T-complex protein 1 subunit gamma

Overview
NameT-complex protein 1 subunit gamma
Smed IDSMED30025525
Length (bp)1745
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-complex protein 1 subunit gamma (SMED30025525) t-SNE clustered cells

Violin plots show distribution of expression levels for T-complex protein 1 subunit gamma (SMED30025525) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of T-complex protein 1 subunit gamma (SMED30025525) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for T-complex protein 1 subunit gamma (SMED30025525) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025525

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30025525SMESG000075311.1 MF669564.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30025525SMESG000075311.1 MF669564.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30025525SMESG000075311.1 MF669564.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30025525SMESG000075311.1 MF669564.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30025525SMESG000075311.1 MF669564.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
reproductive organSMED30025525SMESG000075311.1 Contig40653newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025525SMESG000075311.1 Contig40653uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025525SMESG000075311.1 SMESG000036236.1 Contig10837newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025525SMESG000075311.1 SMESG000036236.1 Contig10837uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30025525SMESG000075311.1 PL06011A2A09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30025525SMESG000075311.1 PL06011A2A09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30025525SMESG000075311.1 PL06011A2A09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testisSMED30025525SMESG000075311.1 PL08004A1B12_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30025525SMESG000075311.1 PL08004A1B12_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30025525SMESG000075311.1 PL08004A1B12_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30025525SMESG000075311.1 SMED_05492_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025525SMESG000075311.1 SMED_05492_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 346/536 (64.55%), Postives = 426/536 (79.48%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            P+LVLS NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  D S+   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI+++CEDII+ KPDVVITEK +SD AQH+L++ANIT IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +N +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ+ Q
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQSRQ 536          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 320/496 (64.52%), Postives = 394/496 (79.44%), Query Frame = 1
Query:  181 MLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  D S+   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI+++CEDII+ KPDVVITEK +SD AQH+L++ANIT IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +N +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ+ Q
Sbjct:    1 MMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQSRQ 491          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 316/536 (58.96%), Postives = 390/536 (72.76%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            P+LVLS NTKR  G+KVQ  NI A K                                      I V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  D S+   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI+++CEDII+ KPDVVITEK +SD AQH+L++ANIT IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +N +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ+ Q
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAK--------------------------------------IQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQSRQ 498          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 327.405 bits (838), Expect = 2.477e-108
Identity = 161/241 (66.80%), Postives = 193/241 (80.08%), Query Frame = 1
Query:   82 NTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGES 804
            NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  D S+   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGES
Sbjct:   37 NTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGES 276          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 303.523 bits (776), Expect = 1.178e-99
Identity = 151/231 (65.37%), Postives = 182/231 (78.79%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIEN 753
            P+LVLS NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIIL GEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  D S+   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+N
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIIL-GEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKN 234          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-3 (T-complex protein 1 subunit gamma [Source:UniProtKB/Swiss-Prot;Acc:Q9N4J8])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 321/526 (61.03%), Postives = 415/526 (78.90%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKK 1638
            PI+VLS  TKR  G +VQ+ NI A K +ADVIRT LGPRAMLKMLMDPMGG VMTNDGNAILREITV+HPAAKSMIEIARTQDEE GDGTTSVIILAGE++  A   LE + HPT II AYR+ALEDM+++ +N  S   D +++AE+ K+VKSCLGTK ISKW D+A  IS++AV+ + + + G +EIDIKR+ RIEKIPGG IED +V+ G++ NKD +H++MRRRIENPRI+LLDCNLEYKKGESQT++E ++E D+   L+ EE+ I K C++II+ KPD+V TEK +SD AQHFL+KA IT +RR++K D  RLAR CGA +V+ T ++++ED+GT A LFEV  I DEY+TYVT  +   ACT+VLRG SKD++NE+ERNLQD+++V RN+++  +LVPGGGA+EMA+S  +++       V + PY A+  ALEVIPRTLIQNCGG  +R +TELR+ H+ + + +  +G+DG +G + DM +LEI DPL V+ QV KTAIET+++LLRIDDIVSGTKK
Sbjct:    8 PIIVLSQGTKRESGHQVQIGNINACKTIADVIRTSLGPRAMLKMLMDPMGGIVMTNDGNAILREITVKHPAAKSMIEIARTQDEETGDGTTSVIILAGEVMAHAQTYLEQKTHPTLIIKAYRQALEDMIQWSENKFSKTVDITDDAEIAKVVKSCLGTKMISKWMDLAVNISIQAVKTIRVEKAGVREIDIKRYCRIEKIPGGRIEDSQVVKGIVVNKDILHAKMRRRIENPRIVLLDCNLEYKKGESQTSLEIMREEDISAILEQEEQAIRKQCDEIIKLKPDLVFTEKGISDLAQHFLLKAGITCLRRLKKTDNNRLARVCGARVVHDTSDLRDEDVGTKAQLFEVVKIADEYYTYVT-AETTTACTVVLRGPSKDVINEVERNLQDSLHVVRNIMINPKLVPGGGALEMALSREIEQQGAKMDGVKKWPYKAIGLALEVIPRTLIQNCGGSTIRKMTELRAIHAQNAENW-TFGVDGTSGDLVDMNKLEIWDPLAVRIQVLKTAIETSVMLLRIDDIVSGTKK 531          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-1 (T-complex protein 1 subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P41988])

HSP 1 Score: 260.766 bits (665), Expect = 1.962e-79
Identity = 173/550 (31.45%), Postives = 302/550 (54.91%), Query Frame = 1
Query:   43 MITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKE----LDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEED------IGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHS-------LDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQ 1641
            M ++G  IL L+   KRT G+ ++  N+ A  A+A+++++ LGP  + KML+D +G  ++TNDG  IL+++ VEHPA K ++E+A+ QDEEVGDGTTSV+I+A E+L +A   ++ ++HPT II+ YR A ++ ++Y+  + S  +D+     ++   K+ + +K I   +D   ++ ++A   V +  +G+    I     + K  G +  +  ++ G   N       M  R++N +I  LD +L   K +    I  V E    L+  R  + E +  ++  + I++   +VV+T   + D      +++    +RR +K D  R+A+A GAT+      ++ ++      +G    + + R I D+    +   K+  A +I+LRGA+  +L+E+ER++ D++ V R VL  ++LV GGGAVE ++S FL+   +T  +  Q+     A+AL +IP+ L  N   D    +T+LR+ HS       L + K+   G+D   G I D KE  I++P   K +  K A E AI +LRIDD++   K++
Sbjct:    1 MASAGDSILALTG--KRTTGQGIRSQNVTAAVAIANIVKSSLGPVGLDKMLVDDVGDVIVTNDGATILKQLEVEHPAGKVLVELAQLQDEEVGDGTTSVVIVAAELLKRADELVKQKVHPTTIINGYRLACKEAVKYISENISFTSDSIGRQSVVNAAKTSMSSKIIGPDADFFGELVVDAAEAVRVENNGKVTYPINAV-NVLKAHGKSARESVLVKGYALNCTVASQAMPLRVQNAKIACLDFSL--MKAKMHLGISVVVEDPAKLEAIR--REEFDITKRRIDKILKAGANVVLTTGGIDDLCLKQFVESGAMAVRRCKKSDLKRIAKATGATLTVSLATLEGDEAFDASLLGHADEIVQER-ISDDELILIKGPKSRTASSIILRGANDVMLDEMERSVHDSLCVVRRVLESKKLVAGGGAVETSLSLFLETYAQTLSSREQLAVAEFASALLIIPKVLASNAARDSTDLVTKLRAYHSKAQLIPQLQHLKWA--GLDLEEGTIRDNKEAGILEPALSKVKSLKFATEAAITILRIDDLIKLDKQE 540          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-7 (T-complex protein 1 subunit eta [Source:UniProtKB/TrEMBL;Acc:Q9TZS5])

HSP 1 Score: 259.225 bits (661), Expect = 5.450e-79
Identity = 167/535 (31.21%), Postives = 271/535 (50.65%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIK---RFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            PI++L + T+  QGK   + NI A + VAD IRT LGPR + K+++D  G T ++NDG  IL+ + +  PAA +M++IAR+QD EVGDGTTSV++LA E+L Q  P +E  +HP  +I A  +A E  L   KN   +E   + E E+ +++  C  T   SK       +S E +    ++ D    +D         I+K+ GG + +  ++ GV F K   ++      ++  N ++ LL+  LE K  +    +      D    +  E   +    + I     +VV+++  + D A  +    ++    RI + D  RL  ACG +++    +I +  +G   G F  + +G E + +   C   +ACT++LRG ++  + E ER+L DA+ + R     + +V GGGA+EM +S  ++E+ K      Q  ++A   A E+IPR L QN G D L  + +LR +H+   +K+   GID H   + D     + +P  VK      A E A L+L ID  V   +  S 
Sbjct:    5 PIILLKDGTENKQGKGQIISNINACQVVADSIRTTLGPRGLDKLIVDSKGATTISNDGATILKLLDIVFPAASTMVDIARSQDAEVGDGTTSVVVLAAEILKQMKPFIEDGVHPQLLIRAIGKACEKTL---KNLADLEIKINGETELREMLVKCAATTLSSKL------VSQERLFFANMIVDAVNTLDAHLPLNMIGIKKVNGGNLHESRLIKGVAFQKAFSYAGFEMQPKKYSNVKVALLNIELELKAEKENAEMRLTNVSDFQAVVDAEWNILYDKLQKIHDSGANVVLSKLPIGDVATQWFADRDMFCAGRIPQDDLDRLMSACGGSVLTTVSQIDDSVLGK-CGKFYEQQVGSERYNFFEDCSKAQACTLLLRGGAEQFIAETERSLHDAIMIVRRAKKNDSIVAGGGAIEMELSRLIREHSKGIEGKDQAFWMAYGQAFEIIPRQLCQNAGLDALDVLNKLRHRHA-QGEKWA--GIDIHREAVGDNLVACVWEPSIVKRNAITAATEAACLVLSIDQTVKNVRTPSG 526          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-7 (T-complex protein 1 subunit eta [Source:UniProtKB/TrEMBL;Acc:Q9TZS5])

HSP 1 Score: 259.225 bits (661), Expect = 5.450e-79
Identity = 167/535 (31.21%), Postives = 271/535 (50.65%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIK---RFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            PI++L + T+  QGK   + NI A + VAD IRT LGPR + K+++D  G T ++NDG  IL+ + +  PAA +M++IAR+QD EVGDGTTSV++LA E+L Q  P +E  +HP  +I A  +A E  L   KN   +E   + E E+ +++  C  T   SK       +S E +    ++ D    +D         I+K+ GG + +  ++ GV F K   ++      ++  N ++ LL+  LE K  +    +      D    +  E   +    + I     +VV+++  + D A  +    ++    RI + D  RL  ACG +++    +I +  +G   G F  + +G E + +   C   +ACT++LRG ++  + E ER+L DA+ + R     + +V GGGA+EM +S  ++E+ K      Q  ++A   A E+IPR L QN G D L  + +LR +H+   +K+   GID H   + D     + +P  VK      A E A L+L ID  V   +  S 
Sbjct:    5 PIILLKDGTENKQGKGQIISNINACQVVADSIRTTLGPRGLDKLIVDSKGATTISNDGATILKLLDIVFPAASTMVDIARSQDAEVGDGTTSVVVLAAEILKQMKPFIEDGVHPQLLIRAIGKACEKTL---KNLADLEIKINGETELREMLVKCAATTLSSKL------VSQERLFFANMIVDAVNTLDAHLPLNMIGIKKVNGGNLHESRLIKGVAFQKAFSYAGFEMQPKKYSNVKVALLNIELELKAEKENAEMRLTNVSDFQAVVDAEWNILYDKLQKIHDSGANVVLSKLPIGDVATQWFADRDMFCAGRIPQDDLDRLMSACGGSVLTTVSQIDDSVLGK-CGKFYEQQVGSERYNFFEDCSKAQACTLLLRGGAEQFIAETERSLHDAIMIVRRAKKNDSIVAGGGAIEMELSRLIREHSKGIEGKDQAFWMAYGQAFEIIPRQLCQNAGLDALDVLNKLRHRHA-QGEKWA--GIDIHREAVGDNLVACVWEPSIVKRNAITAATEAACLVLSIDQTVKNVRTPSG 526          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 244.588 bits (623), Expect = 1.701e-73
Identity = 165/495 (33.33%), Postives = 275/495 (55.56%), Query Frame = 1
Query:  157 RTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKS-----VSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNP-KACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            RT LGPR M KM+    G   +TNDG  IL +++V HP AK ++E+++ QD E GDGTT+V+++AG +L  A   L   IHPT I  +++ A  +  E + ++ S   D SN+A + K+  + L +K +S+ S +   +++ AV+++ I  +    +++K    I+K+ G  +E+ E+++G + ++  +      RIE  +I L+   +   K + +  +       M RALK E +Y+ +IC+ I     +V++ +KS     V++ A HFL K  I  I+ I + D    +R  G   V   +    + +G    + E+ T GD     VT  +NP  A +I+LRG++K +L E +R++ DA+ V R ++ ++ L+PGGGA EM I+  L+   +T+    Q  + A A ALE+IP TL +N G   + T+TELR+ H+  N    +YG++   G + DM E +++ PL V     K A E    +L+IDDIV
Sbjct:   48 RTSLGPRGMDKMIQSGNGDVTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEA-EKILDEMSSPVDLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKI-INSENDSNVNLKMIKIIKKM-GDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVIITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNS---SYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIV 536          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0302371)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 360/531 (67.80%), Postives = 431/531 (81.17%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFL-KENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKH-SLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            PILVLS NTKR  G+KVQL NI+AGKA+ADVIRTCLGP+AMLKMLMDPMGG VMTNDGNAILREITV+HPAAKSMIEIARTQDEEVGDGTTSVI+LAGEML  A P L+ QIHPT II AYREALED++ ++++  SI+ D  ++A+M  +VK+C+GTKFI KWSD+A KI+L+AV  VT+ ++GR E+DIKR+A++EKIPGGAIE+  VL GVM NKD  H +MRR IENPRI+LLDC+LEYKKGESQT +E + E D  R L+IEEE++++IC DII  KPD+V TEK VSD AQH+L+KA IT IRR+RK D  R+ARACGATIVNRTEE+ E+D+GTGAGLFEV+ IGDEYFT+VT+CK PKACTI+LRGASKDILNE ERNLQDA++VARN++LE RLV GGGAVEMA S  L ++ VK        PY AVA ALE+IPRTL QNCG + +R +T LR+KH S        +GIDG +G I DM    I +PL VK Q +KTA+ETAILLLRIDDIVSG+KK+  
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQVKG-------PYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKRGG 530          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0302370)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 360/531 (67.80%), Postives = 431/531 (81.17%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFL-KENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKH-SLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            PILVLS NTKR  G+KVQL NI+AGKA+ADVIRTCLGP+AMLKMLMDPMGG VMTNDGNAILREITV+HPAAKSMIEIARTQDEEVGDGTTSVI+LAGEML  A P L+ QIHPT II AYREALED++ ++++  SI+ D  ++A+M  +VK+C+GTKFI KWSD+A KI+L+AV  VT+ ++GR E+DIKR+A++EKIPGGAIE+  VL GVM NKD  H +MRR IENPRI+LLDC+LEYKKGESQT +E + E D  R L+IEEE++++IC DII  KPD+V TEK VSD AQH+L+KA IT IRR+RK D  R+ARACGATIVNRTEE+ E+D+GTGAGLFEV+ IGDEYFT+VT+CK PKACTI+LRGASKDILNE ERNLQDA++VARN++LE RLV GGGAVEMA S  L ++ VK        PY AVA ALE+IPRTL QNCG + +R +T LR+KH S        +GIDG +G I DM    I +PL VK Q +KTA+ETAILLLRIDDIVSG+KK+  
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQVKG-------PYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKRGG 530          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0083337)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 360/531 (67.80%), Postives = 431/531 (81.17%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFL-KENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKH-SLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            PILVLS NTKR  G+KVQL NI+AGKA+ADVIRTCLGP+AMLKMLMDPMGG VMTNDGNAILREITV+HPAAKSMIEIARTQDEEVGDGTTSVI+LAGEML  A P L+ QIHPT II AYREALED++ ++++  SI+ D  ++A+M  +VK+C+GTKFI KWSD+A KI+L+AV  VT+ ++GR E+DIKR+A++EKIPGGAIE+  VL GVM NKD  H +MRR IENPRI+LLDC+LEYKKGESQT +E + E D  R L+IEEE++++IC DII  KPD+V TEK VSD AQH+L+KA IT IRR+RK D  R+ARACGATIVNRTEE+ E+D+GTGAGLFEV+ IGDEYFT+VT+CK PKACTI+LRGASKDILNE ERNLQDA++VARN++LE RLV GGGAVEMA S  L ++ VK        PY AVA ALE+IPRTL QNCG + +R +T LR+KH S        +GIDG +G I DM    I +PL VK Q +KTA+ETAILLLRIDDIVSG+KK+  
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQVKG-------PYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKRGG 530          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0083338)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 360/531 (67.80%), Postives = 431/531 (81.17%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFL-KENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKH-SLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            PILVLS NTKR  G+KVQL NI+AGKA+ADVIRTCLGP+AMLKMLMDPMGG VMTNDGNAILREITV+HPAAKSMIEIARTQDEEVGDGTTSVI+LAGEML  A P L+ QIHPT II AYREALED++ ++++  SI+ D  ++A+M  +VK+C+GTKFI KWSD+A KI+L+AV  VT+ ++GR E+DIKR+A++EKIPGGAIE+  VL GVM NKD  H +MRR IENPRI+LLDC+LEYKKGESQT +E + E D  R L+IEEE++++IC DII  KPD+V TEK VSD AQH+L+KA IT IRR+RK D  R+ARACGATIVNRTEE+ E+D+GTGAGLFEV+ IGDEYFT+VT+CK PKACTI+LRGASKDILNE ERNLQDA++VARN++LE RLV GGGAVEMA S  L ++ VK        PY AVA ALE+IPRTL QNCG + +R +T LR+KH S        +GIDG +G I DM    I +PL VK Q +KTA+ETAILLLRIDDIVSG+KK+  
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQVKG-------PYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKRGG 530          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT7 (gene:FBgn0037632 transcript:FBtr0081918)

HSP 1 Score: 253.832 bits (647), Expect = 9.506e-77
Identity = 166/533 (31.14%), Postives = 283/533 (53.10%), Query Frame = 1
Query:   64 ILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGT----KFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYK--KGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTK 1635
            I++L   T  +QGK   + NI A +++ D +RT LGPR M K+++D  G   ++NDG  I++ + + HPAAK++++IA++QD EVGDGTTSV++LAGE L Q  P +E  +HP  II A R+AL+  +E + N+ +++    ++ +   +++ C  T    K I +  D   +I ++AV  +        E+       I+K+ GG++E+ +++ GV F K   ++      +  +N +I LL+  LE K  +  ++  ++ VKE    + +  E + +      I     +VV+++  + D A  +    +I    R+ + D  R  +ACG  ++    +IK   +G     FE R +G E F     C N K  T++LRG ++  L E ER+L DA+ + R  +  + +V GGGA+EM +S  L++  +T     Q+   A+A  LE+IPR L  N G D    + +LR KH+   Q    YG+D +   I+D  E  + +P  +K      A E A ++L +D+ +   K
Sbjct:    5 IVLLKEGTDSSQGKPQLVSNINACQSIVDAVRTTLGPRGMDKLIVDAHGKATISNDGATIMKLLEIIHPAAKTLVDIAKSQDAEVGDGTTSVVLLAGEFLKQVKPFVEEGVHPRVIIKAIRKALQLCMEKI-NEMAVQIVEQSKDQQRALLEKCAATAMSSKLIHQQKDFFSRIVVDAVLSL-------DELLPLNMIGIKKVTGGSLEESQLVSGVAFKKTFSYAGFEMAPKSYDNCKIALLNIELELKAERDNAEIRVDNVKEYQ--KVVDAEWQILYNKLAKIHESGANVVLSKLPIGDVATQYFADRDIFCAGRVPEEDLKRTMKACGGAVMTTANDIKPNVLGL-CEHFEERQVGGERFNLFQGCPNAKTSTLILRGGAEQFLEETERSLHDAIMIVRRTIKHDSVVAGGGAIEMELSKLLRDYSRTIAGKEQLLIAAIAKGLEIIPRQLCDNAGFDATNILNKLRQKHAQGGQW---YGVDINKEDISDNYEQCVWEPSIIKINALTAAAEAACMILSVDETIKSPK 523          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: cct3 (chaperonin containing TCP1, subunit 3 (gamma) [Source:ZFIN;Acc:ZDB-GENE-020419-5])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 345/529 (65.22%), Postives = 423/529 (79.96%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQ 1641
            G P+LVLS N KR  G+KVQ+ NI A K +AD+IRTCLGPRAM+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +I AYR+AL+DML  +K D S   D SN   M+KI+ S + TK +S+WS +AC I+L+AVR V + ++GRKEIDIK++A++EK+PGG IED  VL GVM NKD  H RMRR I+NPRI+LLDC+LEYKKGESQT IE  +E D  R L++EEEY+++ICEDIIR KPD++ TEK +SD AQH+L+KANIT IRRIRK D  R+ARACGA I +RT+E+ E+D+GTGAGLFEV+ IGDEYFT+VT+CK+PKACTI+LRGASK+IL E+ERNLQDAM V RNVLL+  L+PGGGAVEM +S  L E  +    V Q PY AVA ALEV+PRTLIQNCG   +R +T LR+KH+ +     ++G++G  G +ADM++L I +PL VK Q +KTA+ETAILLLRIDDIVSG KK+
Sbjct:    3 GRPVLVLSQNIKRESGRKVQIGNISAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVIGAYRQALDDMLNILK-DISTPVDVSNRDMMLKIINSAINTKALSRWSTLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLRGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEIAREEDFARILQMEEEYVQQICEDIIRLKPDLIFTEKGISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELTEDDVGTGAGLFEVKKIGDEYFTFVTECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMEVSHRLTERSRAMTGVEQWPYRAVAQALEVVPRTLIQNCGASAIRVLTSLRAKHTQEGNS--SWGVNGETGTLADMEQLGIWEPLAVKAQTYKTAVETAILLLRIDDIVSGHKKK 528          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 261.151 bits (666), Expect = 2.109e-79
Identity = 171/528 (32.39%), Postives = 282/528 (53.41%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKN-DCSIEADTSNEAEMI--KIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            P+++L   T  +QG    + NI A + VA+ +RT LGPR M K+++D  G   ++NDG  IL+ + V HPAAK++++IAR+QD EVGDGTTSV +LA E L Q  P +E  +HP  II A+R A +  ++ +K    +I+ D   E   +  K   + L +K I+   D   K+ ++AV  +        ++   +   ++K+ GGA+E+ +++ GV F K   ++      +R  NP+I LL+  LE  K E   A   V  ++ Y+A+   E   +    E I +    VV+++  + D A  +    ++    R+ + D  R   ACG +I      + ++ +G    LFE   +G E + +   C   K CTI+LRG ++  + E +R+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   A A ALE+IPR L  N G D    + +LR+KH+   Q  + YG+D +N  IAD  +  + +P  V+      A E A L+L +D+ +
Sbjct:    5 PVILLKEGTDTSQGVPQLVSNINACQVVAEAVRTTLGPRGMDKLVVDNRGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIAVTIKKDDKQEQRRLLEKCAATALNSKLIAGQKDFFSKMVVDAVMML-------DDLLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYMNPKIALLNIELEL-KAEKDNAEVRVNSVEDYQAIVDAEWNILYDKLEKIHKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVVEEDLKRTMMACGGSIQTSVGSLTDDVLGQ-CELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETDRSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHA---QGGMWYGVDVNNEDIADNFQACVWEPSIVRINALTAASEAACLILSVDETI 520          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 253.832 bits (647), Expect = 1.211e-76
Identity = 170/528 (32.20%), Postives = 299/528 (56.63%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQ--GKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYM-KNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIG--DEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDI 1620
            G P +++ +  K+++  G +    +I A KAVA+ +RT LGP  + KM++D  G   +TNDG  IL  + V+H  AK M+E++++QD+E+GDGTT V++LAG +L QA   L+  IHP +I   Y +A +  +E + K   S   D +N   +++   + LG+K I++      +I++ A+  +T+    RK++D +   ++E   GG +ED +++ GV+ +K+  H +M + +++ +I +L C  E  K +++  ++ V  ++ Y+AL K E++  +++   +     ++ I +    D A H L++  +  IR +  P+   +A A G  IV R  E+  E +GT AGL +    G   +    + +CKN +A TI +RG +K I+ E +R L DA+ V RN++ + R+V GGGA E+A +  + E      ++ Q    A A ALEVIP  L +N G + ++T+TE+R++   +N   +  GID  +    DMK+  +++ L  K Q    A +   ++L+IDDI
Sbjct:   13 GRPFIIIKDQDKKSRLTGLEALKSHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAI--LTVADMERKDVDFE-LIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLD-VTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQWGFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGT-AGLVKEICFGTTKDRMLVIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENNSAL--GIDCLHLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 248.44 bits (633), Expect = 8.552e-75
Identity = 170/518 (32.82%), Postives = 285/518 (55.02%), Query Frame = 1
Query:   91 RTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSV-----SDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNP-KACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVS 1626
            R +  +++  NI AGKAVAD IRT LGP+ M KM+ D  G   +TNDG  IL+++ V HPAAK M+E+++ QD E GDGTTSV+++AG +L      L+  IHPT I  ++++A++  +E + +  S     S+   ++    + L +K +S+ S +   +S++AV +V I       +D++    ++K+ GG I+DCE++DG++  +  + S    R+E  +I L+   L   K +    I       M R L+ E  YI  + + + +    V++ +KS+     SD A HFL K  I VI+ I + +   + +  G   +   ++   E +G+   + EV   G      +T C +P K  +IV+RG++K ++ E ER++ DA+ V R ++ +  L+ GGGA E+ ++  L E  ++   +      A A ALEVIP TL +N G + + T+TELR++H+   Q     GI+   G I+++ E  ++ PL V       A ET   +L+IDD+V+
Sbjct:   21 RDKPAQIRYSNINAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVLTS-ISTPLLLSDRESLLNSASTSLCSKVVSQNSSLLAPMSVDAVMKV-IDPATATSVDLRDINVVKKL-GGTIDDCELVDGMVLTQR-VASTGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQVKKAGCTVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREEIEFICKTIGTKPIAHIDQFTPEMLGSAELVEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEYARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHA---QGETTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDLVN 531          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 242.662 bits (618), Expect = 2.328e-72
Identity = 171/545 (31.38%), Postives = 290/545 (53.21%), Query Frame = 1
Query:   40 NMITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRF----ARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGE--SQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEED------IGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKH-----SLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            +MI S  P+ VL    +RT G+ V+  N+ A  ++A+++++ LGP  + KML+D +G   +TNDG  IL+ + VEHPAAK + E+A  QD+EVGDGTTSV+I+A E+L  A   ++ +IHPT IIS YR A ++ + Y+  + +I  D      ++   K+ + +K I   ++    + ++A   V  V DG+    + R+      + K  G + ++  +++G   N       M +R+ N +I  LD +L+  K +   Q  I   ++LD  R  + E +  ++  + I+    +VV+T   + D    + +      +RR+ K D  R+A+A GAT+ +    ++ E+      +G    + + R   DE    +   K   + +I+LRGA+  + +E+ER+L DA+ V + VL  + +VPGGGAVE A+S +L+    +  +  Q+     A +L VIP+TL  N   D    + +LR+ H     + D +     G+D  NG   D K+  + +P  VK +  K A E AI +LRIDD++
Sbjct:    2 SMIDS--PLSVLG---QRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFV-DGK---GVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIR--QRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDE-LILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:394965])

HSP 1 Score: 345.895 bits (886), Expect = 3.861e-115
Identity = 179/280 (63.93%), Postives = 224/280 (80.00%), Query Frame = 1
Query:  805 QTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQS 1644
            QT IE  +E D  R L++EEEYI+++CEDIIR KPDVVITEK +SD AQH+L+KANIT IRR+RK D  R+ARACGA I +RT+E++EED+GTGAGLFE++ IGDEYFT++T+CK+PKACTIVLRGASK+IL E+ERNLQDAM V RNV+++  LVPGGGA EM+++  L E  KT   V Q PY AVA ALEVIPRTL+QNCG   +R +T LR+KH+ +  +   +G+DG  GV+ DMKEL I +PL VK Q +KTA+ETAILLLRIDDIVSG K++ 
Sbjct:   13 QTEIEITREEDFARILQMEEEYIQQVCEDIIRLKPDVVITEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIGSRTDELREEDVGTGAGLFEIKKIGDEYFTFITECKDPKACTIVLRGASKEILAEVERNLQDAMQVCRNVVIDPHLVPGGGAAEMSVAHILTEKSKTMTGVEQWPYRAVAQALEVIPRTLVQNCGASTIRVLTSLRAKHTQEGCQ--TWGVDGEAGVLVDMKELGIWEPLAVKLQTYKTAVETAILLLRIDDIVSGHKRKG 290          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:407957])

HSP 1 Score: 264.618 bits (675), Expect = 1.495e-80
Identity = 171/528 (32.39%), Postives = 287/528 (54.36%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKN-DCSIEADTSNEAEMI--KIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            P+++L   T  +QG    + NI A + +A+ +RT LGPR M K+++D  G   ++NDG  IL+ + V HPAAK++++IA++QD EVGDGTTSV +LA E + Q  P +E  +HP  II AYR A +  +  ++    +++ +   E  ++  K   + L +K I+   D   K+ ++A   V+++ D    + +K    I+K+ GGA+ED  ++ GV F K   ++      ++ E+P+I LL+  LE  K E   A   V  ++ Y+A+   E   +    E I +    VV+++  + D A  +    ++    R+ + D  R   ACG +I      + ++ +G  A LFE   +G E + + T C   K CTI+LRG ++  + E ER+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   + A ALE+IPR L  N G D    + +LR+KH+   Q  + YG+D +N  IAD  +  + +P  V+      A E A L+L +D+ +
Sbjct:    5 PVILLKEGTDTSQGVPQLVSNINACQVIAEAVRTTLGPRGMDKLIVDDRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFMKQVKPYVEEGLHPQIIIRAYRTATQLAVGKIREIAVTVKKEDKEEQRLLLEKCAATALSSKLIALQKDFFAKMVVDA---VSLLDD---LLQLKMIG-IKKVQGGALEDSHLVAGVAFKKTFSYAGFEMQPKKYESPKISLLNVELEL-KAEKDNAEVRVSNIEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVPEEDLKRTMMACGGSIQTSVNALTDDVLGHCA-LFEEAQVGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATNILNKLRAKHA---QGGMWYGVDVNNEDIADNFDACVWEPAIVRINALTAASEAACLVLSVDETI 520          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:407957])

HSP 1 Score: 262.307 bits (669), Expect = 8.070e-80
Identity = 168/530 (31.70%), Postives = 285/530 (53.77%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKN-DCSIEADTSNEAEMI--KIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYK--KGESQTAIEFVKELD-MYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            P+++L   T  +QG    + NI A + +A+ +RT LGPR M K+++D  G   ++NDG  IL+ + V HPAAK++++IA++QD EVGDGTTSV +LA E + Q  P +E  +HP  II AYR A +  +  ++    +++ +   E  ++  K   + L +K I+   D   K+ ++A   V+++ D    + +K    I+K+ GGA+ED  ++ GV F K   ++      ++ E+P+I LL+  LE K  K  +++      E + +Y  L+            I +    VV+++  + D A  +    ++    R+ + D  R   ACG +I      + ++ +G  A LFE   +G E + + T C   K CTI+LRG ++  + E ER+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   + A ALE+IPR L  N G D    + +LR+KH+   Q  + YG+D +N  IAD  +  + +P  V+      A E A L+L +D+ +
Sbjct:    5 PVILLKEGTDTSQGVPQLVSNINACQVIAEAVRTTLGPRGMDKLIVDDRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFMKQVKPYVEEGLHPQIIIRAYRTATQLAVGKIREIAVTVKKEDKEEQRLLLEKCAATALSSKLIALQKDFFAKMVVDA---VSLLDD---LLQLKMIG-IKKVQGGALEDSHLVAGVAFKKTFSYAGFEMQPKKYESPKISLLNVELELKAEKDNAESVFFVYAEWNILYDKLE-----------KIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVPEEDLKRTMMACGGSIQTSVNALTDDVLGHCA-LFEEAQVGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATNILNKLRAKHA---QGGMWYGVDVNNEDIADNFDACVWEPAIVRINALTAASEAACLVLSVDETI 512          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:407957])

HSP 1 Score: 259.225 bits (661), Expect = 1.049e-78
Identity = 170/525 (32.38%), Postives = 284/525 (54.10%), Query Frame = 1
Query:   70 VLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKN-DCSIEADTSNEAEMI--KIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            + S  T  +QG    + NI A + +A+ +RT LGPR M K+++D  G   ++NDG  IL+ + V HPAAK++++IA++QD EVGDGTTSV +LA E + Q  P +E  +HP  II AYR A +  +  ++    +++ +   E  ++  K   + L +K I+   D   K+ ++A   V+++ D    + +K    I+K+ GGA+ED  ++ GV F K   ++      ++ E+P+I LL+  LE  K E   A   V  ++ Y+A+   E   +    E I +    VV+++  + D A  +    ++    R+ + D  R   ACG +I      + ++ +G  A LFE   +G E + + T C   K CTI+LRG ++  + E ER+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   + A ALE+IPR L  N G D    + +LR+KH+   Q  + YG+D +N  IAD  +  + +P  V+      A E A L+L +D+ +
Sbjct:    1 MFSLGTDTSQGVPQLVSNINACQVIAEAVRTTLGPRGMDKLIVDDRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFMKQVKPYVEEGLHPQIIIRAYRTATQLAVGKIREIAVTVKKEDKEEQRLLLEKCAATALSSKLIALQKDFFAKMVVDA---VSLLDD---LLQLKMIG-IKKVQGGALEDSHLVAGVAFKKTFSYAGFEMQPKKYESPKISLLNVELEL-KAEKDNAEVRVSNIEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVPEEDLKRTMMACGGSIQTSVNALTDDVLGHCA-LFEEAQVGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATNILNKLRAKHA---QGGMWYGVDVNNEDIADNFDACVWEPAIVRINALTAASEAACLVLSVDETI 513          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 255.373 bits (651), Expect = 2.786e-77
Identity = 171/518 (33.01%), Postives = 284/518 (54.83%), Query Frame = 1
Query:   91 RTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSV-----SDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNP-KACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVS 1626
            R +  +++  NI AGKAVAD +RT LGP+ M KM+ D  G   +TNDG  IL+ + V HPAAK ++E+++ QD E GDGTTSV+++AG +L      L+  IHPT I  +++ A +  +E + N  S   + S+   ++    + L +K +S++S +   +S++AV +V   Q     +D++    ++K+ GG I+DCE++DG++  +   ++ +  R+E  +I L+   L   K +    I       M R L+ E  YI  + + I +   +V++ +KS+     SD A HFL K  I V++ I + D   + +  G   V   ++   + + +     EV   G      +T C NP K  TIV+RG++K ++ E ER++ DA+ V R ++ +  L+ GGGA E+ +S  L E  +T   +      A A ALE+IP TL +N G + + T+TELR++H+   Q     GI+   G I+++ E  ++ PL V       A ET   +L+IDD+V+
Sbjct:   19 RDKPAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTN-MSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTA-NSVDLRDIKIVKKL-GGTIDDCEMVDGLVLTQKAANTGV-TRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHA---QGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVN 529          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 343/536 (63.99%), Postives = 422/536 (78.73%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            P+LVLS NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR AL+DM+  +K   S   D +N   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI ++CEDII+ KPDVVITEK +SD AQH+L++AN+T IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ ++ +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ  Q
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKK-ISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQNRQ 536          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 325/509 (63.85%), Postives = 402/509 (78.98%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIE 1587
            P+LVLS NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR AL+DM+  +K   S   D +N   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI ++CEDII+ KPDVVITEK +SD AQH+L++AN+T IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ ++ +   +G++G  G + DMKEL I +PL VK Q +KTA+E
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKK-ISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVE 511          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 313/536 (58.40%), Postives = 386/536 (72.01%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            P+LVLS NTKR  G+KVQ  NI A K                                      I V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR AL+DM+  +K   S   D +N   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI ++CEDII+ KPDVVITEK +SD AQH+L++AN+T IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ ++ +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ  Q
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAK--------------------------------------IQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKK-ISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQNRQ 498          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 335.495 bits (859), Expect = 3.986e-111
Identity = 188/356 (52.81%), Postives = 238/356 (66.85%), Query Frame = 1
Query:  325 GTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIP 1392
            GTTSVIILAGEML  A   LE Q+HPT +ISAYR AL+DM+  +K   S   D +N   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EK                                                  T IE  +E D  R L++EEEYI ++CEDII+ KPDVVITEK +SD AQH+L++AN+T IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIP
Sbjct:    2 GTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKK-ISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEK--------------------------------------------------TDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIP 306          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct7 (chaperonin containing Tcp1, subunit 7 (eta) [Source:MGI Symbol;Acc:MGI:107184])

HSP 1 Score: 261.536 bits (667), Expect = 1.525e-79
Identity = 167/529 (31.57%), Postives = 285/529 (53.88%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSC----LGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            P+++L   T  +QG    + NI A + +A+ +RT LGPR M K+++D  G   ++NDG  IL+ + V HPAAK++++IA++QD EVGDGTTSV +LA E L Q  P +E  +HP  II A+R A +  +  +K + ++     ++ E  K+++ C    L +K IS+      K+ ++AV  +        E+   +   I+K+ GGA+E+ +++ GV F K   ++      ++ +NP+I LL+  LE K  +    I  V  ++ Y+A+   E   +    E I +    V++++  + D A  +    ++    R+ + D  R   ACG +I      +  + +G    +FE   IG E + + T C   K CTI+LRG ++  + E ER+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   A A ALE+IPR L  N G D    + +LR++H+   Q  + YG+D +N  IAD  +  + +P  V+      A E A L++ +D+ +
Sbjct:    5 PVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIK-EIAVTVKKQDKVEQRKMLEKCAMTALSSKLISQQKVFFAKMVVDAVMML-------DELLQLKMIGIKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELELKAEKDNAEIR-VHTVEDYQAIVDAEWNILYDKLEKIHQSGAKVILSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALVPDVLGH-CQVFEETQIGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHA---QGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDETI 520          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|P48605|TCPG_DROME (T-complex protein 1 subunit gamma OS=Drosophila melanogaster OX=7227 GN=CCT3 PE=2 SV=2)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 360/531 (67.80%), Postives = 431/531 (81.17%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFL-KENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKH-SLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            PILVLS NTKR  G+KVQL NI+AGKA+ADVIRTCLGP+AMLKMLMDPMGG VMTNDGNAILREITV+HPAAKSMIEIARTQDEEVGDGTTSVI+LAGEML  A P L+ QIHPT II AYREALED++ ++++  SI+ D  ++A+M  +VK+C+GTKFI KWSD+A KI+L+AV  VT+ ++GR E+DIKR+A++EKIPGGAIE+  VL GVM NKD  H +MRR IENPRI+LLDC+LEYKKGESQT +E + E D  R L+IEEE++++IC DII  KPD+V TEK VSD AQH+L+KA IT IRR+RK D  R+ARACGATIVNRTEE+ E+D+GTGAGLFEV+ IGDEYFT+VT+CK PKACTI+LRGASKDILNE ERNLQDA++VARN++LE RLV GGGAVEMA S  L ++ VK        PY AVA ALE+IPRTL QNCG + +R +T LR+KH S        +GIDG +G I DM    I +PL VK Q +KTA+ETAILLLRIDDIVSG+KK+  
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQVKG-------PYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKRGG 530          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|P50143|TCPG_XENLA (T-complex protein 1 subunit gamma OS=Xenopus laevis OX=8355 GN=cct3 PE=2 SV=2)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 349/529 (65.97%), Postives = 426/529 (80.53%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQ 1641
            G P+LVLS N KR  G+KVQ  NI A K +AD+IRTCLGPRAM+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT IISAYR+AL+DM+  +K + S   DT++   M+KI+ S + TK I  W+DMAC I+L+AV+ V + ++GRKEIDIK++A++EKIPGG IED  VL GVM NKD  H +MRR I+NPRI+LLDC+LEYKKGESQT IE  +E D  R L++EEEYI+++CEDIIR KPDVVITEK +SD AQH+L+KANIT +RR+RK D  R+ARACGA I +RT+E++EED+GTGAGLFE++ IGDEYFT++T CK+PKACTIVLRGASK+IL E+ERNLQDAM V RNV+++  LVPGGGA EM+++  L E  KT   V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +  +   +G+DG  GV+ADMKEL I +PL VK Q +KTA+ETAILLLRIDDIVSG KK+
Sbjct:    3 GRPVLVLSQNMKRESGRKVQSGNINAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVIISAYRKALDDMVNTLK-EISTPVDTNDRELMLKIINSAINTKAIKLWADMACGIALDAVKTVELEENGRKEIDIKKYAKVEKIPGGIIEDSCVLRGVMVNKDVTHPKMRRLIKNPRIILLDCSLEYKKGESQTEIEITREEDFARILQMEEEYIQQVCEDIIRLKPDVVITEKGISDLAQHYLVKANITAVRRVRKTDNNRIARACGARIASRTDELREEDVGTGAGLFEIKKIGDEYFTFITDCKDPKACTIVLRGASKEILAEVERNLQDAMQVCRNVVIDPYLVPGGGASEMSVAHILTEKSKTMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRILTSLRAKHTQEGCQ--TWGVDGEAGVLADMKELGIWEPLAVKLQTYKTAVETAILLLRIDDIVSGHKKK 528          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|Q3T0K2|TCPG_BOVIN (T-complex protein 1 subunit gamma OS=Bos taurus OX=9913 GN=CCT3 PE=1 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 349/536 (65.11%), Postives = 428/536 (79.85%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            P+LVLS NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  DTSN   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI+++CEDII+ KPDVVITEK +SD AQH+L++ANIT IRR+RK D  R+ARACGA IV+R EE++EED+GTGAGL E++ IGDEYFT++T+CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +N +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ+ Q
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDTSNRDTMLNIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREEDVGTGAGLLEIKKIGDEYFTFITECKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQSRQ 536          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|P49368|TCPG_HUMAN (T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 346/536 (64.55%), Postives = 426/536 (79.48%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            P+LVLS NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  D S+   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI+++CEDII+ KPDVVITEK +SD AQH+L++ANIT IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +N +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ+ Q
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQSRQ 536          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|Q5NVF9|TCPG_PONAB (T-complex protein 1 subunit gamma OS=Pongo abelii OX=9601 GN=CCT3 PE=2 SV=1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 344/536 (64.18%), Postives = 426/536 (79.48%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQ 1668
            P+LVLS NTKR  G+KVQ  NI A K +AD+IRTCLGP++M+KML+DPMGG VMTNDGNAILREI V+HPAAKSM+EI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DM+  +K   SI  D ++   M+ I+ S + TK IS+WS +AC I+L+AV+ V   ++GRKEIDIK++AR+EKIPGG IED  VL GVM NKD  H RMRR I+NPRI+LLD +LEYKKGESQT IE  +E D  R L++EEEYI+++CEDII+ KPDVVITEK +SD AQH+L++ANIT IRR+RK D  R+ARACGA IV+R EE++E+D+GTGAGL E++ IGDEYFT++T CK+PKACTI+LRGASK+IL+E+ERNLQDAM V RNVLL+ +LVPGGGA EMA++  L E  K    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +N +   +G++G  G + DMKEL I +PL VK Q +KTA+ETA+LLLRIDDIVSG KK+    DQ+ Q
Sbjct:    6 PVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMVEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKK-ISIPVDINDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCE--TWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG--DDQSRQ 536          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A074ZMD9 (T-complex protein 1 subunit gamma (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13906 PE=3 SV=1)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 378/538 (70.26%), Postives = 451/538 (83.83%), Query Frame = 1
Query:   37 RNMITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLN-VHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            R+ +  G P+LVL+ N +  +GK VQL NIEAGK VADVIRTCLGPRAMLKMLMDPMGG VMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIIL GEML  A P LE QIHPTKII+A+R+ L+DML  + +  S+  D++N+ EM  I+KSC+GTKFI++WSD+AC+I+L+AV+ V+I  DGRKEIDIKR+A++EKIPGG+IED  V+DGVMFNKD +H RM RRIENPRILLLDCNLEYKKGESQT+IE   E D  RAL+IEE  I+++C+ II+ KPDVVITEK VSD AQHFL KA I+VIRR+RK D  R+ARA GATIV+RTEEIKEEDIGT AGLFEV+TIGDEYFT++TKCKNPKACTI+LRGASKD+LNE+ERNLQDAMNVARNV+LE+RLVPGGGA+EMA+   L E  K  ++ V Q+ Y+A+A ALEVIPRTL +NCG +VLR ITELR++H++D  ++   G+DG  G +ADMK+L + DPL VK Q FKTA+ETAILLLRIDD+VSG K+Q  
Sbjct:   51 RSSMVGGAPVLVLNRNARGEKGKSVQLANIEAGKTVADVIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCLEKQIHPTKIIAAFRKGLDDMLSALHDRLSVPVDSNNKEEMYTIIKSCVGTKFINQWSDLACQIALDAVKTVSIEVDGRKEIDIKRYAKVEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRRIENPRILLLDCNLEYKKGESQTSIEITAEKDFTRALEIEEANIKEMCDSIIKHKPDVVITEKGVSDLAQHFLAKAGISVIRRLRKTDNFRVARATGATIVSRTEEIKEEDIGTQAGLFEVKTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLEQRLVPGGGAIEMALGQVLAEKAKLAVSGVQQMAYMAMAQALEVIPRTLAKNCGANVLRLITELRARHAIDPARYWTLGVDGTTGQLADMKQLNVWDPLVVKAQTFKTAVETAILLLRIDDVVSGVKRQGG 588          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A5J4NT18 (T-complex protein 1 subunit gamma OS=Paragonimus westermani OX=34504 GN=DEA37_0007138 PE=3 SV=1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 379/535 (70.84%), Postives = 453/535 (84.67%), Query Frame = 1
Query:   46 ITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLN-VHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            ++ G  ++VL+ N++  + K VQL NIEAGK VADV+RTCLGPRAMLKMLMDPMGG VMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIIL GEML  A P +E QIHPTKIISA+R+ L+DML  ++ + SI  DT+N+ EM K++KSC+GTKFI++W+D+AC+I+L+AV+ VTI  DGRKEIDIKR+A+IEKIPGG+IED  V+DGVMFNKD +H RM R+IENPRILLLDCNLEYKKGESQT+IE   E D  RAL+IEE YI+ IC++II+ KPDVVITEK VSD AQHFL KA I+V+RR+RK D  R+ARA GATIV+R EEIKE+DIGT AGLFEVRTIGDEYFT++TKCKNPKACTI+LRGASKD+LNE+ERNLQDAMNVARNV+L++RLVPGGGA+EMA+   L E  K+ ++ V Q+ YL++A ALEVIPRTL +NCG +VLR ITELR++H++D  K+   G+DG  G +ADMKEL + DPL VK Q FKTAIETAILLLRIDD+VSG KKQS 
Sbjct:    1 MSVGGQVIVLNRNSRGEKSKSVQLANIEAGKTVADVVRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCIERQIHPTKIISAFRKGLDDMLSALRENLSISVDTNNKEEMFKVIKSCVGTKFINQWADLACQIALDAVKTVTIESDGRKEIDIKRYAKIEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRKIENPRILLLDCNLEYKKGESQTSIEISNEKDFTRALEIEENYIKDICDNIIKYKPDVVITEKGVSDLAQHFLAKAGISVLRRLRKTDNFRIARATGATIVSRPEEIKEDDIGTQAGLFEVRTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLDQRLVPGGGAIEMALGQVLTEKAKSAVSGVQQMAYLSMAQALEVIPRTLAKNCGANVLRLITELRARHAIDPAKYWTLGVDGTTGKLADMKELNVWDPLVVKSQTFKTAIETAILLLRIDDVVSGVKKQSG 535          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A3R7CM86 (T-complex protein 1 subunit gamma OS=Clonorchis sinensis OX=79923 GN=CCT3 PE=3 SV=1)

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 377/538 (70.07%), Postives = 451/538 (83.83%), Query Frame = 1
Query:   37 RNMITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLN-VHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            R+ +  G P+LVL+ N +  +GK VQL NIEAGK VADVIRTCLGPRAMLKMLMDPMGG VMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIIL GEML  A P LE QIHPTKII+A+R+ L+DML  + +  S+  D++N+ EM  I+KSC+GTKFI++WSD+AC+I+L+AV+ V+I  DGRKEIDIKR+A++EKIPGG+IED  V+DGVMFNKD +H RM RR+ENPRILLLDCNLEYKKGESQT+IE   E D  RAL+IEE  I+++C+ II+ KPDVVITEK VSD AQHFL KA I+VIRR+RK D  R+ARA GATIV+RTEEIKEEDIGT AGLFEV+TIGDEYFT++TKCKNPKACTI+LRGASKD+LNE+ERNLQDAMNVARNV+LE+RLVPGGGA+EMA+   L E  K  ++ V Q+ Y+A+A ALEVIPRTL +NCG +VLR ITELR++H++D  ++   G+DG  G +ADMK+L + DPL VK Q FKTA+ETAILLLRIDD+VSG K+Q  
Sbjct:   12 RSGMVGGAPVLVLNRNARGEKGKCVQLANIEAGKTVADVIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCLEKQIHPTKIIAAFRKGLDDMLSALHDRLSVPVDSNNKEEMYAIIKSCVGTKFINQWSDLACQIALDAVKTVSIEVDGRKEIDIKRYAKVEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRRVENPRILLLDCNLEYKKGESQTSIEITAEKDFTRALEIEETNIKEMCDSIIKHKPDVVITEKGVSDLAQHFLAKAGISVIRRLRKTDNFRVARATGATIVSRTEEIKEEDIGTQAGLFEVKTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLEQRLVPGGGAIEMALGQVLAEKAKLAVSGVQQMAYMAMAQALEVIPRTLAKNCGANVLRLITELRARHAIDPARYWTLGVDGTTGQLADMKQLNVWDPLVVKAQTFKTAVETAILLLRIDDVVSGVKRQGG 549          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A4S2MGT3 (T-complex protein 1 subunit gamma OS=Opisthorchis felineus OX=147828 GN=CRM22_000146 PE=3 SV=1)

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 375/535 (70.09%), Postives = 449/535 (83.93%), Query Frame = 1
Query:   46 ITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLN-VHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            +  G P+LVL+ N +  +G+ VQL NIEAGK VADVIRTCLGPRAMLKMLMDPMGG VMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIIL GEML  A P LE QIHPTKII+A+R+ L+DML  + +  S+  D++N+ EM  I+KSC+GTKFI++WSD+AC+I+L+AV+ V+I  DGRKEIDIKR+A++EKIPGG+IED  V+DGVMFNKD +H RM RR+ENPRILLLDCNLEYKKGESQT+IE   E D  RAL+IEE  I+++C+ II+ KPDVVITEK VSD AQHFL KA I+VIRR+RK D  R+ARA GATIV+RTEEIKEEDIGT AGLFEV+TIGDEYFT++TKCKNPKACTI+LRGASKD+LNE+ERNLQDAMNVARNV+LE+RLVPGGGA+EMA+   L E  K  ++ V Q+ Y+A+A ALEVIPRTL +NCG +VLR ITELR++H++D  ++   G+DG  G +ADMK+L + DPL VK Q FKTA+ETAILLLRIDD+VSG K+Q  
Sbjct:    1 MVGGAPVLVLNRNARGEKGRSVQLANIEAGKTVADVIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCLEKQIHPTKIIAAFRKGLDDMLSALHDRLSVPVDSNNKEEMYAIIKSCVGTKFINQWSDLACQIALDAVKTVSIEVDGRKEIDIKRYAKVEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRRVENPRILLLDCNLEYKKGESQTSIEITAEKDFTRALEIEEANIKEMCDSIIKHKPDVVITEKGVSDLAQHFLAKAGISVIRRLRKTDNFRVARATGATIVSRTEEIKEEDIGTEAGLFEVKTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLEQRLVPGGGAIEMALGQVLAEKAKLAVSGVQQMAYMAMAQALEVIPRTLAKNCGANVLRLITELRARHAIDPTRYWTLGVDGTTGQLADMKQLNVWDPLVVKAQTFKTAVETAILLLRIDDVVSGVKRQGG 535          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A504YS00 (T-complex protein 1 subunit gamma OS=Fasciola gigantica OX=46835 GN=FGIG_02826 PE=3 SV=1)

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 377/535 (70.47%), Postives = 449/535 (83.93%), Query Frame = 1
Query:   52 SGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLN-VHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAIS 1653
            +G P+LVL+ N +  +GK VQL NIEAGK VADVIRTCLGPRAMLKMLMDPMGG VMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIIL GEML  A P LE QIHPTKIISA+R+ L+DML  ++ + S+  D SN  EM KI+KSC+GTKFI++W+++AC+I+L+AV+ V +  DG KEIDIKR+A+IEKIPGG+IED  V+DGVMFNKD +H RM RRIE+PRILLLDC+LEYKKGESQT+IE   + D  +AL+IEE YI+++CE+II+ +P+VVITEK VSD AQHFL KA I+VIRR+RK D  R+ARA GATIV+R EEIKE+DIG GAGLFEV+TIGDEYFT++TKCKNPKACTI+LRGASKD+LNE+ERNLQDAMNVARNV+LE+RLVPGGGA+EMA+   L E  K+ ++ V Q+ YLA+A ALEVIPRTL  NCG +VLR ITELR+KH++D  K+   G+DG  G + DM+EL+I DPL VK Q  KTA+ETAILLLRIDDIVSG KKQS  S
Sbjct:    3 AGAPVLVLNRNARGEKGKSVQLANIEAGKMVADVIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCLEKQIHPTKIISAFRKGLDDMLTALRENLSVPVDASNRDEMFKIIKSCVGTKFINQWAELACQIALDAVKTVAVEVDGHKEIDIKRYAKIEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRRIEDPRILLLDCSLEYKKGESQTSIEITTDKDFTKALEIEENYIKEVCENIIKHRPNVVITEKGVSDLAQHFLSKAGISVIRRLRKTDNFRIARATGATIVSRPEEIKEDDIGLGAGLFEVKTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLEQRLVPGGGAIEMALGRVLTEKAKSTVSGVQQMAYLAMAQALEVIPRTLANNCGANVLRLITELRAKHAVDPAKYWTLGVDGTTGKLIDMRELDIWDPLVVKAQTLKTAVETAILLLRIDDIVSGVKKQSGDS 537          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:103023813])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 350/536 (65.30%), Postives = 428/536 (79.85%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQT 1662
            G P+LVLS N KR  G+KVQ  NI A K +ADVIRTCLGPRAM+KML+DPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT +ISAYR+AL+DML  +K + S   D ++ + M+KI+ S + TK +S+WS +AC I+L+AVR V + ++GRKEIDIK++A++EK+PGG IED  VL GVM NKD  H RMRR I+NPRI+LLDC+LEYKKGESQT IE  +E D  + L++EEEYI+ ICEDIIR KPD++ TEK +SD AQH+L+KANIT IRRIRK D  R+ARACGA I +RT+E++EED+GTGAGLFEV+ IGDEYFT+VT+CK+PKACTI+LRGASK+IL E+ERNLQDAM V RNVLL+  L+PGGGAVEMA+S  L E  +    V Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +     ++G++G  G +ADM EL I +PL VK Q +KTA+ETAILLLRIDDIVSG KK+   ++QT
Sbjct:    3 GRPVLVLSQNMKRESGRKVQTGNINAAKTIADVIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVISAYRQALDDMLSMLK-EISTPVDQNDRSMMLKIINSAINTKALSRWSSLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLKGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEITREEDFAKILQMEEEYIQLICEDIIRLKPDLIFTEKGISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELREEDVGTGAGLFEVKKIGDEYFTFVTECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMAVSHRLTERSRALTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGS--TSWGVNGETGTLADMVELGIWEPLAVKAQTYKTAVETAILLLRIDDIVSGHKKKGDKAEQT 535          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:103028526])

HSP 1 Score: 269.24 bits (687), Expect = 2.442e-82
Identity = 171/529 (32.33%), Postives = 288/529 (54.44%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSC----LGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            P+++L   T  +QG    + NI A + +A+ +RT LGPR M K+++D  G   ++NDG  IL+ + V HPAAK++++IAR+QD EVGDGTTSV +LA E L Q  P +E  +HP  II A+R A +  ++ +K + ++     N+ E  ++++ C    L +K I+   +   K+ ++AV  +        E+   +   ++K+ GGA+E+ +++ GV F K   ++      +R +NP+I LL+  LE  K E   A   VK ++ Y+A+   E   +    E I +    VV+++  + D A  +    ++    R+++ D  R   ACG +I      + ++ +G    LFE   +G E + +   C   K CTI+LRG ++  + E ER+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   A A ALE+IPR L  N G D    + +LR+KH+   Q  + YG+D +N  IAD  +  + +P  V+      A E A L+L +D+ +
Sbjct:   25 PVILLKEGTDTSQGVPQLISNINACQVIAEAVRTTLGPRGMDKLIVDNRGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIK-EIAVTVKKDNKEEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMML-------DELLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYDNPKIALLNIELEL-KAEKDNAEVRVKSVEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVGSLTDDVLGQ-CELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHA---QGGMWYGVDVNNEDIADNFQACVWEPAIVRINALTAASEAACLILSVDETI 540          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 248.44 bits (633), Expect = 2.972e-74
Identity = 171/520 (32.88%), Postives = 287/520 (55.19%), Query Frame = 1
Query:   91 RTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSV-----SDYAQHFLIKANITVIRRIRKPDQARLARAC--GATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNP-KACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVS 1626
            R +  +++  NI AGKAVAD IRT LGP+ M KM+ D  G   +TNDG  IL+++ V HPAAK ++E+++ QD E GDGTTSV+++AG +L      L+  IHPT I  ++++A++  +E + +  S   + S+   ++    + L +K +S++S +   +S++AV RV I       +D++    ++K+ GG I+DCE++DG++  +  +++ +  R+E  +I L+   L   K +    I       M R L+ E  YI  + + I +   +V++ +KS+     SD A HFL K  I V++ I + +       C  G   +   ++   E +G      EV   G      +T C +P K  +IV+RG++K ++ E ER++ DA+ V R ++ +  L+ GGGA E+ ++  L E  ++   +      A A ALEVIP TL +N G + + T+TELR++H+   Q     GI+   G I+++ E  ++ PL V       A ET   +L+IDD+VS
Sbjct:   21 RDKPAQIRYSNISAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTS-ISQPVELSDRETLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRV-IDPATATSVDLRDIHIVKKL-GGTIDDCELVDGLVLTQRVVNTGV-SRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLIKQIKKAGCNVLLIQKSILRDALSDLAVHFLNKMKIMVVKDIEREEIEEQLNICTIGTKPIAHIDQFTPEMLGLAELAEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEFARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHA---QGEKTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDVVS 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 246.899 bits (629), Expect = 3.400e-74
Identity = 168/528 (31.82%), Postives = 294/528 (55.68%), Query Frame = 1
Query:   55 GVPILVLSNNTK--RTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYM-KNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIG--DEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDI 1620
            G P +++ +  K  R  G      +I A KAVA+ ++T LGP  + KM++D  G   +TNDG  IL  + V+H  AK M+E++++QD+E+GDGTT V++LAG +L QA   L+  IHP +I   Y +A    +E++ K   S   D SN   +I+   + LG+K I++      +I++ A+  +T+    RK++D +   ++E   GG +ED +++ GV+ +K+  H +M + +++ +I +L C  E  K +++  ++ +  ++ Y+AL K E+E  +++ + +     ++ I +    D A H L++  +  +R +  P+   +A A G  IV R  E+  E +G  AGL      G   +    + +CKN +A TI +RG +K I+ E +R L DA+ V RN++ + R+V GGGA E++ +  + E      ++ Q    A A ALEVIP  L +N G + ++T+TE+R++   ++   +  GID       DMK+  +++ L  K Q    A +   ++L+IDDI
Sbjct:   13 GRPFIIIKDQDKKFRLTGLDALKSHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAI--LTVADMERKDVDFE-LIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLD-ITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLG-AAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSAL--GIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 247.284 bits (630), Expect = 3.558e-74
Identity = 175/541 (32.35%), Postives = 288/541 (53.23%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRF----ARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGE--SQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEED------IGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVN--------YGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            P+ VL    +RT G+ V+  N+ A  ++A+++++ LGP  + KML+D +G   +TNDG  IL+ + VEHPAAK + E+A  QD+EVGDGTTSV+I+A E+L  A   ++ +IHPT IIS YR A ++ + Y+  + +I AD      ++   K+ + +K I   SD    + ++A   V  V DG+    + R+      + K  G + ++  +++G   N       M +R++N +I  LD +L+  K +   Q  I   ++LD  R  + E +  ++  + I+    +VV+T   + D    + + A    +RR+   D  R+A+A GATI      ++ E+      +G    + + R   DE    V   K   + +I+LRGA+  + +E+ER+L DA+ V + VL  + +VPGGGAVE A+S +L+    +  +  Q+     A +L VIP+TL  N   D    + +LR+ H   N+  VN         G+D  NG   D K+  + +P  VK +  K A E AI +LRIDD++
Sbjct:    7 PLNVLG---QRTTGESVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGADDLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFV-DGK---GVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMKLGVQVVISDPEKLDQIR--QRESDITKERIQKILASGANVVLTTGGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATICPSLSNLEGEETFEATMLGQAEEVVQERVCDDE-LILVKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFH---NEAQVNPERKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 512.686 bits (1319), Expect = 2.989e-180
Identity = 259/385 (67.27%), Postives = 314/385 (81.56%), Query Frame = 1
Query:   46 ITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDIL 1200
            ++ G P+LVLS NTKR  G+KVQ  NI A K +ADVIRTCLGPRAM+KMLMDPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT IISAYR+ALEDML  +K+  S+  D ++   M++IVKS + TK +S+ S++AC I+L+AV  V    +GR+EIDIK +A+IEK+PGG +E+  VL GVM NKD  H RMRRRIE PRILLLDC+LE+KKGESQT IE  +E D  + L+ EE+YI++IC DI+R KPD++ TEK +SD AQHFL+KANIT IRRIRK D  R+ARACGA IV+RT + KEED+GTGAGLFEV+ IGD+YFT++T+CK+PKACTI+LRGASKDIL
Sbjct:    3 LSGGAPVLVLSQNTKRESGRKVQQGNISAAKMIADVIRTCLGPRAMMKMLMDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDISSVAVDVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDNGRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKDVTHPRMRRRIETPRILLLDCSLEFKKGESQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEKGISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSRTSDAKEEDVGTGAGLFEVKKIGDDYFTFITECKDPKACTILLRGASKDIL 387          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 251.136 bits (640), Expect = 2.566e-76
Identity = 169/509 (33.20%), Postives = 282/509 (55.40%), Query Frame = 1
Query:  121 NIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSV-----SDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNP-KACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSG 1629
            NI A KA+AD IRT LGP+ M KM+ D  G   +TNDG  IL+++ V HPAAK ++E+++ QD E GDGTTSV+++AG +L  +   L+  IHPT I  ++++ALE   E +++  S+  + S+   ++    + L +K +S+++ +   +S++AV +V I       +D+     I K+ GG I+DCE+++G++  +  I +    R+E  +I L+   L   K + +  I       M R L+ E  Y   + + + +   +V++ +KS+     SD A HFL K  I V++ I + D   + +  G   +   +    E + + A L E  ++G      VT C NP K  +I++RG++K +L E ER+L DA+ V R ++ +  L+ GGGA E+ +S  L E  +T  ++      A   A+EVIP TL +N G + + T+TELR++H+   Q     GI+   G I+++ E  ++ PL V       + ET   +L+IDDIV+ 
Sbjct:   44 NICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILES-MSLPLELSDRQSLLNSATTALNSKVVSQYASLLAPMSVDAVMKV-IDPATATSVDLNDIKLIRKL-GGTIDDCELVEGLVLTQR-ISNTGIIRVEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIASVDHFTAEMLAS-AELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRHA---QGEKTAGINVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDIVNA 544          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 239.58 bits (610), Expect = 5.483e-72
Identity = 158/530 (29.81%), Postives = 285/530 (53.77%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQ--GKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDC-SIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIG--DEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDG-HNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVS 1626
            G P +++ +  ++++  G      +I A K+VA  +RT LGP+ + KM++   G   +TNDG  IL  + VEH  AK M+E++R+QD+E+GDGTT V++LAG +L QA   L+  IHP +I   Y +A    + ++ +   S   D +N   ++    + LG+K +++   M  +I++ AV  V  ++  RK++D +   ++E   GG ++D  ++ GV+ +KD  H +M + + N +I +L C  E  K +++  ++     D    L+ E+E   ++   +     ++ I +    D A H L++  +  +R +   +   +A A G  IV R  E+  + +G  AG+    + G   ++   + +C N +A TI +RG +K I+ E +R++ DA+ V RN++ + R+V GGG+ E++ S  + E       + Q    A A ALEVIP  L +N G + +  + E+RS+   + + ++  GI+   +    DMKE  +++ L  K Q    A +   ++L+IDDI S
Sbjct:   13 GRPFIIIKDQDRKSRLSGLDALKSHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLE--RKDVDFE-LIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKTKHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQWGFDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADKLGH-AGIVRELSFGTTKDHMLVIEQCHNSRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVRSRQLAEKKPYL--GINCMQSSSKGDMKEQHVIETLIGKKQQISLATQMVKMILKIDDIRS 536          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 224.557 bits (571), Expect = 3.406e-67
Identity = 146/461 (31.67%), Postives = 234/461 (50.76%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAE----MIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGD 1422
            PI++L   T  +QG    L NI A   VAD +RT LGPR M K+++D  G + ++NDG  IL+ + V HPA K++++IAR+QD EVGDGTTSV +LA E+L Q    +E  +HP  I  A+R+A    +E +K + S+     ++ E    ++K   + L +K +S+  D    + ++AV  +        E+       ++K+ GG +ED  ++ GV F K   ++      +    P+I LL+  LE K       +      D    +  E   +      I      VV+++  + D A  +    ++    R+ + D  R   ACG +I      + ++ +G    LFE   IG + + +   C   K CTI+LRG ++  ++E ER+L DA+ + R  +  + +V GGGAVEM +S +L++  +T     Q+   A A ALEV PR L  N G D
Sbjct:    4 PIILLKEGTDTSQGIPQLLSNITACLVVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIK-EISVPVKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVDAVSML-------DELMPLNMIGMKKVQGGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVELELKAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKLPIGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDDVLGR-CELFEEVQIGGDRYNFFKGCPQAKTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAGFD 455          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 8.685e-25
Identity = 58/186 (31.18%), Postives = 106/186 (56.99%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGG----TVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYRE---ALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRV 597
            PI +L +     + +  +L +      + D++++ LGP+ M K+L+           +TNDG  IL+ I V++PAAK ++++++ QD+EVGDGTTSV +LA E+L +A   +  +IHP  II+ +R+   A    LE    D   + +  +  +++ I ++ L +K ++   D   K+++EAV R+
Sbjct:    6 PINILKSGADEEKAETARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALELAAVDHGHDKEKFH-VDLLNISRTTLSSKLLTHHKDHFAKLAVEAVLRL 190          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT3 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; capable of binding Q/N rich proteins and mediating their folding [Source:SGD;Acc:S000003551])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 306/534 (57.30%), Postives = 390/534 (73.03%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSL-EMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRV------TIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQ 1641
            P++ ++ + +RT G++ Q+ NI A KAVADVIRTCLGP+AMLKML+DPMGG V+TNDG+AILREI V HPAAKSM+E++RTQDEEVGDGTT+VIILAGE+L Q  P L E  IHP  II A ++AL D LE +K   S   D  N+A M K++++ +GTK++  WS+  C+++L+AV+ V      T+  +   EIDIKR+ R+EKIPGG + D  VL GV+ NKD +H +M R IENPR++LLDC LEYKKGESQT IE  KE D  R L+IEEE ++ +CE I+  +P +VITEK VSD AQH+L+K   +V+RR++K D  R+AR  GATIVNR E++KE D+GT  GLF+V  IGDEYF+++  CK PKACTI+LRG SKDILNE++RNLQDAM VARNV+L   L PGGGA EMA+S  L E  K    + Q PY AVA A+E IPRTLIQN GGD +R +++LR+KH+  N      GIDG  G I DM    I +P  +K Q  KTAIE+A LLLR+DDIVSG +KQ
Sbjct:    4 PVVFMNASQERTTGRQAQISNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIKQ-VSKPVDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTVRKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEKGVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIGDEYFSFLDNCKEPKACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKHAQGN---FTTGIDGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDIVSGVRKQ 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 255.758 bits (652), Expect = 3.083e-78
Identity = 177/534 (33.15%), Postives = 287/534 (53.75%), Query Frame = 1
Query:   64 ILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKN-DCSIEADTSNEAEMI-KIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHS---RMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            I+VL   T  +QGK   + NI A  AV + ++  LGP     +++     T ++NDG  IL+ + V HPAAK++++I+R QD EVGDGTTSV ILAGE++ +A P LE  I    I+  YR+A+   +E +      I ++ S+  E++ +  ++ + +K I   +D   K+ ++AV  +      R ++D K    I+KIPGGA+E+   ++GV F K   ++   +  ++  NP+IL L+  LE  K E   A   V+ ++ Y+A+   E + I +    +     ++V+++  + D A  F    NI    R+   D  R+ +A G +I + T +IK E +GT A LFE   IG E +     C   K CT++LRG ++ ++ E+ER+L DA+ + +  L  + +V GGGA EM +S  L++  KT     Q+   A A ALEVIPR L +N G D +  + +LR  HS   +K+  YG+      I D     + +P  VK     +A E   L+L +D+ ++    +SA
Sbjct:   10 IVVLKEGTDASQGKGQIISNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKINELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVLSLD-----RNDLDDKLIG-IKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELEL-KAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLSKLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCA-LFEEMQIGSERYNLFQGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHS-KGEKW--YGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETITNKGSESA 532          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 243.817 bits (621), Expect = 1.321e-73
Identity = 164/546 (30.04%), Postives = 302/546 (55.31%), Query Frame = 1
Query:   55 GVPILVLSN--NTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALE---DMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEID---IKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRI------ENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXX-XXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLF--EVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQ 1641
            G P +++ +  N KR  G + +  +I A ++VA +I+T LGPR + K+L+ P G   +TNDG  IL ++ +++  AK +++++++QD+E+GDGTT V++LA  +L QA   ++  IHP KI + + EA +     LE   +D S   D      +++  K+ LG+K +SK  D   ++++EAV  + ++   RK++D   IK   R+    GG+I D ++++GV+ +KD  H +M + +      +  ++ +L C  E  K +++  ++ +  ++ Y+ L+  E+   K   +D+ +   DVVI +    D A H L++ ++  +R +   +   +A +    IV R +++ ++ +GT + ++  E  T  D     + + K  K  T  +RG++K I++E ER L D++ V RN++ + R+V GGGA E+ +S  + E    +  + Q  +   A AL+ IP TL +N G D + T++ L+SK     +K  N G+D       DMKEL ++DP   K Q    A +   ++L+ID+++   K +
Sbjct:   26 GRPFIIVKDQGNKKRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAV--INVMDKDRKDVDFDLIKMQGRV----GGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLD-ISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLI-IEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQL--KEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVIISGKDE 561          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 233.802 bits (595), Expect = 2.986e-70
Identity = 171/528 (32.39%), Postives = 289/528 (54.73%), Query Frame = 1
Query:   70 VLSNNTKRTQGK--KVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSR-MRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKS-----VSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKA---CTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDI 1620
            V SN T + + K  +V+  NI A ++VAD IRT LGP+ M KM+    G  +++NDG+ IL+++ + HP A+ ++E++  QD E GDGTTSV+IL G +L  A   L   IHPT I  +++ A +  ++ +   C  +   S+  ++++   + L +K +S++S     +++++V +++   +  K +D+     ++K+ GG I+D E++DGV+  +  I S     R E  +I L+   +   K +++  I       M + LK E  Y+  IC+ I + K +V++ +KS     V+D A HFL K NI V++ I + +   L++  G   +   E   E+ +G+   + E+ + G +    VT  +N  A    ++V+RGA+  I++E ER+L DA+ V R ++ E  L+ GGGA E+ IS  L +  ++   V    +   A+ALEVIP TL +N G + ++ +TELRSKH  +N +  N GI        +  E  I+ P+ V       A E    +LRIDDI
Sbjct:    5 VPSNATFKNKEKPQEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCH-KVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKIS--DENSKNVDLNDIRLVKKV-GGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEIDSDGSK-IVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKH--ENGEL-NDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDI 524          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: TCP1 (Alpha subunit of chaperonin-containing T-complex; complex mediates protein folding in the cytosol; involved in actin cytoskeleton maintenance; overexpression in neurons suppresses formation of pathogenic conformations of huntingtin protein [Source:SGD;Acc:S000002620])

HSP 1 Score: 232.646 bits (592), Expect = 1.693e-69
Identity = 165/538 (30.67%), Postives = 278/538 (51.67%), Query Frame = 1
Query:   88 KRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIK-RFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIE--NPRILLLDCNLEYKKGES--QTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIG-----------DEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHS---------LDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVS 1626
            ++  G  ++  N+ A  AVA+V+++ LGP  + KML+D +G   +TNDG  IL  + V+HPA K ++E+A+ QD E+GDGTTSV+I+A E+L +A   ++ +IHPT II+ +R AL + + ++    S   DT  +  +I I K+ + +K I   SD    + ++A+  V   Q+ + EI    +   + K  G +  +  ++ G   N       M +RI   N +I  LD NL+  +     Q  I+  ++L+  R  K E   + +  + II     VV+T K + D      ++A I  +RR +K D  R+ARA GAT+V+    ++ E+       FE   +G           D+    +       + +I+LRGA+   L+E+ER+L D+++V +  L    +VPGGG VE A++ +L     T  +  Q+     A AL +IP+TL  N   D    + +LRS H+         +  + + NYG+D   G I D     +++P   K +  K+A+E  + +LRID +++
Sbjct:   18 EKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVK-TQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIR--KREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEET------FESSYLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMIT 546          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO35415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL4])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 352/530 (66.42%), Postives = 432/530 (81.51%), Query Frame = 1
Query:   58 VPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            + ++VL+ NTKR  G+KVQL N++A K +AD+IRTCLGPRAMLKMLMDPMGG VMTNDGNAILREI V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGE +  A P LE Q+HPT+II+AYR A++DM++ +K   S+  D  N  EM+KI++S +GTKFI+KW D+AC I+L+AV+ V + +  RKEIDIK +A++EK+PGG IED +VL GVM NKD  H RM+RRIENPRI+LLDCNLEYKKGESQT++E   + D  R L++EEE+I+K+C+++I  KPD+VITEK +SD AQHFL+KANIT IRR+RK D  R+ARACGATIVNRTEE+KEEDIGTGAGLFEV   GDEYFT++T+C NPKACTI+LRGASKD+LNE+ERNLQDAMNVARNV+++ RLVPGGGA EMA++  L E  K    V Q PY AVA  LEVIPRTLIQNCG + +RTIT LR+KH+ +     ++GIDG +G I DM+EL + D   VK Q FKTA+ETA+LLLRIDDIVSGTKK + 
Sbjct:    1 MSVIVLNQNTKRESGRKVQLGNVQAAKTIADIIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISVPVDIDNREEMLKIIRSSVGTKFINKWGDLACNIALDAVKTVALDRGDRKEIDIKNYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEKGISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITECNNPKACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRAKHAAEGN--TSWGIDGESGQIVDMQELGVWDTYAVKAQTFKTALETAMLLLRIDDIVSGTKKATG 528          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO31685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX65])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 303/535 (56.64%), Postives = 376/535 (70.28%), Query Frame = 1
Query:   58 VPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTK-----FISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSA 1647
            + ++VL+ NTKR  G+KVQL N++A K +AD+IRTCLGPRAMLK                     I V+HPAAKSMIEI+RTQDEEVGDGTTSVIILAGE +  A P LE Q+HPT+II+AYR A++DM++ +K   S      +        +            +++W D+AC I+L+AV+ V + +  RKEIDIK +A++EK+PGG IED +VL GVM NKD  H RM+RRIENPRI+LLDCNLEYKKGESQT++E   + D  R L++EEE+I+K+C+++I  KPD+VITEK +SD AQHFL+KANIT IRR+RK D  R+ARACGATIVNRTEE+KEEDIGTGAGLFEV   GDEYFT++T+CKNPKACTI+LRGASKD+LNE+ERNLQDAMNVARNV+++ RLVPGGGA EMA++  L E  K    V Q PY AVA  LEVIPRTLIQNCG + +RTIT LR+  S      +   IDG                            +TA+LLLRIDDIVSGTKK + 
Sbjct:    1 MSVIVLNQNTKRESGRKVQLGNVQAAKTIADIIRTCLGPRAMLK---------------------IQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISRHHHCHHHHHHHPDYRQHHKHHHDQLILLNQWGDLACNIALDAVKTVALDRGDRKEIDIKSYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEKGISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITECKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRT--SGGGWTVIQRRIDG----------------------------QTAMLLLRIDDIVSGTKKATG 484          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO48692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF0])

HSP 1 Score: 252.677 bits (644), Expect = 1.120e-76
Identity = 160/531 (30.13%), Postives = 282/531 (53.11%), Query Frame = 1
Query:   64 ILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSC----LGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHS--RMRRRIENP-RILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTK 1635
            I++L   T  +QG    + NI+A + +AD +RT LGPR M K+++D  G   ++NDG  I+  + + HPAAK++++IA++QD EVGDGTTSV +L GE L Q    +E  +HP  I+ +YR+A    ++ +K + ++    ++  EM ++++ C    L +K I+   +   K+ ++AV    ++ D    +D+     ++K+ GGA+ED  +++GV F K   ++   M+ +  N  +I LL+  LE K  +    +      D    +  E + +    + +++    VV+++  + D A  +    ++    R+ + D  R  +ACG  I      + ++ +G    LFE + +G E + + + CK    CTI++RG ++  + E ER+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   A+A A E+IPR L  N G D    + +LR KH    Q    YG+D +   IAD  E  + +P  VK      A E + L+L +D+ +   K
Sbjct:    5 IILLKEGTDASQGIPQLISNIDACQFIADAVRTTLGPRGMDKLIVDGRGKATISNDGATIINLLDIVHPAAKTLVDIAKSQDAEVGDGTTSVTLLTGEFLKQVKQFVEEGVHPQIIVKSYRKAANLAIKRIK-ELAVHVKKNDAGEMRQLLERCAATALSSKLIATQKEFFAKMVVDAV----MMLDELLPLDM---IGMKKVSGGALEDSMLIEGVAFKKTFSYAGFEMQPKTYNHCKIALLNVELELKAEKENAEVRLDNVKDYQSIVDAEWDILYDKLDKVVKSGAKVVLSKLPIGDVATQYFADRDMFCAGRVTEEDLKRTMKACGGAIQTSVNSMTDDVLGR-CDLFEEKQVGGERYNFFSGCKQSTTCTIIMRGGAEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIEMELSKYLRDYSRTIAGKEQLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQKHFQGGQW---YGVDINREDIADNFEACVWEPAVVKINAITAATEASCLILSVDETIKNPK 523          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 248.054 bits (632), Expect = 5.860e-75
Identity = 161/528 (30.49%), Postives = 287/528 (54.36%), Query Frame = 1
Query:   55 GVPILVLSNN--TKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDC-SIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXR-CKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIG--DEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDI 1620
            G P ++L      KR  G + Q  +I A +AVA +++T LGP+ M KM++ P G   +TNDG  IL  + V+H  AK M+E++++QD E+GDGTT V++LAG +L  A   L+  IHP +I   Y  A +  LE+M +   +   D  N+  +I+   + LG+K +S+      +I+++AV  V  ++  RK++D +   ++E   GG ++D  ++ GV+ +KD  H +M + +++ +I +L C  E  K +++  ++ V  ++ Y+ L+  E          ++    ++ I +    D A H L++ ++  +R +  P+   +A A G  IV R  E+  E +G  AG+    + G   +    + +C N +A TI +RG +K I+ E +R++ DA+ V RN++ + R+V GGGA E++ S  + +       + Q    A A AL+ IP  L +N G + ++T+ +++S+     +K    G+D  +  I DMK   +++ L  K Q    A +   ++L+IDDI
Sbjct:   19 GRPFIILKEQEEQKRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPVDKDNKESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLE--RKDVDFE-LIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLD-VATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGK-AGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQV--AEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 539          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO27411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B6])

HSP 1 Score: 228.024 bits (580), Expect = 9.456e-68
Identity = 157/527 (29.79%), Postives = 280/527 (53.13%), Query Frame = 1
Query:   55 GVPILVLSNN--TKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXR-CKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIG--DEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDI 1620
            G P ++L      KR  G + Q  +I A +AVA +++T LGP+ M KM++ P G   +TNDG  IL  + V+H  AK M+E++++QD E+GDGTT V++LAG +L  A   L+  IHP +I   Y  A +  LE+M        D+  +   + +  S      +S+      +I+++AV  V  ++  RK++D +   ++E   GG ++D  ++ GV+ +KD  H +M + +++ +I +L C  E  K +++  ++ V  ++ Y+ L+  E          ++    ++ I +    D A H L++ ++  +R +  P+   +A A G  IV R  E+  E +G  AG+    + G   +    + +C N +A TI +RG +K I+ E +R++ DA+ V RN++ + R+V GGGA E++ S  + +       + Q    A A AL+ IP  L +N G + ++T+ +++S+     +K    G+D  +  I DMK   +++ L  K Q    A +   ++L+IDDI
Sbjct:    7 GRPFIILKEQEEQKRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHM--------DSIADNFPLPLGYS------VSRCHRPLAEIAVDAVLSVADLE--RKDVDFE-LIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLD-VATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGK-AGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKIATIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQV--AEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 512          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 347/535 (64.86%), Postives = 424/535 (79.25%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQ 1659
            G  +LVL+ N KR  G+KVQ  NI A K +ADVIRTCLGPRAM+KML+DP GG VMTNDGNAILREI V+HPAAK+MIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT IISAYR+ALEDMLE +K + S   DTS+ + M+KIV S + TK + +WSD+AC I+L+AVR V + ++GRKEIDIK +A++EK+PGG IED  VL GVM NKD  H +MRR I+NPRI+LLDC+LEYKKGESQT IE  KE D  R L++EE+YI++ICEDI+R KPD++ TEK +SD AQH+L+KANIT IRR+RK D  R+ARACGA IV+RT+E++EED+G GAGLFEV+ IGDEYFT++T+CK+PKACTI+LRGASK+IL E+ERNLQDAM V RNVLL+  L+PGGGAVEMA+S  L E  +    + Q PY AVA ALEVIPRTLIQNCG   +R +T LR+KH+ +    V +GI+G +G + DM  L I +PL VK Q +KTA+ETAILLLRIDDIVSG KK+     Q
Sbjct:    3 GQQVLVLNQNVKRESGRKVQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALK-EVSTPVDTSDRSMMLKIVNSAINTKALFRWSDLACTIALDAVRTVELEENGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGLFEVKKIGDEYFTFITECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGN--VGWGINGESGCLTDMSTLGIWEPLAVKAQTYKTAVETAILLLRIDDIVSGHKKKDKADGQ 534          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 330/545 (60.55%), Postives = 406/545 (74.50%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELR----------------------------------SKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIE 1587
            G  +LVL+ N KR  G+KVQ  NI A K +ADVIRTCLGPRAM+KML+DP GG VMTNDGNAILREI V+HPAAK+MIEI+RTQDEEVGDGTTSVIILAGEML  A   LE Q+HPT IISAYR+ALEDMLE +K + S   DTS+ + M+KIV S + TK + +WSD+AC I+L+AVR V + ++GRKEIDIK +A++EK+PGG IED  VL GVM NKD  H +MRR I+NPRI+LLDC+LEYKKGESQT IE  KE D  R L++EE+YI++ICEDI+R KPD++ TEK +SD AQH+L+KANIT IRR+RK D  R+ARACGA IV+RT+E++EED+G GAGLFEV+ IGDEYFT++T+CK+PKACTI+LRGASK+IL E+ERNLQDAM V RNVLL+  L+PGGGAVEMA+S  L E  +    + Q PY AVA ALEVIPRTLIQNCG   +R +T LR                                  +KH+ +    V +GI+G +G + DM  L I +PL VK Q +KTA+E
Sbjct:    3 GQQVLVLNQNVKRESGRKVQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALK-EVSTPVDTSDRSMMLKIVNSAINTKALFRWSDLACTIALDAVRTVELEENGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGLFEVKKIGDEYFTFITECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRVQKTQNINILLFLMASGVIFFLFKNFKKIIFLVQAKHTQEGN--VGWGINGESGCLTDMSTLGIWEPLAVKAQTYKTAVE 544          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:101173660])

HSP 1 Score: 270.781 bits (691), Expect = 8.109e-83
Identity = 174/528 (32.95%), Postives = 281/528 (53.22%), Query Frame = 1
Query:   61 PILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKN-DCSIEADTSNEAEMI--KIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMR---RRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRAL-KXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            P+++L   T  +QG    + NI A + +A+ +RT LGPR M K+++D  G   ++NDG  IL+ + V HPAAK++++IAR+QD EVGDGTTSV +LA E L Q  P +E  +HP  II A+R A    +  +K    S++ D   E   +  K   + L +K I+   +   K+ ++AV  +        E+   +   I+K+ GGA+ED +++ GV F K   ++      +R +NP+I LL+  LE  K E   A   VK ++ Y+A+   E   +    E I +    VV+++  + D A  +    ++    R+++ D  R   ACG +I      + E+ +G    +FE   +G E + +   C   K CTI+LRG ++    E ER+L DA+ + R  +  + +V GGGA+EM +S +L++  +T     Q+   A A ALE+IPR L  N G D    + +LR+KH+   Q  + YG+D +N  IAD     + +P  V+      A E A L+L +D+ +
Sbjct:   32 PVILLKEGTDSSQGIPQLVSNINACQVIAEAVRTTLGPRGMDKLMVDARGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLRQLKPFVEESLHPQTIIRAFRTATNLAVSKIKEIAVSVKKDDKQEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMSL-------DELLSLKMIGIKKVQGGALEDSQLVSGVAFKKTFSYAGFEMQPKRYDNPKIALLNVELEL-KAEKDNAEVRVKSVEEYQAIVDAEWNILYDKLEKIYQSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVGALTEDVLGL-CEVFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFTEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHA---QGGMWYGVDINNEDIADNFAAFVWEPSIVRINALTAASEAACLILSVDETI 547          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 248.44 bits (633), Expect = 1.061e-74
Identity = 167/518 (32.24%), Postives = 285/518 (55.02%), Query Frame = 1
Query:   91 RTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSV-----SDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNP-KACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVS 1626
            R +  +++  NI A KAVAD +RT LGP+ M KM+ D  G   +TNDG  IL+++ V HP+AK ++E+++ QD E GDGTTSV+I+AG +L      L+  IHPT I  ++++A++  +E + N  S   + S+   ++    + L +K +S++S +   +S++AV RV I       +D+     I+K+ GG I+DCE+++G++  +  + S    R+E  +I L+   L   K +    I       M R L+ E  YI  + + + +   +V++ +KS+     SD A HFL K  I V++ I + +   + +  G   +   +    E +GT     E+   G      +T C +P K  +IV+RG++K +++E ER++ DA+ V R ++ +  L+ GGGA E+ ++  L E  +T   +      A   ALEVIP TL +N G + + T+TELR+KH+  ++     GI+   G I+++ E  ++ P+ V       A ET   +L+IDD+V+
Sbjct:   24 RDKPAQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVL-NGMSRPVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRV-IDPATATGVDLNNIKIIKKL-GGTIDDCELVEGLVLTQR-VASTGVTRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGDKM---AGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVVN 534          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:101171367])

HSP 1 Score: 243.817 bits (621), Expect = 4.934e-73
Identity = 169/530 (31.89%), Postives = 296/530 (55.85%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQ--GKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYM-KNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCK-PDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIG--DEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVS 1626
            G P +++ +  K+T+  G      +I A KAVA  +RT LGP  + KM++D  G   +TNDG  IL  + V+H  AK M+E++++QD+E+GDGTT V++LAG +L +A   L+  IHP +I   Y +A    +E + K   +   D +N   +I+   + LG+K I++      +I++ A+  V  +Q  RK++D +   ++E   GG +ED +++ GV+ +K+  H +M + +++ +I +L C  E  K +++  ++ V  ++ Y+AL+  E+   +     ++    ++ I +    D A H L++  +  +R +  P+   +A A G  IV R  E+  E +GT AGL +  + G   ++   + +CKN +A TI +RG +K I+ E +R L DA+ V RN++ + R+V GGGA E+A +  +        ++ Q    + A ALEVIP  L +N G + ++T+ E+R++   DN  F+  GID  +    DMK+  +++ L  K Q    A +   ++L+IDDI S
Sbjct:   13 GRPFIIIKDQDKKTRLTGIDALKSHIMAAKAVAGTLRTSLGPNGLDKMMVDRDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAELLLDRGIHPIRISDGYDQAARIAIEKLDKIAETFPCDPNNLEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMQ--RKDVDFE-LIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKELKDVKIAILTCPFEPPKPKTKHKLD-VTSVEDYKALQKYEKEKFEEMIQQVKSNGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFSELTPEKLGT-AGLVKELSFGTTKDHMLVIQECKNTRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLIRDNRVVYGGGASEIACALAVNRAADKCPSLEQYAMRSFADALEVIPMALAENSGLNPIQTMAEVRARQVKDNNPFL--GIDCLHKNTNDMKQQHVIETLIAKKQQISLATQVVRMILKIDDIRS 535          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000075311.1 (SMESG000075311.1)

HSP 1 Score: 1076.62 bits (2783), Expect = 0.000e+0
Identity = 543/543 (100.00%), Postives = 543/543 (100.00%), Query Frame = 1
Query:   43 MITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQN 1671
            MITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKIEEEYIEKICEDIIRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQN
Sbjct:    1 MITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKIEEEYIEKICEDIIRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQN 543          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000066978.1 (SMESG000066978.1)

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 364/530 (68.68%), Postives = 441/530 (83.21%), Query Frame = 1
Query:   52 SGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQ 1641
            S +P+++L++N +R QGKKVQ  NI A K VADVIRTCLGPRAMLKMLM P GG VMTNDGNAILREITVE PAAKSMIEIARTQDEEVGDGTTSVIILAGE+L QA   L+ +IHPTKIISAYREAL+D LEYMK    +  D+ N  EM+K++KSCLGTKFI+KWSD+ACKI+L+AV +VT  ++G+KEIDIKR+ +IEKIPGGAIED  VL GV+FNKD +H +MRRRIENPRILLLD ++EYKKGESQT++E  +E +M RAL++EEEY+EK+C DIIR KPD+VITEK VSD AQH+ +KANI+V+RR+RK D  R+AR CGA+I++  +E KEEDIGTGAGLFE++ IGDEYFT++T+CK PKAC+I+LRG+SKD+LNE+ERNL DAM+VARNV++E  LVPGGGA+EMAIS  L    +  + V Q  YLAVA ALEVIPRTL QNCG  VLR ITELR+KH++D     + G+DG  GVI DMK+L + DPL V+ QV KTAIET++LLLRIDDI+SGTKKQ
Sbjct:    2 SSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHVDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 531          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000079886.1 (SMESG000079886.1)

HSP 1 Score: 268.47 bits (685), Expect = 2.180e-82
Identity = 170/537 (31.66%), Postives = 287/537 (53.45%), Query Frame = 1
Query:   55 GVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSC----LGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIEN---PRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQS 1644
            G  I++L   T  +QG    + NI A +++A+ +RT LGPR M K+++D      ++NDG  IL+ + V HP A ++++IA +QD+EVGDGTTSV++LA E L QA P +E  +HP  I  AY++A +  L Y+ N+ S++ +  NE E   +++ C    L +K ++ + D   K+ ++AV  +    D    +D+     I+K+PGG+++D +++ GV F K   ++    + ++   P+I LL+  LE K  +    I      +  R +  E + +    E I +    +V+++  + D A  +    ++    R+ + D  R   ACG  I    ++I E+ +G      EV+ IG E F     C   K CTI+LRG S+  + E ER+L DA+ + R  +  + +V GGGA++M IS +L++  +  L   Q+   A+A + E+IPR L +N G D    + +LR KHS   Q  +  G+D  N  +AD  E  + +P  VK      A E A ++L +D+ +   K ++
Sbjct:    4 GAQIVLLKEGTDTSQGIPQIMSNITAIQSIAEAVRTTLGPRGMDKLIIDEKSKATISNDGATILKLLDVIHPVAGTVVQIALSQDDEVGDGTTSVMLLASEFLKQAKPFIEEGVHPELIQKAYKKASKLALSYL-NELSVKIEEGNEVERRSLLEKCASTALSSKLVATYKDFFSKLVVDAVSSL----DHLLPLDM---IGIKKVPGGSLQDSQLISGVAFKKTFSYAGFEMQPKSYVKPKISLLNIELELKSEKENAEIRVNSVEEYQRIVDAEWQILYDKLEAIYKSGAKIVLSKLPIGDVATQYFADRDMFCAGRVSEEDLKRTMAACGGGIQTTVKDITEDTLGKCDSFEEVQ-IGGERFNIFVGCPEAKTCTIILRGGSEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIDMEISRYLRDYSRKILGRDQLFISAMAKSFEIIPRQLCENAGFDATNILNKLRQKHS---QGKIWCGVDILNEDVADNFEACVWEPALVKSNAITAATEAACMVLTLDETIRNAKSKT 528          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000067696.1 (SMESG000067696.1)

HSP 1 Score: 254.218 bits (648), Expect = 5.503e-77
Identity = 167/529 (31.57%), Postives = 282/529 (53.31%), Query Frame = 1
Query:   73 LSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIK-RFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATI------VNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQ-----KFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            L+   +RT G  V+  N+ A + +A++++T LGP  + KML+D +G   ++NDG  IL+ + VEHPAAK ++E+A+ QDEEVGDGTTSV+I+A E+L  A   ++ +IHPT IIS YR A  +  +Y++N+ +I+ D   +  +    K+ + +K I   SD    +++EA   V  V DG+       +   + K  G ++++  ++ G   N      +M R I+  +I LLD +L+  K +    +       +    K E +  ++  E I++   +V++T   + D    + ++A    +RR +K D  R+A+A G ++      ++  E   + ++G    + + R   DE    +  CK   A +++LRGA+   ++E+ER++ D+  V + VL  + +VPGGGA E A+  +L++   T  +  QI     A AL VIP+ L  N   D    + +LR+ H    Q      F  YG+D  N  +++ KE  I +P   K +  K A E AI +LRIDD+V
Sbjct:    9 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVK-VSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDITKEKIEKILKTGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDE-LILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 535          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000050684.1 (SMESG000050684.1)

HSP 1 Score: 248.44 bits (633), Expect = 1.045e-74
Identity = 175/532 (32.89%), Postives = 285/532 (53.57%), Query Frame = 1
Query:   73 LSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRV-TIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYK--KGESQTAIEFVKELDMYRALKXXXXXXXXXXXXXXRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEED-------IGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELR-SKHSLDNQK----FVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIV 1623
            LS +  RT G  ++  N+ A   VA++I++ LGP  + KML+D +G   ++NDG  IL+ + VEHPAAK ++E+A+ QD+EVGDGTTSV+++A E+L  A   +  +IHPT +IS YR A  +  +Y+ N+  +  D      +I   K+ + +K I   S+   K+++EA   V T   DG     I     I K  G ++ + E+++G   N      +M R I   +I LLD NL+    K   Q  +    +LD  R  K E +  ++  E I++   +V++T   + D    + +++N   +RR +K D  R+A+A G +++     + +E+       +G    +F+ R   DE    +   K   A +I+LRGA+   ++E+ER++ DA+ V + VL  + +VPGGGA E+A+S FL++   T  +  QI     A +L  IP+ L  N   D    +++L+ S HS  N++        G+D  N  IA+ K   I +P  +K +  K A E AI +LRIDD+V
Sbjct:    9 LSIDGDRTTGDNIRRQNVLAAVTVANIIKSSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDDEVGDGTTSVVLIAAELLKNAEEQVSGKIHPTILISGYRIACREACKYIMNNLVLNVDDLGPECIINAAKTSMSSKLIGVDSNFFAKMAVEAAMAVKTPNGDGTFYYPINSI-NILKAHGKSMRESEIVNGYAINCTVSSLQMPRYINKAKIALLDFNLQKTRLKLGVQILVTDPDKLDEIR--KRESDITKERIEKILKAGANVILTTGGIDDLCMKYFVESNTMAVRRCKKVDLKRIAKATGGSLLCTMSTLDKEEESYDPSMLGEAEEVFQRRVCDDEMI-IIKNTKTRSAASILLRGANDFYVDEMERSMHDALCVIKRVLESKSVVPGGGACEVALSVFLEDFATTIGSKEQIAIAEYARSLLTIPKQLAVNASLDSTELLSQLQASHHSSQNEEGKSDLKWMGLDLQNCTIANNKAAGIFEPTMIKIKSLKFATEAAITILRIDDLV 536          
The following BLAST results are available for this feature:
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT30.000e+064.55chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT30.000e+064.52chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT30.000e+058.96chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT32.477e-10866.80chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT31.178e-9965.37chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-30.000e+061.03T-complex protein 1 subunit gamma [Source:UniProt... [more]
cct-11.962e-7931.45T-complex protein 1 subunit alpha [Source:UniProt... [more]
cct-75.450e-7931.21T-complex protein 1 subunit eta [Source:UniProtKB... [more]
cct-75.450e-7931.21T-complex protein 1 subunit eta [Source:UniProtKB... [more]
cct-41.701e-7333.33T-complex protein 1 subunit delta [Source:UniProt... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT30.000e+067.80gene:FBgn0015019 transcript:FBtr0302371[more]
CCT30.000e+067.80gene:FBgn0015019 transcript:FBtr0302370[more]
CCT30.000e+067.80gene:FBgn0015019 transcript:FBtr0083337[more]
CCT30.000e+067.80gene:FBgn0015019 transcript:FBtr0083338[more]
CCT79.506e-7731.14gene:FBgn0037632 transcript:FBtr0081918[more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct30.000e+065.22chaperonin containing TCP1, subunit 3 (gamma) [Sou... [more]
cct72.109e-7932.39chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct51.211e-7632.20chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct48.552e-7532.82chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
tcp12.328e-7231.38t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct33.861e-11563.93chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
cct71.495e-8032.39chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct78.070e-8031.70chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct71.049e-7832.38chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct42.786e-7733.01chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cct30.000e+063.99chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct30.000e+063.85chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct30.000e+058.40chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct33.986e-11152.81chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct71.525e-7931.57chaperonin containing Tcp1, subunit 7 (eta) [Sourc... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48605|TCPG_DROME0.000e+067.80T-complex protein 1 subunit gamma OS=Drosophila me... [more]
sp|P50143|TCPG_XENLA0.000e+065.97T-complex protein 1 subunit gamma OS=Xenopus laevi... [more]
sp|Q3T0K2|TCPG_BOVIN0.000e+065.11T-complex protein 1 subunit gamma OS=Bos taurus OX... [more]
sp|P49368|TCPG_HUMAN0.000e+064.55T-complex protein 1 subunit gamma OS=Homo sapiens ... [more]
sp|Q5NVF9|TCPG_PONAB0.000e+064.18T-complex protein 1 subunit gamma OS=Pongo abelii ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZMD90.000e+070.26T-complex protein 1 subunit gamma (Fragment) OS=Op... [more]
A0A5J4NT180.000e+070.84T-complex protein 1 subunit gamma OS=Paragonimus w... [more]
A0A3R7CM860.000e+070.07T-complex protein 1 subunit gamma OS=Clonorchis si... [more]
A0A4S2MGT30.000e+070.09T-complex protein 1 subunit gamma OS=Opisthorchis ... [more]
A0A504YS000.000e+070.47T-complex protein 1 subunit gamma OS=Fasciola giga... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct30.000e+065.30chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
cct72.442e-8232.33chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct42.972e-7432.88chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct53.400e-7431.82chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
tcp13.558e-7432.35t-complex 1 [Source:NCBI gene;Acc:103041096][more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002042.12.989e-18067.27pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
cct42.566e-7633.20chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct55.483e-7229.81chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct73.406e-6731.67chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
ENSPMAT00000002094.18.685e-2531.18pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCT30.000e+057.30Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT73.083e-7833.15Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT51.321e-7330.04Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT42.986e-7032.39Subunit of the cytosolic chaperonin Cct ring compl... [more]
TCP11.693e-6930.67Alpha subunit of chaperonin-containing T-complex; ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354150.000e+066.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316850.000e+056.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486921.120e-7630.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495715.860e-7530.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274119.456e-6829.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct30.000e+064.86chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
cct30.000e+060.55chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
cct78.109e-8332.95chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct41.061e-7432.24chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct54.934e-7331.89chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075311.10.000e+0100.00SMESG000075311.1[more]
SMESG000066978.10.000e+068.68SMESG000066978.1[more]
SMESG000079886.12.180e-8231.66SMESG000079886.1[more]
SMESG000067696.15.503e-7731.57SMESG000067696.1[more]
SMESG000050684.11.045e-7432.89SMESG000050684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025525 ID=SMED30025525|Name=T-complex protein 1 subunit gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=1745bp
TCTTCAATTTTAATAAATTAATATCTTATCGAGATTAGAAACATGATAAC
GAGTGGGGTACCAATATTAGTATTAAGTAATAACACCAAAAGAACTCAAG
GGAAAAAAGTCCAGTTGGTAAATATAGAAGCTGGAAAGGCTGTGGCCGAT
GTTATTCGTACATGTCTCGGACCACGAGCAATGCTCAAAATGCTTATGGA
TCCAATGGGAGGCACTGTTATGACAAATGATGGCAATGCGATTTTGCGAG
AAATAACGGTAGAACATCCAGCTGCAAAATCCATGATTGAAATCGCTCGT
ACACAAGATGAAGAAGTTGGAGATGGGACAACATCAGTGATAATCTTAGC
TGGGGAAATGCTATGCCAAGCGGGCCCTTCATTGGAAATGCAGATTCATC
CAACGAAAATCATTTCGGCTTACAGAGAAGCACTTGAAGACATGTTAGAA
TACATGAAAAATGATTGCAGCATTGAGGCTGACACATCAAATGAAGCTGA
AATGATTAAAATTGTTAAAAGTTGCTTGGGAACTAAGTTTATCAGTAAAT
GGTCAGATATGGCATGCAAAATATCCCTGGAAGCCGTTAGACGAGTAACA
ATAGTTCAGGATGGAAGAAAAGAAATAGATATCAAGAGATTTGCTCGAAT
AGAAAAGATTCCAGGCGGAGCAATTGAAGACTGTGAAGTCCTTGATGGGG
TGATGTTCAACAAAGACCCTATACATTCACGAATGAGAAGACGAATTGAA
AACCCAAGAATATTGCTTCTAGATTGCAATCTGGAATATAAAAAAGGCGA
AAGCCAAACTGCTATTGAATTTGTCAAAGAATTGGACATGTATCGTGCCT
TAAAAATTGAAGAAGAATATATTGAAAAAATTTGTGAAGATATTATTCGA
TGCAAGCCGGACGTTGTAATCACAGAGAAATCAGTTTCAGACTATGCTCA
ACATTTTCTGATCAAGGCAAATATAACTGTAATAAGGAGAATTAGGAAGC
CCGATCAAGCAAGATTGGCCAGAGCTTGTGGAGCAACAATTGTGAACAGA
ACTGAAGAAATCAAAGAAGAGGACATTGGTACTGGAGCAGGTTTATTCGA
AGTACGCACAATTGGAGATGAATATTTCACTTATGTAACTAAATGCAAAA
ATCCAAAAGCTTGCACTATCGTTTTACGAGGAGCAAGCAAAGATATTTTA
AATGAACTTGAACGCAATTTACAAGATGCAATGAATGTTGCAAGAAATGT
TTTGTTGGAAGAACGCTTGGTTCCAGGCGGTGGAGCAGTGGAAATGGCGA
TCTCTTGCTTTTTAAAAGAGAACGTGAAAACCAAATTAAATGTTCACCAA
ATTCCTTATTTAGCTGTAGCTACTGCATTGGAAGTAATTCCTCGAACTCT
CATTCAAAATTGCGGTGGAGATGTTCTTCGAACGATTACTGAATTGCGAA
GCAAACATTCACTTGATAATCAAAAATTCGTAAATTATGGTATTGATGGC
CATAATGGCGTGATTGCTGATATGAAAGAACTAGAAATAATGGATCCATT
GCAAGTCAAGGGGCAAGTATTCAAAACTGCAATAGAAACTGCTATTCTGC
TGTTAAGAATCGACGACATTGTATCTGGAACTAAAAAGCAGTCAGCGATT
AGTGATCAAACAAATCAGAATTGAAATAAATTTAATTAAATTTAATTATT
TGTTAAAGTTCATTAATAAAATAAACATGTTGGTTTCAAAAAAAA
back to top

protein sequence of SMED30025525-orf-1

>SMED30025525-orf-1 ID=SMED30025525-orf-1|Name=SMED30025525-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=544bp
MITSGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKM
LMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVI
ILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSN
EAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRF
ARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYK
KGESQTAIEFVKELDMYRALKIEEEYIEKICEDIIRCKPDVVITEKSVSD
YAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAG
LFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVA
RNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIP
RTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIM
DPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQSAISDQTNQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR012719Chap_CCT_gamma
IPR017998Chaperone_TCP-1
IPR002423Cpn60/TCP-1
IPR027413GROEL-like_equatorial_sf
IPR027409GroEL-like_apical_dom_sf
IPR027410TCP-1-like_intermed_sf
IPR002194Chaperonin_TCP-1_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 386..406
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 7..540
NoneNo IPR availablePANTHERPTHR11353:SF24T-COMPLEX PROTEIN 1 SUBUNIT GAMMAcoord: 7..540
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 36..52
score: 33.7
coord: 58..76
score: 39.38
coord: 88..107
score: 48.99
coord: 375..397
score: 32.01
coord: 409..421
score: 44.04
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 146..406
e-value: 2.2E-173
score: 579.6
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 147..405
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 218..370
e-value: 2.2E-173
score: 579.6
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 213..380
IPR012719T-complex protein 1, gamma subunitTIGRFAMTIGR02344TIGR02344coord: 7..533
e-value: 8.0E-257
score: 850.8
IPR012719T-complex protein 1, gamma subunitCDDcd03337TCP1_gammacoord: 7..529
e-value: 0.0
score: 830.786
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 34..528
e-value: 1.0E-158
score: 529.0
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 27..526
e-value: 2.2E-173
score: 579.6
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 16..529
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00751TCP1_2coord: 60..76
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00750TCP1_1coord: 39..51
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00995TCP1_3coord: 88..96