Q+LD     +D     SN     + R  R ++  LQE+++ TNEEIK L   K+   K L +I+ D  +N +S SIR  RP  EK   DGAD+LL  E+  L+ ++  LE  L++ Q+ L  ++  R  L    +ER+RV+DL+C      RG  I D                   I   +TP  +PL  YTP C   I  A +  + S   R+++A  +E+  K ++ +   VN     K++ET  ++  LQ+     R + ++++RW N  E  + +  GP  Y+DL  RE LDRP +KIFQRHPG QLPEA+E+ +    L+ S+     NI  L+     +  D   K  A  +D + +R RR
Sbjct:    6 TIGCDTWKNASVRNIRLGQTVVNRSDKACDMGQQLDPLPSLRDTSIQQSNARIHAYVRATRAVLVKLQENLLDTNEEIKSLIKGKETLEKTLEHIRKDIVLNNKSTSIRKTRPPREKS-PDGADDLLTAERKHLLKLKRILEAQLRSAQKQLQVLDANRKRLRAAVQERSRVMDLICHAVSSVRGAGIKDQ------------------IERPSTPEVEPLGPYTPECARVISEAADARQRSSTLRKEVAEAIEQTIKLQKAAHNSVNDGLTQKVAETVSMRQHLQVGGGELRMSIHRSKRWYNATEMALGYTLGPVAYSDLTTREHLDRPTVKIFQRHPGNQLPEAREIGRGGQGLQESLNATARNIGLLKLTKDRIDSDASDKHHASLIDSNVVRDRR 386          
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Medaka
Match: ccdc105 (coiled-coil domain containing 105 [Source:NCBI gene;Acc:101168150])

HSP 1 Score: 141.354 bits (355), Expect = 8.914e-37
Identity = 95/349 (27.22%), Postives = 164/349 (46.99%), Query Frame = 2
Query:  194 SNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKS 1240
            S+  A ++ REVR +   LQ    +  EE+ KL   + +  + L  ++ D  +NR S+  R+KRP       DGAD+LL  E+ +L  ++  LE  L   +  L  + ++   L     ER +VL+LL + G A L                       ++  T P S +TP CK+ + ++    + SQ  R++I   L      +  +   VN S + K++E + ++  L + R   R A ++ QR       +    QGP+  +D L RE+L+RP+++++QRH   +LPEA  + Q    L   +      +  L+    +L  D+ S+  A  VD++ L  RR ++
Sbjct:  111 SSAMASRYMREVREVEAQLQRQAGRVTEEVTKLQGERGHLERALRGLRTDLAVNRRSREARSKRPAPVNTEKDGADSLLLWERKELTELKLDLEEVLGNTRTQLQALGESSRRLLACASERAQVLELLPRSGSAGLHGAT-------------------DHMQTLPNSSFTPKCKQVLESSSLAVQQSQLLRQRIRQTLSSATSRQNAAHLSVNDSLLQKVAEADGVQQSLALTRAATRQAVSRKQREIKSIIYSRGRVQGPEYNSDTLTREKLNRPLVQVYQRHAAMRLPEAAHIAQGSAALTRCLTSCEGELAALQGACLQLLGDLHSQRAAAQVDQTILHMRRQQA 440          
BLAST of coiled-coil domain-containing protein 105 vs. Planmine SMEST
Match: SMESG000077974.1 (SMESG000077974.1)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 412/412 (100.00%), Postives = 412/412 (100.00%), Query Frame = 2
Query:   23 MFEISNSKKSIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDXXXXXXXXXXXXFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKSQEMHCK 1258
            MFEISNSKKSIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDSRLSTRNSNNNSFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKSQEMHCK
Sbjct:    1 MFEISNSKKSIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVHKDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKYLYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHLETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDSRLSTRNSNNNSFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFREQIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASNKAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEAQELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLRWRRYKSQEMHCK 412          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1051.915e-2526.82coiled-coil domain containing 105 [Source:HGNC Sym... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1053.805e-2825.66coiled-coil domain containing 105 [Source:ZFIN;Acc... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam207a5.674e-2626.55family with sequence similarity 207 member A [Sour... [more]
fam207a4.022e-2527.17family with sequence similarity 207 member A [Sour... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc1059.243e-2827.25coiled-coil domain containing 105 [Source:MGI Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q2YDN4|CC105_BOVIN3.519e-3027.68Coiled-coil domain-containing protein 105 OS=Bos t... [more]
sp|Q9D4K7|CC105_MOUSE6.465e-2727.25Coiled-coil domain-containing protein 105 OS=Mus m... [more]
sp|Q4V7B5|CC105_RAT2.609e-2626.69Coiled-coil domain-containing protein 105 OS=Rattu... [more]
sp|Q8IYK2|CC105_HUMAN9.195e-2526.82Coiled-coil domain-containing protein 105 OS=Homo ... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JWN25.699e-7435.34Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7NK324.418e-6634.56Uncharacterized protein OS=Pomacea canaliculata OX... [more]
R7VCB32.927e-6536.79Uncharacterized protein OS=Capitella teleta OX=283... [more]
K1QIQ61.966e-6334.62Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A210PSX91.868e-6233.92Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1051.425e-2624.31coiled-coil domain containing 105 [Source:ZFIN;Acc... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO305551.733e-5732.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1058.914e-3727.22coiled-coil domain containing 105 [Source:NCBI gen... [more]
back to top
BLAST of coiled-coil domain-containing protein 105 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077974.10.000e+0100.00SMESG000077974.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025527 ID=SMED30025527|Name=coiled-coil domain-containing protein 105|organism=Schmidtea mediterranea sexual|type=transcript|length=1383bp
CTATATAAATCTTATATGTTAGATGTTTGAAATTTCAAATTCAAAGAAAA
GTATTGGACCAAACAAGTGGAAAGAAAGATCTTATGAAAAGATCAGGAGA
CTTCAACATCATATTGAAAATATTGAAAATTCTCCATGGAATATTCAAAA
ATTGGATGTAACTTTAGTTCACAAGGACTTGATTGCTGGATTGAGTAATC
AAGAGGCTCTCAAACACGCTCGTGAAGTACGAAATATAGTATTTTTCCTC
CAAGAGTCTATTGTTCAAACCAATGAAGAAATCAAAAAGCTGAATATATT
GAAACAAAACTATGGAAAATATTTATATAATATCAAAGTCGATCAACGTA
TAAATCGTGAAAGTAAATCCATTAGAAATAAACGACCAGAAACAGAGAAA
AAAATTTCAGATGGTGCAGATAACTTGTTAGAAGTCGAGAAAACCCAACT
AATCAACATTCGGTTTCATTTAGAAACCGCTTTGAAAACCATTCAAGAAC
ATCTTCTAAATGTCAATCAAGCCAGGTTTGAACTGACAAAGATTCAGAAA
GAAAGAAATCGAGTTCTCGATTTACTCTGCCAACGAGGAGGAGCCATTTT
GGACTCGAGATTGTCCACAAGAAATTCGAATAATAATTCATTCCTGAAAA
GTCAAGAACCAATTAATCTTGAAAATACTCCAACTGACCCCTTATCGGGG
TACACTCCTGCTTGTAAAGAAGCAATACGTGCAGCTGATAATGTCTGTCG
AGATTCACAACAGTTTCGTGAGCAAATTGCTAATAATTTAGAAAAAATAC
AAAAATATCGAGAAAAATCCAGTCAGATTGTTAATTCTAGCTTCATTCAC
AAATTGTCTGAAACAGAACAGATCAAAAATCAACTACAAATGGCGAGAGT
TCGAGCGAGAAGTGCGTCAAATAAAGCGCAAAGATGGTGCAATTTCGCCG
AAAAAACAATGGAATTTAATCAAGGCCCACAAAAATATAACGACCTTCTA
GTTAGAGAACGCCTTGATCGGCCAATTATTAAAATATTTCAAAGACATCC
TGGAACTCAACTTCCAGAAGCCCAAGAATTGATTCAAGTAGACAATAAAT
TGCGATCCTCAATGGTTAAAGCTACGTCTAATATTGATAATCTTCGAGCA
ATTGATGCAGAACTGTATAAAGATATAAGATCAAAATCTAGAGCTATGGA
TGTAGACAAATCTACTCTCCGGTGGAGAAGATATAAATCTCAGGAAATGC
ACTGTAAATAAATATAACAAGCTTTAGTTTTATCGCGTAAATATATTTGA
ATTATTACGATATCCTTGCTAAATTACATATTTCAATTGCTCATTTTAGA
TAGTCATAATTATTTAAACAAACAATAATTATC
back to top

protein sequence of SMED30025527-orf-1

>SMED30025527-orf-1 ID=SMED30025527-orf-1|Name=SMED30025527-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MFEISNSKKSIGPNKWKERSYEKIRRLQHHIENIENSPWNIQKLDVTLVH
KDLIAGLSNQEALKHAREVRNIVFFLQESIVQTNEEIKKLNILKQNYGKY
LYNIKVDQRINRESKSIRNKRPETEKKISDGADNLLEVEKTQLINIRFHL
ETALKTIQEHLLNVNQARFELTKIQKERNRVLDLLCQRGGAILDSRLSTR
NSNNNSFLKSQEPINLENTPTDPLSGYTPACKEAIRAADNVCRDSQQFRE
QIANNLEKIQKYREKSSQIVNSSFIHKLSETEQIKNQLQMARVRARSASN
KAQRWCNFAEKTMEFNQGPQKYNDLLVRERLDRPIIKIFQRHPGTQLPEA
QELIQVDNKLRSSMVKATSNIDNLRAIDAELYKDIRSKSRAMDVDKSTLR
WRRYKSQEMHCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038949CCDC105
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 17..37
NoneNo IPR availableCOILSCoilCoilcoord: 245..265
NoneNo IPR availablePFAMPF03148Tektincoord: 65..403
e-value: 8.2E-23
score: 80.8
IPR038949Coiled-coil domain-containing protein 105PANTHERPTHR35081FAMILY NOT NAMEDcoord: 7..408