60 kDa heat shock protein, mitochondrial

Overview
Name60 kDa heat shock protein, mitochondrial
Smed IDSMED30025522
Length (bp)1974
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60 kDa heat shock protein, mitochondrial (SMED30025522) t-SNE clustered cells

Violin plots show distribution of expression levels for 60 kDa heat shock protein, mitochondrial (SMED30025522) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60 kDa heat shock protein, mitochondrial (SMED30025522) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60 kDa heat shock protein, mitochondrial (SMED30025522) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025522

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025522SMESG000065325.1 SmedASXL_008182SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025522SMESG000065325.1 SmedASXL_008182SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30025522SMESG000065325.1 dd_Smed_v4_141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025522SMESG000065325.1 dd_Smed_v4_141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025522SMESG000065325.1 dd_Smed_v4_141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30025522SMESG000065325.1 dd_Smed_v4_141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30025522SMESG000065325.1 SMED30025522smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30025522SMESG000065325.1 SMED30025522smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30025522SMESG000065325.1 CUFF.325473.1be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025522SMESG000065325.1 isotig19365be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30025522SMESG000065325.1 dd_Smed_v6_141_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30025522SMESG000065325.1 dd_Smed_v6_141_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025522SMESG000065325.1 dd_Smed_v6_141_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30025522SMESG000065325.1 dd_Smed_v6_141_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30025522SMESG000065325.1 H.21.6hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 4 cellSMED30025522SMESG000065325.1 H.21.6hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025522SMESG000065325.1 GU591874smed_ncbi_20200123PMID:21356107
Fernández-Taboada et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 401/554 (72.38%), Postives = 478/554 (86.28%), Query Frame = 3
Query:  138 MFRIARSLRLLQ-LSKVNTLR-SCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M R+    R ++ +S+V     +  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISSIQS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFG+E  T  +E+VQ HDLG+  EV++TKDD +++KGKG    I+KRI+EI +++ ++TSEYEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPALD+L P  EDQKIGIEI+++ L  P  TIA NAGV  S++VEK+    +E+GYDAM  ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:    1 MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 401/554 (72.38%), Postives = 478/554 (86.28%), Query Frame = 3
Query:  138 MFRIARSLRLLQ-LSKVNTLR-SCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M R+    R ++ +S+V     +  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISSIQS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFG+E  T  +E+VQ HDLG+  EV++TKDD +++KGKG    I+KRI+EI +++ ++TSEYEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPALD+L P  EDQKIGIEI+++ L  P  TIA NAGV  S++VEK+    +E+GYDAM  ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:    1 MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 353.984 bits (907), Expect = 2.714e-118
Identity = 176/234 (75.21%), Postives = 204/234 (87.18%), Query Frame = 3
Query:  138 MFRIARSLRLLQ-LSKVNTLR-SCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKG 833
            M R+    R ++ +S+V     +  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G IT  DGKTL+DELE+IEGMKFDRGYISPYFINT KG
Sbjct:    1 MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVIT--DGKTLNDELEIIEGMKFDRGYISPYFINTSKG 232          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 333.954 bits (855), Expect = 1.046e-110
Identity = 166/221 (75.11%), Postives = 194/221 (87.78%), Query Frame = 3
Query:  138 MFRIARSLRLLQ-LSKVNTLR-SCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDR 794
            M R+    R ++ +S+V     +  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDR
Sbjct:    1 MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDR 221          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Match: HSPD1 (heat shock protein family D (Hsp60) member 1 [Source:HGNC Symbol;Acc:HGNC:5261])

HSP 1 Score: 191.045 bits (484), Expect = 1.521e-56
Identity = 92/108 (85.19%), Postives = 103/108 (95.37%), Query Frame = 3
Query:  207 YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISK 530
            YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISK
Sbjct:   68 YAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISK 175          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 376/552 (68.12%), Postives = 448/552 (81.16%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQN-EMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            M R+AR  + LQ + V +     YAKDVKFGAE R AMLVGV++LADAV+VTMGPKGRNVI+E+SWGSPKITKDGVTVAK I+LKDK+QN+GA+L+QDVAN  NEEAGDGTT ATVLARAIAKEGFE I +G N ++ RRGVM AV+ VVA LK +SK VTTPEEIAQVATISANGD  +G+LIS+AMKKVG  G ITVKDGKTL+DELE+IEGMKFDRGYISPYFI + KGAK E++ A +L SEKKIS +Q ++P LE+ ++ ++PL+I+AEDVDGEALT LVLNRLK+GLQV A+KAPGFGDNRKNTLKDM  ATG  +FGD++   KIE++  +DLG   EV ITKDDTL+++G+G   +I+KRIE I DEI  STS+YEKEK+ ERL+KLS GVAV+K+GG SEVEV EKKDR TDAL ATRAAVEEGIVPGGG AL+R + AL N K   EDQ+IG+ IV+KALT P  TI  NAG+  S ++++V    N   GYDA+N ++V+M E GIIDPTKVVRTAL DASGVASLL T E VVTEI KE+
Sbjct:    1 MLRLAR--KGLQTAVVRS-----YAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTTPEEIAQVATISANGDTVVGNLISDAMKKVGTTGVITVKDGKTLNDELELIEGMKFDRGYISPYFITSAKGAKVEYEKALVLLSEKKISQVQDIVPALELANKLRRPLVIIAEDVDGEALTTLVLNRLKVGLQVVAIKAPGFGDNRKNTLKDMGIATGATIFGDDSNLIKIEDITANDLGEVDEVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEKLNERLAKLSKGVAVLKIGGGSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEVTGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVRTALQDASGVASLLATTECVVTEIPKEE 545          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 376/552 (68.12%), Postives = 448/552 (81.16%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQN-EMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            M R+AR  + LQ + V +     YAKDVKFGAE R AMLVGV++LADAV+VTMGPKGRNVI+E+SWGSPKITKDGVTVAK I+LKDK+QN+GA+L+QDVAN  NEEAGDGTT ATVLARAIAKEGFE I +G N ++ RRGVM AV+ VVA LK +SK VTTPEEIAQVATISANGD  +G+LIS+AMKKVG  G ITVKDGKTL+DELE+IEGMKFDRGYISPYFI + KGAK E++ A +L SEKKIS +Q ++P LE+ ++ ++PL+I+AEDVDGEALT LVLNRLK+GLQV A+KAPGFGDNRKNTLKDM  ATG  +FGD++   KIE++  +DLG   EV ITKDDTL+++G+G   +I+KRIE I DEI  STS+YEKEK+ ERL+KLS GVAV+K+GG SEVEV EKKDR TDAL ATRAAVEEGIVPGGG AL+R + AL N K   EDQ+IG+ IV+KALT P  TI  NAG+  S ++++V    N   GYDA+N ++V+M E GIIDPTKVVRTAL DASGVASLL T E VVTEI KE+
Sbjct:    1 MLRLAR--KGLQTAVVRS-----YAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTTPEEIAQVATISANGDTVVGNLISDAMKKVGTTGVITVKDGKTLNDELELIEGMKFDRGYISPYFITSAKGAKVEYEKALVLLSEKKISQVQDIVPALELANKLRRPLVIIAEDVDGEALTTLVLNRLKVGLQVVAIKAPGFGDNRKNTLKDMGIATGATIFGDDSNLIKIEDITANDLGEVDEVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEKLNERLAKLSKGVAVLKIGGGSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEVTGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVRTALQDASGVASLLATTECVVTEIPKEE 545          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 288.886 bits (738), Expect = 4.008e-93
Identity = 149/239 (62.34%), Postives = 181/239 (75.73%), Query Frame = 3
Query: 1077 MATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQN-EMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            M  ATG  +FGD++   KIE++  +DLG   EV ITKDDTL+++G+G   +I+KRIE I DEI  STS+YEKEK+ ERL+KLS GVAV+K+GG SEVEV EKKDR TDAL ATRAAVEEGIVPGGG AL+R + AL N K   EDQ+IG+ IV+KALT P  TI  NAG+  S ++++V    N   GYDA+N ++V+M E GIIDPTKVVRTAL DASGVASLL T E VVTEI KE+
Sbjct:    1 MGIATGATIFGDDSNLIKIEDITANDLGEVDEVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEKLNERLAKLSKGVAVLKIGGGSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEVTGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVRTALQDASGVASLLATTECVVTEIPKEE 239          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 260.766 bits (665), Expect = 1.155e-80
Identity = 135/210 (64.29%), Postives = 164/210 (78.10%), Query Frame = 3
Query: 1164 AQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQN-EMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            +++V ITKDDTL+++G+G   +I+KRIE I DEI  STS+YEKEK+ ERL+KLS GVAV+K+GG SEVEV EKKDR TDAL ATRAAVEEGIVPGGG AL+R + AL N K   EDQ+IG+ IV+KALT P  TI  NAG+  S ++++V    N   GYDA+N ++V+M E GIIDPTKVVRTAL DASGVASLL T E VVTEI KE+
Sbjct:  150 SKKVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEKLNERLAKLSKGVAVLKIGGGSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEVTGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVRTALQDASGVASLLATTECVVTEIPKEE 359          

HSP 2 Score: 224.557 bits (571), Expect = 5.869e-67
Identity = 114/161 (70.81%), Postives = 133/161 (82.61%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVT 620
            M R+AR  + LQ + V +     YAKDVKFGAE R AMLVGV++LADAV+VTMGPKGRNVI+E+SWGSPKITKDGVTVAK I+LKDK+QN+GA+L+QDVAN  NEEAGDGTT ATVLARAIAKEGFE I +G N ++ RRGVM AV+ VVA LK +SK VT
Sbjct:    1 MLRLAR--KGLQTAVVRS-----YAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVT 154          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Match: hsp-60 (Chaperonin homolog Hsp-60, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P50140])

HSP 1 Score: 260.766 bits (665), Expect = 1.155e-80
Identity = 135/210 (64.29%), Postives = 164/210 (78.10%), Query Frame = 3
Query: 1164 AQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQN-EMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            +++V ITKDDTL+++G+G   +I+KRIE I DEI  STS+YEKEK+ ERL+KLS GVAV+K+GG SEVEV EKKDR TDAL ATRAAVEEGIVPGGG AL+R + AL N K   EDQ+IG+ IV+KALT P  TI  NAG+  S ++++V    N   GYDA+N ++V+M E GIIDPTKVVRTAL DASGVASLL T E VVTEI KE+
Sbjct:  150 SKKVTITKDDTLLLRGRGDQTEIEKRIEHITDEIEQSTSDYEKEKLNERLAKLSKGVAVLKIGGGSEVEVGEKKDRVTDALCATRAAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSSIIDEVTGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVRTALQDASGVASLLATTECVVTEIPKEE 359          

HSP 2 Score: 224.557 bits (571), Expect = 5.869e-67
Identity = 114/161 (70.81%), Postives = 133/161 (82.61%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVT 620
            M R+AR  + LQ + V +     YAKDVKFGAE R AMLVGV++LADAV+VTMGPKGRNVI+E+SWGSPKITKDGVTVAK I+LKDK+QN+GA+L+QDVAN  NEEAGDGTT ATVLARAIAKEGFE I +G N ++ RRGVM AV+ VVA LK +SK VT
Sbjct:    1 MLRLAR--KGLQTAVVRS-----YAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVT 154          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60A (gene:FBgn0015245 transcript:FBtr0073434)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 402/551 (72.96%), Postives = 477/551 (86.57%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            MFR+  SL    +S+   +R   YAKDV+FG E R+ ML GVD+LADAVAVTMGPKGRNVI+E+SWGSPKITKDGVTVAK IELKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKISKGANP++ RRGVM+AV+ V  +LK MS+PV+TPEEIAQVATISANGD++IG+LISEAMKKVG+DG ITVKDGKTL DELEVIEGMKFDRGYISPYFIN+ KGAK EFQDA +L SEKKISS+QS+IP LE+ + Q+KPL+I+AED+DGEAL+ LV+NRLK+GLQV AVKAPGFGDNRK+TL DMA A+GG+VFGD+A+  K+E+V++ DLG+  EV+ITKDDTL++KGKG   D+ +R  +IKD+I  +TSEYEKEK+QERL++L++GVA+++VGGSSEVEVNEKKDR  DALNATRAAVEEGIVPGGGTAL+RCI  L+ ++   EDQK+G+EIVR+AL  PC TIA NAGV+ ++VV KV +   + GYDA+  EY N+IEKGIIDPTKVVRTA+ DASGVASLLTTAE VVTEI KED
Sbjct:    1 MFRLPVSLARSSISRQLAMRG--YAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEIAQVATISANGDQAIGNLISEAMKKVGRDGVITVKDGKTLTDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALLLLSEKKISSVQSIIPALELANAQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPGFGDNRKSTLTDMAIASGGIVFGDDADLVKLEDVKVSDLGQVGEVVITKDDTLLLKGKGKKDDVLRRANQIKDQIEDTTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHDALNATRAAVEEGIVPGGGTALLRCIEKLEGVETTNEDQKLGVEIVRRALRMPCMTIAKNAGVDGAMVVAKVENQAGDYGYDALKGEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEAVVTEIPKED 549          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60A (gene:FBgn0015245 transcript:FBtr0073435)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 402/551 (72.96%), Postives = 477/551 (86.57%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            MFR+  SL    +S+   +R   YAKDV+FG E R+ ML GVD+LADAVAVTMGPKGRNVI+E+SWGSPKITKDGVTVAK IELKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKISKGANP++ RRGVM+AV+ V  +LK MS+PV+TPEEIAQVATISANGD++IG+LISEAMKKVG+DG ITVKDGKTL DELEVIEGMKFDRGYISPYFIN+ KGAK EFQDA +L SEKKISS+QS+IP LE+ + Q+KPL+I+AED+DGEAL+ LV+NRLK+GLQV AVKAPGFGDNRK+TL DMA A+GG+VFGD+A+  K+E+V++ DLG+  EV+ITKDDTL++KGKG   D+ +R  +IKD+I  +TSEYEKEK+QERL++L++GVA+++VGGSSEVEVNEKKDR  DALNATRAAVEEGIVPGGGTAL+RCI  L+ ++   EDQK+G+EIVR+AL  PC TIA NAGV+ ++VV KV +   + GYDA+  EY N+IEKGIIDPTKVVRTA+ DASGVASLLTTAE VVTEI KED
Sbjct:    1 MFRLPVSLARSSISRQLAMRG--YAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEIAQVATISANGDQAIGNLISEAMKKVGRDGVITVKDGKTLTDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALLLLSEKKISSVQSIIPALELANAQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPGFGDNRKSTLTDMAIASGGIVFGDDADLVKLEDVKVSDLGQVGEVVITKDDTLLLKGKGKKDDVLRRANQIKDQIEDTTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHDALNATRAAVEEGIVPGGGTALLRCIEKLEGVETTNEDQKLGVEIVRRALRMPCMTIAKNAGVDGAMVVAKVENQAGDYGYDALKGEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEAVVTEIPKED 549          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60C (gene:FBgn0031728 transcript:FBtr0079112)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 383/552 (69.38%), Postives = 467/552 (84.60%), Query Frame = 3
Query:  138 MFRIARSL-RLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            MFR   +L R  ++S V  L +  YAKDV+FG E R+ ML GVD+LADAVAVTMGPKGRNVI+E+SWGSPKITKDGVTVAK I LKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKIS+GA+P++ RRGVM+A++ V  +L+ +S+PV TPEEI QVATISANGD+S+G+LISEA+KKVG+DG ITVKDGKTL DELEVIEGMKFDRGYISPYFINT KGAK EFQDA +LF EKKI S  S++P LE+ + Q+KPL+I+AED++ EAL+ LV+NRLK+GLQVCAVKAPGFGDNRK  L DMA ATGG+VFGDEA   ++E++++ D GR  EV+++KDDT+++KGKG   +++KR+E +++ I  STS YEKEKMQERL++LS+GVA+++VGGSS+VEV+EKKDR  DALNATRAAVEEGIVPGGGTAL+RCI  L++LK   EDQ +GIEI+R+AL  PC TIA NAGV+ ++VV KV  +  + GYDA+  EY NMIE+GIIDPTKVVRTA+ DA+GVASLLTTAE VVTE+  E+
Sbjct:    4 MFRYTNTLQRTAKISHV--LWARNYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVGNLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDALLLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPGFGDNRKENLMDMAVATGGIVFGDEANMVRLEDIKMSDFGRVGEVVVSKDDTMLLKGKGQKAEVEKRVEGLREAIKESTSSYEKEKMQERLARLSSGVALLRVGGSSDVEVSEKKDRVIDALNATRAAVEEGIVPGGGTALLRCIQKLNDLKGANEDQNMGIEIIRRALRMPCLTIAKNAGVDGAMVVAKVEILDGDYGYDALKGEYGNMIERGIIDPTKVVRTAISDAAGVASLLTTAEAVVTELPLEE 553          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60C (gene:FBgn0031728 transcript:FBtr0079111)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 383/552 (69.38%), Postives = 467/552 (84.60%), Query Frame = 3
Query:  138 MFRIARSL-RLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            MFR   +L R  ++S V  L +  YAKDV+FG E R+ ML GVD+LADAVAVTMGPKGRNVI+E+SWGSPKITKDGVTVAK I LKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKIS+GA+P++ RRGVM+A++ V  +L+ +S+PV TPEEI QVATISANGD+S+G+LISEA+KKVG+DG ITVKDGKTL DELEVIEGMKFDRGYISPYFINT KGAK EFQDA +LF EKKI S  S++P LE+ + Q+KPL+I+AED++ EAL+ LV+NRLK+GLQVCAVKAPGFGDNRK  L DMA ATGG+VFGDEA   ++E++++ D GR  EV+++KDDT+++KGKG   +++KR+E +++ I  STS YEKEKMQERL++LS+GVA+++VGGSS+VEV+EKKDR  DALNATRAAVEEGIVPGGGTAL+RCI  L++LK   EDQ +GIEI+R+AL  PC TIA NAGV+ ++VV KV  +  + GYDA+  EY NMIE+GIIDPTKVVRTA+ DA+GVASLLTTAE VVTE+  E+
Sbjct:    4 MFRYTNTLQRTAKISHV--LWARNYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVGNLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDALLLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPGFGDNRKENLMDMAVATGGIVFGDEANMVRLEDIKMSDFGRVGEVVVSKDDTMLLKGKGQKAEVEKRVEGLREAIKESTSSYEKEKMQERLARLSSGVALLRVGGSSDVEVSEKKDRVIDALNATRAAVEEGIVPGGGTALLRCIQKLNDLKGANEDQNMGIEIIRRALRMPCLTIAKNAGVDGAMVVAKVEILDGDYGYDALKGEYGNMIERGIIDPTKVVRTAISDAAGVASLLTTAEAVVTELPLEE 553          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Match: Hsp60C (gene:FBgn0031728 transcript:FBtr0079110)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 383/552 (69.38%), Postives = 467/552 (84.60%), Query Frame = 3
Query:  138 MFRIARSL-RLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            MFR   +L R  ++S V  L +  YAKDV+FG E R+ ML GVD+LADAVAVTMGPKGRNVI+E+SWGSPKITKDGVTVAK I LKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKIS+GA+P++ RRGVM+A++ V  +L+ +S+PV TPEEI QVATISANGD+S+G+LISEA+KKVG+DG ITVKDGKTL DELEVIEGMKFDRGYISPYFINT KGAK EFQDA +LF EKKI S  S++P LE+ + Q+KPL+I+AED++ EAL+ LV+NRLK+GLQVCAVKAPGFGDNRK  L DMA ATGG+VFGDEA   ++E++++ D GR  EV+++KDDT+++KGKG   +++KR+E +++ I  STS YEKEKMQERL++LS+GVA+++VGGSS+VEV+EKKDR  DALNATRAAVEEGIVPGGGTAL+RCI  L++LK   EDQ +GIEI+R+AL  PC TIA NAGV+ ++VV KV  +  + GYDA+  EY NMIE+GIIDPTKVVRTA+ DA+GVASLLTTAE VVTE+  E+
Sbjct:    4 MFRYTNTLQRTAKISHV--LWARNYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVGNLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDALLLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPGFGDNRKENLMDMAVATGGIVFGDEANMVRLEDIKMSDFGRVGEVVVSKDDTMLLKGKGQKAEVEKRVEGLREAIKESTSSYEKEKMQERLARLSSGVALLRVGGSSDVEVSEKKDRVIDALNATRAAVEEGIVPGGGTALLRCIQKLNDLKGANEDQNMGIEIIRRALRMPCLTIAKNAGVDGAMVVAKVEILDGDYGYDALKGEYGNMIERGIIDPTKVVRTAISDAAGVASLLTTAEAVVTELPLEE 553          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: hspd1 (heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-021206-1])

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 391/529 (73.91%), Postives = 464/529 (87.71%), Query Frame = 3
Query:  207 YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKD+++NIGA+LVQDVANNTNEEAGDGTT ATVLARA+AKEGF+ ISKGANP++ RRGVMMAV+ V++ LK  SKPVTTPEEIAQVATISANGD  +G++IS AMKKVG+ G ITVKDGKTLHDELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +Q +KPL+IVAEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN L+DMA +TGG VFGDEA    +E++Q HD G+  EV++TKDDT+++KG+G    I+KR+ EI +++  + S+YEKEK+ ERL+KLS+GVAVIKVGG+S+VEVNEKKDR TDALNATRAAVEEGIVPGGG AL+RCIPALDN+KP   DQKIGI+I+R++L  P  TIA NAGV  S+VVEK+     E+GYDAMN EYVNM+E+GIIDPTKVVRTAL+DA+GVASLL+TAE VVTEI KE+K
Sbjct:   26 YAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDRYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAVAKEGFDTISKGANPVEIRRGVMMAVEEVISELKKNSKPVTTPEEIAQVATISANGDTEVGNIISNAMKKVGRKGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLQDMAVSTGGTVFGDEAMGLALEDIQAHDFGKVGEVIVTKDDTMLLKGRGDASAIEKRVNEIAEQLESTNSDYEKEKLNERLAKLSDGVAVIKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPALDNIKPANADQKIGIDIIRRSLRIPAMTIAKNAGVEGSLVVEKILQSSTEIGYDAMNGEYVNMVERGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: hspd1 (heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-021206-1])

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 391/529 (73.91%), Postives = 464/529 (87.71%), Query Frame = 3
Query:  207 YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKD+++NIGA+LVQDVANNTNEEAGDGTT ATVLARA+AKEGF+ ISKGANP++ RRGVMMAV+ V++ LK  SKPVTTPEEIAQVATISANGD  +G++IS AMKKVG+ G ITVKDGKTLHDELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +Q +KPL+IVAEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN L+DMA +TGG VFGDEA    +E++Q HD G+  EV++TKDDT+++KG+G    I+KR+ EI +++  + S+YEKEK+ ERL+KLS+GVAVIKVGG+S+VEVNEKKDR TDALNATRAAVEEGIVPGGG AL+RCIPALDN+KP   DQKIGI+I+R++L  P  TIA NAGV  S+VVEK+     E+GYDAMN EYVNM+E+GIIDPTKVVRTAL+DA+GVASLL+TAE VVTEI KE+K
Sbjct:   26 YAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDRYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAVAKEGFDTISKGANPVEIRRGVMMAVEEVISELKKNSKPVTTPEEIAQVATISANGDTEVGNIISNAMKKVGRKGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLQDMAVSTGGTVFGDEAMGLALEDIQAHDFGKVGEVIVTKDDTMLLKGRGDASAIEKRVNEIAEQLESTNSDYEKEKLNERLAKLSDGVAVIKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPALDNIKPANADQKIGIDIIRRSLRIPAMTIAKNAGVEGSLVVEKILQSSTEIGYDAMNGEYVNMVERGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 58.151 bits (139), Expect = 2.140e-8
Identity = 35/116 (30.17%), Postives = 64/116 (55.17%), Query Frame = 3
Query:  270 LADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV 617
            +ADA+  ++GPKG + +++   G   IT DG T+ K +++     +  A+++ +++   + EAGDGTT+  V+A A+     + + KG +P         AVD  V  L ++S P+
Sbjct:   38 VADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQV----LHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVLTSISTPL 149          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 52.7582 bits (125), Expect = 9.784e-7
Identity = 32/114 (28.07%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  267 ILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMS 608
            ++A+AV  T+GP+G + ++  + G   I+ DG T+ K +++     +  A+ + D+A + + E GDGTT+ T+LA    K+    + +G +P    R   +A    V  +K ++
Sbjct:   31 VVAEAVRTTLGPRGMDKLVVDNRGKATISNDGATILKLLDVV----HPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIA 140          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 50.0618 bits (118), Expect = 8.344e-6
Identity = 44/187 (23.53%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  228 GAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAM--SKPV--TTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIE 776
            G EA  + ++    +A+ +  ++GP G + ++    G   +T DG T+   +++  +     A+L+ +++ + ++E GDGTT   VLA A+ ++  + + +G +PI    G   A    +  L  +  S PV     E + Q A ++  G + I +     M ++  +  +TV D +    + E+I+
Sbjct:   30 GLEALKSHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQI----AKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTA-MTTLGSKVI-NRCHRQMAEIAVNAILTVADMERKDVDFELIK 210          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:100124945])

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 404/559 (72.27%), Postives = 477/559 (85.33%), Query Frame = 3
Query:  123 FSN*NMFRIARSLRLLQ-LSKVNTLR-SCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            FS   M RI R LR  +  S+  +L  S  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVMMAVD V+  LK  SKPVTTPEEIAQVATISANGD+ IG +IS+AMK+VG+ G ITVKDGKTLHDELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ++GGVVFG+E  T  IE++Q HD G+  EV++TKDDT+++KGKG    I+KRI+EI +++  + SEYEKEK+ ERL+KLS+GVAVIKVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPAL+ L P  EDQ++GIEI+R+ L  P  TIA NAGV  S+VVEK+     E+GYDAM+ E+VN++EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:   19 FSVLEMLRIQRILRHAKPASRALSLSLSRQYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMMAVDAVIKELKNQSKPVTTPEEIAQVATISANGDQEIGKIISDAMKRVGRRGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYLLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAISSGGVVFGEEGLTLNIEDIQPHDFGKVGEVIVTKDDTMLLKGKGDKAQIEKRIQEIHEQLESTNSEYEKEKLNERLAKLSDGVAVIKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALEALNPANEDQRVGIEIIRRTLKIPAMTIAKNAGVEGSLVVEKIIQSPVEIGYDAMHAEFVNLVEKGIIDPTKVVRTALMDAAGVASLLTTAEAVVTEIPKEEK 577          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:100124945])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 402/554 (72.56%), Postives = 475/554 (85.74%), Query Frame = 3
Query:  138 MFRIARSLRLLQ-LSKVNTLR-SCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M RI R LR  +  S+  +L  S  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVMMAVD V+  LK  SKPVTTPEEIAQVATISANGD+ IG +IS+AMK+VG+ G ITVKDGKTLHDELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ++GGVVFG+E  T  IE++Q HD G+  EV++TKDDT+++KGKG    I+KRI+EI +++  + SEYEKEK+ ERL+KLS+GVAVIKVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPAL+ L P  EDQ++GIEI+R+ L  P  TIA NAGV  S+VVEK+     E+GYDAM+ E+VN++EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:    1 MLRIQRILRHAKPASRALSLSLSRQYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMMAVDAVIKELKNQSKPVTTPEEIAQVATISANGDQEIGKIISDAMKRVGRRGVITVKDGKTLHDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYLLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAISSGGVVFGEEGLTLNIEDIQPHDFGKVGEVIVTKDDTMLLKGKGDKAQIEKRIQEIHEQLESTNSEYEKEKLNERLAKLSDGVAVIKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALEALNPANEDQRVGIEIIRRTLKIPAMTIAKNAGVEGSLVVEKIIQSPVEIGYDAMHAEFVNLVEKGIIDPTKVVRTALMDAAGVASLLTTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 57.7658 bits (138), Expect = 4.118e-8
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 3
Query:  270 LADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV--TTPEEIAQVATISAN 662
            +ADAV  ++GPKG + +++   G   IT DG T+ K +++     +  A+++ +++   + EAGDGTT+  V+A A+     + + KG +P        +A D  +  L  MS+ V  +  E +   AT S N
Sbjct:   36 VADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQV----LHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLN 164          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 57.7658 bits (138), Expect = 4.488e-8
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 3
Query:  270 LADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV--TTPEEIAQVATISAN 662
            +ADAV  ++GPKG + +++   G   IT DG T+ K +++     +  A+++ +++   + EAGDGTT+  V+A A+     + + KG +P        +A D  +  L  MS+ V  +  E +   AT S N
Sbjct:   42 VADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQV----LHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLN 170          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 57.3806 bits (137), Expect = 5.158e-8
Identity = 40/134 (29.85%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  270 LADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV--TTPEEIAQVATISANG 665
            +ADAV  ++GPKG + +++   G   IT DG T+ K +++        A+++ +++   + EAGDGTT+  V+A A+     + + KG +P        +A D  +  L  MS+ V  +  E +   AT S N 
Sbjct:   39 VADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHP----AAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNS 168          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Hspd1 (heat shock protein 1 (chaperonin) [Source:MGI Symbol;Acc:MGI:96242])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 401/554 (72.38%), Postives = 476/554 (85.92%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCT--YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M R+   LR ++          T  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFG+E     +E+VQ HDLG+  EV++TKDD +++KGKG    I+KRI+EI +++ ++TSEYEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPALD+LKP  EDQKIGIEI+++AL  P  TIA NAGV  S++VEK+    +E+GYDAM  ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:    1 MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPANEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Hspd1 (heat shock protein 1 (chaperonin) [Source:MGI Symbol;Acc:MGI:96242])

HSP 1 Score: 297.36 bits (760), Expect = 5.694e-97
Identity = 149/202 (73.76%), Postives = 172/202 (85.15%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCT--YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVK 737
            M R+   LR ++          T  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVK
Sbjct:    1 MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVK 202          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Hspd1 (heat shock protein 1 (chaperonin) [Source:MGI Symbol;Acc:MGI:96242])

HSP 1 Score: 207.223 bits (526), Expect = 2.248e-63
Identity = 98/117 (83.76%), Postives = 111/117 (94.87%), Query Frame = 3
Query:  207 YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRR 557
            YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RR
Sbjct:   26 YAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRR 142          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Cct4 (chaperonin containing Tcp1, subunit 4 (delta) [Source:MGI Symbol;Acc:MGI:104689])

HSP 1 Score: 58.9214 bits (141), Expect = 1.409e-8
Identity = 40/146 (27.40%), Postives = 76/146 (52.05%), Query Frame = 3
Query:  231 AEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV--TTPEEIAQVATISAN 662
            A+ R + +     +ADA+  ++GPKG + +++   G   IT DG T+ K +++     +  AR++ +++   + EAGDGTT+  ++A ++     + + KG +P         A++  +  L  MS+PV  +  E +   AT S N
Sbjct:   31 AQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQV----LHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLN 172          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Match: Cct2 (chaperonin containing Tcp1, subunit 2 (beta) [Source:MGI Symbol;Acc:MGI:107186])

HSP 1 Score: 55.0694 bits (131), Expect = 5.641e-8
Identity = 41/127 (32.28%), Postives = 67/127 (52.76%), Query Frame = 3
Query:  168 LQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSW--GSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
            L L+ VN  ++     D +    AR +  +G   + D V  T+GPKG + IL  S    +  +T DG T+ K+I +     N  A+++ D++   ++E GDGTT+ TVLA  + +E    I+K  +P
Sbjct:    4 LSLAPVNIFKA---GADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAALMVTNDGATILKNIGV----DNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHP 123          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|P63039|CH60_RAT (60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hspd1 PE=1 SV=1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 401/554 (72.38%), Postives = 476/554 (85.92%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCT--YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M R+   LR ++          T  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFG+E     +E+VQ HDLG+  EV++TKDD +++KGKG    I+KRI+EI +++ ++TSEYEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPALD+LKP  EDQKIGIEI+++AL  P  TIA NAGV  S++VEK+    +E+GYDAM  ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:    1 MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPANEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|P63038|CH60_MOUSE (60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 401/554 (72.38%), Postives = 476/554 (85.92%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCT--YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M R+   LR ++          T  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFG+E     +E+VQ HDLG+  EV++TKDD +++KGKG    I+KRI+EI +++ ++TSEYEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPALD+LKP  EDQKIGIEI+++AL  P  TIA NAGV  S++VEK+    +E+GYDAM  ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:    1 MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPANEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|P18687|CH60_CRIGR (60 kDa heat shock protein, mitochondrial OS=Cricetulus griseus OX=10029 GN=HSPD1 PE=2 SV=1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 401/554 (72.38%), Postives = 476/554 (85.92%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCT--YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M R+   LR ++          T  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLAR+IAKEGFEKISKGANP++ RRGVM+AVD V+A LK  SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFG+E     +E+VQ HDLG+  EV++TKDD +++KGKG    I+KRI+EI +++ ++TSEYEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIV GGG AL+RCIPALD+LKP  EDQKIGIEI+++AL  P  TIA NAGV  S++VEK+    +E+GYDAM  ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI KE+K
Sbjct:    1 MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKVGEVIVTKDDAMLLKGKGEKAQIEKRIQEITEQLEITTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPSNEDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEIGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5ZL72|CH60_CHICK (60 kDa heat shock protein, mitochondrial OS=Gallus gallus OX=9031 GN=HSPD1 PE=1 SV=1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 399/554 (72.02%), Postives = 476/554 (85.92%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCT--YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            M R+   LR ++          T  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKISKGANP++ RRGVM+AVD + A LK +SKPVTTPEEIAQVATISANGD+ IG++IS+AMKKVG+ G ITVKDGKTL+DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +  +KPL+I+AEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFG+E  +  +E++Q HD G+  EV++TKDDT+++KGKG    I+KRI+EI +++ ++TSEYEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIVPGGG AL+RCIPALD LKP  EDQKIGIEI+++ L  P  TIA NAGV  S++VEK+    +E+GYDAM  E+VNM+EKGIIDPTKVVRTAL+DA+GVASLL+TAE VVTE+ KE+K
Sbjct:    1 MLRLPAVLRQIRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVDAITAELKKLSKPVTTPEEIAQVATISANGDQEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYVLISEKKISSVQSIVPALEIANSHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLSLNVEDIQPHDFGKVGEVIVTKDDTMLLKGKGEKAQIEKRIQEIIEQLEVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPALDALKPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGEFVNMVEKGIIDPTKVVRTALMDAAGVASLLSTAEAVVTEVPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Match: sp|O02649|CH60A_DROME (Heat shock protein 60A OS=Drosophila melanogaster OX=7227 GN=Hsp60A PE=1 SV=3)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 402/551 (72.96%), Postives = 477/551 (86.57%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            MFR+  SL    +S+   +R   YAKDV+FG E R+ ML GVD+LADAVAVTMGPKGRNVI+E+SWGSPKITKDGVTVAK IELKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKISKGANP++ RRGVM+AV+ V  +LK MS+PV+TPEEIAQVATISANGD++IG+LISEAMKKVG+DG ITVKDGKTL DELEVIEGMKFDRGYISPYFIN+ KGAK EFQDA +L SEKKISS+QS+IP LE+ + Q+KPL+I+AED+DGEAL+ LV+NRLK+GLQV AVKAPGFGDNRK+TL DMA A+GG+VFGD+A+  K+E+V++ DLG+  EV+ITKDDTL++KGKG   D+ +R  +IKD+I  +TSEYEKEK+QERL++L++GVA+++VGGSSEVEVNEKKDR  DALNATRAAVEEGIVPGGGTAL+RCI  L+ ++   EDQK+G+EIVR+AL  PC TIA NAGV+ ++VV KV +   + GYDA+  EY N+IEKGIIDPTKVVRTA+ DASGVASLLTTAE VVTEI KED
Sbjct:    1 MFRLPVSLARSSISRQLAMRG--YAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEIAQVATISANGDQAIGNLISEAMKKVGRDGVITVKDGKTLTDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALLLLSEKKISSVQSIIPALELANAQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPGFGDNRKSTLTDMAIASGGIVFGDDADLVKLEDVKVSDLGQVGEVVITKDDTLLLKGKGKKDDVLRRANQIKDQIEDTTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHDALNATRAAVEEGIVPGGGTALLRCIEKLEGVETTNEDQKLGVEIVRRALRMPCMTIAKNAGVDGAMVVAKVENQAGDYGYDALKGEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEAVVTEIPKED 549          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A481NV52 (Heat shock protein 60 OS=Dugesia japonica OX=6161 GN=hsp60 PE=2 SV=1)

HSP 1 Score: 1079.7 bits (2791), Expect = 0.000e+0
Identity = 526/552 (95.29%), Postives = 547/552 (99.09%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            MFR+A SLRLL+LSKVNTLR+CTYAKDVKFGA+ARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGA+LVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDN+VASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELE+IEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTL+DMAT+TGG+VFGDEA+T+KIENVQLHDLGRAQEVLITKDDTLVMKGKG+ KDIQKRI+EI+DEIALSTSEYEKEKMQERL+KLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIP L+NLKPKTEDQKIGIEIVR+ALTTPCYTIAHNAGVNASVVVEKV SM++ MGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIK+DK
Sbjct:    1 MFRLANSLRLLKLSKVNTLRTCTYAKDVKFGADARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGAKLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNIVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEIIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLRDMATSTGGIVFGDEADTYKIENVQLHDLGRAQEVLITKDDTLVMKGKGLQKDIQKRIDEIRDEIALSTSEYEKEKMQERLAKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPGLENLKPKTEDQKIGIEIVRRALTTPCYTIAHNAGVNASVVVEKVLSMESAMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDK 552          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A3Q0KC41 (Heat shock protein HSP60, putative OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 432/529 (81.66%), Postives = 486/529 (91.87%), Query Frame = 3
Query:  204 TYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            +YAK+VKFGA+ARSAMLVGVDILADAVAVTMGPKGRNVI+E SW SPKITKDGVTVAK IELKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKISKGANPI+FRRGVM AVD VV  LK++SKP++TPEEIAQVATISANGD++IGDLI+ AMKKVG DGTITVKDGKTLHDELE IEGMKFDRGYISPYF+NT+KGA+CEFQDAF+LFSEKKI+SIQ+L+P LE+ HQQK+PLLI+AEDV+GEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMA ATGG+VFGDEA+ +K+E+VQL DLGR  EV++TKDD L+M+G+G   D+ KRI +IK+E+  S SEYEKEKM ERL+KLSNGVAVIKVGGSSEVEV+EKKDRYTDALNATRAA+EEGIVPGGGTAL+RCIP L +L+ K EDQ+ G++IV +AL+TPCYTIAHNAGVNASVVVEKV  M   MGYDA ND YV+MIE GIIDPTKVVRTALVDA+GVASLLTTAETVVT++ KE+
Sbjct:   23 SYAKEVKFGADARSAMLVGVDILADAVAVTMGPKGRNVIIESSWKSPKITKDGVTVAKGIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPIEFRRGVMSAVDAVVKELKSLSKPISTPEEIAQVATISANGDKAIGDLIATAMKKVGNDGTITVKDGKTLHDELEFIEGMKFDRGYISPYFLNTEKGARCEFQDAFVLFSEKKINSIQTLLPALELCHQQKRPLLIIAEDVEGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMAVATGGIVFGDEADMYKLEDVQLQDLGRVAEVVVTKDDCLLMRGRGSKTDVDKRIAQIKEEMEASNSEYEKEKMHERLAKLSNGVAVIKVGGSSEVEVSEKKDRYTDALNATRAAIEEGIVPGGGTALLRCIPILKSLESKNEDQRTGVQIVLRALSTPCYTIAHNAGVNASVVVEKVMGMGQNMGYDAQNDAYVDMIEAGIIDPTKVVRTALVDAAGVASLLTTAETVVTDLPKEE 551          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A4Z2DXW1 (60 kDa heat shock protein OS=Schistosoma japonicum OX=6182 GN=EWB00_000948 PE=3 SV=1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 438/551 (79.49%), Postives = 488/551 (88.57%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            M R   SLR   +     +    YAK+VKFGA+ARSAML+GVD+LADAVAVTMGPKGRNVI+E SW SPKITKDGVTVAK IELKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKISKGANPI+FRRGVM+AVD VV  LK+ SK ++TPEEIAQVATISANGD++IGDLI+ AMK+VG DGTITVKDGKTLHDELE IEGMKFDRGYISPYFINT+KGA+CEFQDAFILFSEKKI+SIQ+L+P LE+ HQQK+PLLI+AEDV+GEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMA ATGG+VFGDEA+ +K+E+VQL DLGR  E +ITKDD L+M+G+G   DI KRI +IKDE+  S SEYEKEKM ERL+KLSNGVAVIKVGGSSEVEV+EKKDRYTDALNATRAA+EEGIVPGGGTAL+RCIP LD L  K EDQ+ G+ IV +AL+TPCYTIAHNAGVNASVVVEKV  M   MGYDA ND YV+MIE GIIDPTKVVRTALVDA+GVASLLTTAETVVT++ KE+
Sbjct:    1 MLRALSSLRGSLVPARQKVVQRFYAKEVKFGADARSAMLIGVDVLADAVAVTMGPKGRNVIIESSWKSPKITKDGVTVAKGIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPIEFRRGVMLAVDAVVKELKSFSKQISTPEEIAQVATISANGDKAIGDLIASAMKRVGNDGTITVKDGKTLHDELEFIEGMKFDRGYISPYFINTEKGARCEFQDAFILFSEKKINSIQTLLPALELCHQQKRPLLIIAEDVEGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMAVATGGIVFGDEADMYKLEDVQLQDLGRVSEAVITKDDCLLMRGRGNKMDIDKRIAQIKDEMEASNSEYEKEKMHERLAKLSNGVAVIKVGGSSEVEVSEKKDRYTDALNATRAAIEEGIVPGGGTALLRCIPVLDTLSTKNEDQRTGVRIVLRALSTPCYTIAHNAGVNASVVVEKVKGMSQNMGYDAQNDVYVDMIEAGIIDPTKVVRTALVDAAGVASLLTTAETVVTDLPKEE 551          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A183K6N7 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10662 PE=3 SV=1)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 438/559 (78.35%), Postives = 496/559 (88.73%), Query Frame = 3
Query:  117 ICFSN*NMFRIARSLR-LLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            +C+    M R   + R  L  ++   +R  +YAK+VKFGA+ARSAMLVGVDILADAVAVTMGPKGRNVI+E SW SPKITKDGVTVAK IELKDKFQNIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGFEKISKGANPI+FRRGVM AVD VV  LK++SKP++TPEEIAQVATISANGD++IGDLI+ AMKKVG DGTITVKDGKTLHDELE IEGMKFDRGYISPYF+NT+KGA+CEFQDAF+LFSEKKI+SIQ+L+P LE+ HQQK+PLLI+AEDV+GEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMA ATGG+VFGDEA+ FK+E+VQL DLGR  EV++TKDD L+M+G+G   D+ KRI +IK+E+  S SEYEKEKM ERL+KLSNGVAVIKVGGSSEVEV+EKKDRYTDALNATRAA+EEGIVPGGGTAL+RCIP L  L+ K EDQ+ G++IV +AL+TPCYTIAHNAGVNASVVVEKV  M   MGYDA ND YV+MI  GIIDPTKVVRTALVDA+GVASLLTTAETVVT++ KE+
Sbjct:   26 LCYLPVTMLRAFATFRGTLAPARHRIIRR-SYAKEVKFGADARSAMLVGVDILADAVAVTMGPKGRNVIIESSWKSPKITKDGVTVAKGIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPIEFRRGVMSAVDAVVKELKSLSKPISTPEEIAQVATISANGDKAIGDLIATAMKKVGNDGTITVKDGKTLHDELEFIEGMKFDRGYISPYFLNTEKGARCEFQDAFVLFSEKKINSIQTLLPALELCHQQKRPLLIIAEDVEGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMAVATGGLVFGDEADMFKLEDVQLQDLGRVAEVVVTKDDCLLMRGRGSKTDVDKRIAQIKEEMEASNSEYEKEKMHERLAKLSNGVAVIKVGGSSEVEVSEKKDRYTDALNATRAAIEEGIVPGGGTALLRCIPVLKCLETKNEDQRTGVQIVLRALSTPCYTIAHNAGVNASVVVEKVMGMGPNMGYDAQNDVYVDMINAGIIDPTKVVRTALVDAAGVASLLTTAETVVTDLPKEE 583          
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Match: A0A0R3U1G1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS198 PE=3 SV=1)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 444/578 (76.82%), Postives = 505/578 (87.37%), Query Frame = 3
Query:   60 LISRINLFKIIFITTYF*N-ICFSN*NMFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            LISR+    ++++   F N + F+   M R A S R       + +R    AKDVKFGAEAR+AMLVGVDILADAVAVTMGPKGRNVILE  W SPKITKDGVTVAK IELKDKFQNIGA+LVQDVANN NEEAGDGTT ATVLARAIAKEGFEKISKGANPI+FRRGVMMAVD VV  LK MS+PVTTPEE+AQVATISANGD SIGDLIS+AMK+VG DGTITVKDGKTLHDE+E IEGMKFDRGYISPYFINTDKGA+CEFQD ++LF EKKI++IQ L+PVLEM HQ K+PL+IVAEDV+GEALTALVLNRLK+GLQVCAVKAPGFGDNRKNTL+DMA A+GGVVFGDEA+ +K+ENVQLHDLGR  E +ITKDDTL M+G+G  ++++KRI +I+DEI++STS+YEKEKMQER++KLSNGVAVIKVGGSSEVEV+EKKDRYTDALN+TRAAVEEGIVPGGGTAL+RCIP LD ++ K +DQ+IGI+IV++AL TP YTIAHNAGVNASVVV+K+  M    GYDAMND+YV+MI  GIIDPTKVVRTALVDASGVASLLTTAE VV +I KED
Sbjct:    4 LISRV----VVYVYQSFWNGVHFT---MLRAALSQRFAGSVCKSVIRG--LAKDVKFGAEARAAMLVGVDILADAVAVTMGPKGRNVILESQWRSPKITKDGVTVAKGIELKDKFQNIGAKLVQDVANNANEEAGDGTTTATVLARAIAKEGFEKISKGANPIEFRRGVMMAVDVVVKHLKEMSRPVTTPEEVAQVATISANGDTSIGDLISDAMKRVGNDGTITVKDGKTLHDEIEFIEGMKFDRGYISPYFINTDKGARCEFQDCYVLFCEKKINNIQVLVPVLEMIHQHKRPLVIVAEDVEGEALTALVLNRLKVGLQVCAVKAPGFGDNRKNTLRDMAIASGGVVFGDEADMYKLENVQLHDLGRVGEAIITKDDTLFMRGQGKKEEVEKRIAQIRDEISVSTSDYEKEKMQERVAKLSNGVAVIKVGGSSEVEVSEKKDRYTDALNSTRAAVEEGIVPGGGTALLRCIPVLDGIEVKNKDQQIGIDIVKRALETPAYTIAHNAGVNASVVVQKIMGMSQNEGYDAMNDKYVDMIAAGIIDPTKVVRTALVDASGVASLLTTAEAVVCDIPKED 572          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:103043207])

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 391/530 (73.77%), Postives = 464/530 (87.55%), Query Frame = 3
Query:  204 TYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            +YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGA+LVQDVANNTNEEAGDGTT ATVLARAIAKEGF+ ISKGANP++ RRGVM+AV+ ++  LK +SKPVTTPEEIAQVATISANGD  +G +IS AMKKVG+ G ITVKDGKTLHDELE+IEG+KFDRGYISPYFINT KG KCEFQDA+IL SEKKISS+QS++P LE+ +Q +KPL+IVAEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN L+DMA A GG VFGDEA    +E++Q HD GR  EV++TKDDT+++KG+G    I+KR+ EI +++  +TS+YEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIVPGGG AL+RCIPALD +KP  +DQKIGI+I+R+AL  P  TIA NAGV  S+VVEK+     E+GYDA+N EYVNM+E+GIIDPTKVVRTAL+DA+GVASLL+TAE VVTEI KE+K
Sbjct:   25 SYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFDTISKGANPVEIRRGVMLAVETIIEELKKLSKPVTTPEEIAQVATISANGDTEVGTIISNAMKKVGRKGVITVKDGKTLHDELEIIEGLKFDRGYISPYFINTTKGQKCEFQDAYILLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLQDMAIAAGGAVFGDEATGLALEDIQAHDFGRVGEVVVTKDDTMLLKGRGDPAAIEKRVAEIAEQLESTTSDYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGLALLRCIPALDTIKPINDDQKIGIDIIRRALRIPAMTIAKNAGVEGSLVVEKILQSNAEIGYDALNGEYVNMVERGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 61.2326 bits (147), Expect = 2.238e-9
Identity = 36/116 (31.03%), Postives = 64/116 (55.17%), Query Frame = 3
Query:  270 LADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV 617
            +ADA+  ++GPKG + +++   G   IT DG T+ K +++        A+++ +++   + EAGDGTT+  V+A A+     + + KG +P         AVD  V  L ++S+PV
Sbjct:   38 VADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHP----AAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTSISQPV 149          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:103036471])

HSP 1 Score: 54.6842 bits (130), Expect = 1.784e-7
Identity = 40/127 (31.50%), Postives = 66/127 (51.97%), Query Frame = 3
Query:  168 LQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSW--GSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
            + ++ VN  +   +  D +    AR +  +G   + D V  T+GPKG + IL      GS  +T DG T+ K I +     N  A+++ D++   ++E GDGTT+ TVLA  + +E    I+K  +P
Sbjct:    1 MSMAPVNIFK---HGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLGGGREGSVTVTNDGATILKAIGV----DNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHP 120          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:103036471])

HSP 1 Score: 54.299 bits (129), Expect = 2.826e-7
Identity = 40/127 (31.50%), Postives = 66/127 (51.97%), Query Frame = 3
Query:  168 LQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSW--GSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
            + ++ VN  +   +  D +    AR +  +G   + D V  T+GPKG + IL      GS  +T DG T+ K I +     N  A+++ D++   ++E GDGTT+ TVLA  + +E    I+K  +P
Sbjct:    4 MSMAPVNIFK---HGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLGGGREGSVTVTNDGATILKAIGV----DNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHP 123          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:103028526])

HSP 1 Score: 53.9138 bits (128), Expect = 4.162e-7
Identity = 33/120 (27.50%), Postives = 62/120 (51.67%), Query Frame = 3
Query:  258 GVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV 617
               ++A+AV  T+GP+G + ++  + G   I+ DG T+ K +++        A+ + D+A + + E GDGTT+ T+LA    K+    + +G +P    R   +A    V  +K ++  V
Sbjct:   26 ACQVIAEAVRTTLGPRGMDKLIVDNRGKATISNDGATILKLLDVVHP----AAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIAVTV 141          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: hspd1 (heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-021206-1])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 299/410 (72.93%), Postives = 355/410 (86.59%), Query Frame = 3
Query:  138 MFRI---ARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRG-VMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGG 1355
            M R+   ARSLR +  +      +  YAKDV+FG+EAR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK IELKD+F+NIGA+LVQDVANNTNEEAGDGTT ATVLARAIAK+GFEKISKGANP++ RR   M+AV+ VVA LK +SKPVTTPEEIAQVATISANGD+ IG+LIS+AMKKVG+ G ITVKDGKTLH+EL++IEG+KFDRGYISPYFIN+ KG KCEFQDAF+L SEKKISS+QS++P LE+ + Q+KPL+I+AEDVDGEAL+ LVLNRLK+GLQVCAVKAPGFGDNRKNTLKD+A ATGG VFGDEA +  +E+VQLHD GR  EV ITKDDT+V+KGKG    I+KRIEEI +++  +TS+YEKEK+ ERL+KLS+GVAV+KV G
Sbjct:    1 MLRVPALARSLRPVTRALAPPRGTRAYAKDVRFGSEARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIELKDRFKNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKDGFEKISKGANPVEIRREESMLAVEAVVAELKKLSKPVTTPEEIAQVATISANGDKEIGNLISDAMKKVGRKGVITVKDGKTLHNELQIIEGLKFDRGYISPYFINSAKGQKCEFQDAFLLISEKKISSVQSIVPALELANAQRKPLVIIAEDVDGEALSTLVLNRLKVGLQVCAVKAPGFGDNRKNTLKDLAVATGGTVFGDEALSVNVEDVQLHDFGRVGEVTITKDDTMVLKGKGERAAIEKRIEEIVEQLEATTSDYEKEKLNERLAKLSDGVAVLKVSG 410          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 60.8474 bits (146), Expect = 5.295e-10
Identity = 38/117 (32.48%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  267 ILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV 617
            ++ADAV  T+GP+G + ++    G   I+ DG T+ K +E+       G  LV D+A + + E GDGTT+ T+LA  + K+  + + +G +P    R    A    +  +K +S PV
Sbjct:   30 VVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEV---VHPAGKTLV-DIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIKEISVPV 142          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 60.077 bits (144), Expect = 9.938e-10
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  231 AEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV 617
            A  RS+ +     +ADA+  ++GPKG + +++   G   IT DG T+ K +++        A+++ +++   + EAGDGTT+  V+A A+     + + KG +P         A++     L++MS P+
Sbjct:   38 AMIRSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHP----AAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILESMSLPL 162          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 2.318e-9
Identity = 42/130 (32.31%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  165 LLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPK----ITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
            ++ L+ +N L+S     D +    AR +  +G   + D V  T+GPKG + IL  S  S +    +T DG T+ K I +     N  A+++ D++   ++E GDGTT+ TVLA  + +E    I+K  +P
Sbjct:    1 MVSLAPINILKS---GADEEKAETARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGV----DNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHP 123          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 53.1434 bits (126), Expect = 1.336e-7
Identity = 40/173 (23.12%), Postives = 83/173 (47.98%), Query Frame = 3
Query:  228 GAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAM--SKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKD 740
            G +A  + ++    +A  +  ++GPKG + ++    G   +T DG T+   ++++ +     A+L+ +++ + ++E GDGTT   VLA A+ ++  + + +G +PI    G   A    +A L ++  S PV      + V T        I +     M ++  +  ++V D
Sbjct:   30 GLDALKSHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQV----AKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVAD 198          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: HSP60 (Tetradecameric mitochondrial chaperonin; required for ATP-dependent folding of precursor polypeptides and complex assembly; prevents aggregation and mediates protein refolding after heat shock; role in mtDNA transmission; phosphorylated [Source:SGD;Acc:S000004249])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 306/531 (57.63%), Postives = 402/531 (75.71%), Query Frame = 3
Query:  195 RSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTS-EYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNE---MGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTE 1775
            R+ +  K++KFG E R+++L GV+ LA+AVA T+GPKGRNV++E+ +G PKITKDGVTVAK I LKDKF+N+GA+L+Q+VA+ TNE AGDGTT+ATVL RAI  E  + ++ G NP+D RRG  +AV+ V+  L A  K +TT EEIAQVATISANGD  +G L++ AM+KVGK+G IT+++G+TL DELEV EGM+FDRG+ISPYFI   K +K EF+   +L SEKKISSIQ ++P LE+++Q ++PLLI+AEDVDGEAL A +LN+L+  ++VCAVKAPGFGDNRKNT+ D+A  TGG VF +E +  K E   + +LG    + +TK+DT+++ G G  + IQ+RIE+IK  I ++T+  YEKEK+QERL+KLS GVAVI+VGG+SEVEV EKKDRY DALNATRAAVEEGI+PGGGTAL++    LD +     DQK+G++I+RKA+T P   I  NAG   SV++ K+     +    GYDA   EY +M+  GIIDP KVVR+ LVDASGVASLL T E  + +
Sbjct:   19 RAYSSHKELKFGVEGRASLLKGVETLAEAVAATLGPKGRNVLIEQPFGPPKITKDGVTVAKSIVLKDKFENMGAKLLQEVASKTNEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQVAVEKVIEFLSANKKEITTSEEIAQVATISANGDSHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPLLLLSEKKISSIQDILPALEISNQSRRPLLIIAEDVDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNTIGDIAVLTGGTVFTEELD-LKPEQCTIENLGSCDSITVTKEDTVILNGSGPKEAIQERIEQIKGSIDITTTNSYEKEKLQERLAKLSGGVAVIRVGGASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALVKASRVLDEVVVDNFDQKLGVDIIRKAITRPAKQIIENAGEEGSVIIGKLIDEYGDDFAKGYDASKSEYTDMLATGIIDPFKVVRSGLVDASGVASLLATTEVAIVD 548          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: TCM62 (Protein involved in assembly of the succinate dehydrogenase complex; mitochondrial; putative chaperone [Source:SGD;Acc:S000000248])

HSP 1 Score: 72.7886 bits (177), Expect = 6.392e-14
Identity = 92/404 (22.77%), Postives = 174/404 (43.07%), Query Frame = 3
Query:  648 TISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRG-------YISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKP-LLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEI--ALSTSEYEKEKMQERLSK--LSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRA-AVEEGIVPGGGTALIRCIPALDNLKPKTED--QKIGIEIVRKALTTPCYTIAHNA-GVN--------ASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKE 1787
            T+S++  +SI  ++     ++  D  + V +G   +DE++V +G K+  G       Y+    + T K    + +D  +L  +  +     ++P +    + +K  LLIV  D  G+ALT++ +N                 ++R   LK    A       D A    ++ ++   L    + + + + + ++  K         IE IK     A   +  + E +  ++ K  L N V  + +GG +E+E++ +++   + LN      + +G +PG G +L++ IP L+ LK    +   K+GI  V  A+  P      NA G N        A  + EK F M       + N E VN ++ G ++P   + + L        LLT+  T++T + K+
Sbjct:  182 TMSSSDSQSIKRVLKAINYELFSDDIVRVINGNKTYDEVDVSKGWKYPAGILDSNEAYLRSLELPTKKLVSID-KDMLVLMYDGTLRDANKILPTITYARKLRKSVLLIVNGDCTGDALTSVTINN--------NRNKRENNESRIVVLKYSKKANN-----DLAPQENLDFIKFLRLPCGYDSIYSPEYSPLVPSKMCADKYYGSIESIKATTGEAFLYNSIDAEAIPNKVPKSFLQNTVT-LSIGGHNEIEIDRRRNAIDNCLNNVLCHGLAKGFIPGYGISLLKAIPGLNELKANEPNFMTKVGINAVLSAVILPSEVAFKNAYGYNYYEINSLIAGAINEKSFPMAKF----SPNSEPVNTVKDGNLEPWSKMDSCLAGVETFIELLTSCNTIITCVYKK 566          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 70.0922 bits (170), Expect = 5.242e-13
Identity = 133/557 (23.88%), Postives = 231/557 (41.47%), Query Frame = 3
Query:  222 KFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDEL------EVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVL------NRLKLGLQVCAV----KAPGF-GDNRKNTLKDMATATGGVV-----FGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEI-KDEIALSTSEYEKE--KMQERL-----SKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEG-IVPGGGTALIRCIPALDNLKPKTEDQKIGIEI-----VRKALTTPCYTIAHNAGVNASVVVEKVFSMQ-----NEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVV 1769
            + G EA+ + ++    +A  +  ++GP+G + IL    G   IT DG T+   +EL ++     A+L+  ++ + ++E GDGTT   VLA A+  +  E I KG +PI    G   A    ++ L          EE      ISA+ D    D +  A  K      I  KD    HD         VI  M  DR  +    I           D+ +         I  +I   + +H Q    ++  E  DG  L  L         + K  L + +V    K   +  D  K  + D+  A   VV     F DEA    ++N    DL   + V   + + + +   G    I  R +++ KD++   +  YE+E    ++R+     SK +  V    V GS+++ V+E +    D+L   R  V++  +V GGG A +    A+     +  D++ GI+        +AL T   T+A N+G++    +  + S Q     + +G D +     +M E  ++DP    +  ++ A+ +  ++   + V+
Sbjct:   41 QHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI----AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKL----------EETCD--DISASNDELFRDFLLRA-AKTSLGSKIVSKD----HDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKL---------INGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQN----DLPAVRWVGGQELEHIAISTNG---RIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCF-VRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVS----EEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVI 555          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 55.4546 bits (132), Expect = 1.846e-8
Identity = 32/103 (31.07%), Postives = 57/103 (55.34%), Query Frame = 3
Query:  234 EARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
            E R A ++    +ADA+  ++GPKG + +++ S G   I+ DG T+ K + +        AR++ +V+   + EAGDGTT+  +L  A+       ++KG +P
Sbjct:   19 EVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPV----ARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHP 117          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Match: CCT2 (Subunit beta of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000001404])

HSP 1 Score: 52.7582 bits (125), Expect = 1.134e-7
Identity = 32/93 (34.41%), Postives = 53/93 (56.99%), Query Frame = 3
Query:  237 ARSAMLVGVDILADAVAVTMGPKGRNVILEK-SWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEG 512
            AR +  VG   + D V  T+GPKG + +L+  S  +  +T DG T+ K I L     N  A+++ +++   ++E GDGTT+ TVL+  + +E 
Sbjct:   18 ARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPL----DNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREA 106          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO49030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHS7])

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 384/547 (70.20%), Postives = 464/547 (84.83%), Query Frame = 3
Query:  150 ARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKED 1790
            ARSL     +  +T R     K++KFGAEAR+AML GVD LADAVAVT+GPKG+NVI+E+S+G PKITKDGVTVAK IELKDK+QNIGARLVQDVANNTNEEAGDGTT ATVLAR+IA EGF  +SKGANP + RRGVM AVD+VV SLK MSKPVTTPEEIAQVATISANGD++IG+LIS AMK+VGK+G ITVKDGKTL DELEVIEGMKFDRGYISPYFIN+ KG K EFQD  +L  +KKISS+Q ++P LE+ +  +KPL+I+AEDVDGEALT LVLNRLK+GLQ+ AVKAPGFGDNRKN L+DMA +TGG+VFGD+A   K+E++ + D G   E+ ITKDDT++++GKG   +I KR E+I+DE+  + S+YEKEK  ERL+KLS+GVA++KVGGSSEVEVNEKKDR TDALNATRAAVEEGIVPGGG AL+RC+PAL+++K  ++DQ++G+++V+KAL  PC TIA NAGV A++VVEKV S++N MGYDA N+ YV+MI+ GIIDPTKVVRTA+ DA+GVASLLTTAETV+ E  KE+
Sbjct:   17 ARSLAPRLAASFSTSRFQNSPKELKFGAEARAAMLQGVDTLADAVAVTLGPKGKNVIIEQSFGGPKITKDGVTVAKAIELKDKYQNIGARLVQDVANNTNEEAGDGTTTATVLARSIATEGFLHVSKGANPQEVRRGVMCAVDSVVESLKKMSKPVTTPEEIAQVATISANGDKNIGELISSAMKRVGKNGVITVKDGKTLRDELEVIEGMKFDRGYISPYFINSSKGQKVEFQDCLLLLCQKKISSVQQIVPALELANSHRKPLVIIAEDVDGEALTTLVLNRLKVGLQIAAVKAPGFGDNRKNMLQDMAVSTGGMVFGDDAIETKLEDITIQDFGEVGEISITKDDTILLRGKGNADEIAKRCEQIRDELESTNSDYEKEKFNERLAKLSDGVAILKVGGSSEVEVNEKKDRVTDALNATRAAVEEGIVPGGGVALLRCVPALNDIKMPSKDQQLGVDLVKKALRKPCQTIAENAGVEAALVVEKVSSLENAMGYDAANNTYVDMIQAGIIDPTKVVRTAITDAAGVASLLTTAETVIVEAPKEE 563          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO27990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7R0])

HSP 1 Score: 335.88 bits (860), Expect = 1.326e-110
Identity = 169/324 (52.16%), Postives = 234/324 (72.22%), Query Frame = 3
Query:  504 KEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV-TTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRC 1472
            KEG + ++ GANP+D +RG+  AV ++V  L   SK V  + E+I QVA ISAN D +IGDLI++A  KVGK+G ITV++ K +   ++V+EGM+FDRGY+SPYF+        + ++ +IL  +KKIS++Q ++P+LE   Q  +PLLI+AEDVDG+AL  LV+N+L+ GL++ AVKAPGFGD RK  L+D+A  TGG V  +E   F +EN  L  LG A+ V I KD+T ++ G G  + I+ R+ +IK +I  +TS+Y+KEK+QERL+KL+ GVAV+ VG +SEVE+ EKKDR  DAL+ATRAAVEEGIV GGG AL+R 
Sbjct:    2 KEGLKNVAAGANPMDLKRGIDKAVTSIVEDLDKQSKKVGNSSEKIKQVAAISANNDDTIGDLIAQAFSKVGKEGVITVEEAKGMETYVDVVEGMQFDRGYLSPYFVTDADKMVADLENPYILLFDKKISNLQEILPILEPVAQSSRPLLIIAEDVDGQALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEE-RGFSLENATLDLLGTAETVTIDKDNTTIVNGSGDAEAIKARVNQIKAQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRA 324          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO34981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT1])

HSP 1 Score: 60.4622 bits (145), Expect = 1.252e-9
Identity = 125/551 (22.69%), Postives = 229/551 (41.56%), Query Frame = 3
Query:  237 ARSAMLVGVDILADAVAVTMGPKGRNVILEK--SWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP----IDFRRGV-MMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMK-------FDRGYISPYFINTDKGAKCEFQDAFILFSEK-----KISSIQSLIPV--------LEMTHQQK---KPLLIVAEDVDGEALTALVLN---RLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETF-KIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEG-IVPGGGTALIRCIPALDNLKPKTEDQK-IGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQ----NEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVV 1769
            AR +  VG   + D V  T+GPKG + IL+     G+ ++T DG T+ K I +     N  A+++ +++   ++E GDGTT+ TVL   + KE  + +S   +P      +R+ V         A++   S P    E++  +A  + +    +     +   K+  D  + +K    L + +++I+ +         D G++    I  ++  K E  +A IL +       KI    S + V        LEM  +QK   K  +I+  D++      L+ N   +L     V A++   F       ++ +A  TGG +      TF + + V+L    + +EV+I +D  +   G                                    L+    V+  G + ++ ++E +    DAL      V+E   V GGG + +    A+  L  KT  ++   +E    AL      IA NAG +++ +V K+ +      N  G + +N    +M + GI +  +V R  L+ A+  A ++   + +V
Sbjct:   22 ARLSSFVGAIAIGDLVKSTLGPKGMDKILQSFGQNGNIQVTNDGATILKSIGI----DNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALEAAAVDHSSDPEKFREDLMNIARTTLSSKILVQH--RDHFAKLAVDAVLRLKGSGDL-NAIQIIKKLGGGMVDSFLDEGFLLDKKIGVNQPKKIE--NAKILIANTPMDADKIKVFGSRVRVDSTAKIADLEMAEKQKMKEKVEMIIKHDINCFINRQLIYNYPEQLFADAGVMAIEHADF-----EGVERLALVTGGEIV----STFGRPDLVKLGTCKKIEEVMIGEDKLIHFSG----------------------------------CALNEACTVVIRGATQQI-LDEAERSLHDALCVLTQTVKETRTVNGGGASEVLMAHAVSQLAAKTPGKEAAAMESFATALRQLPTIIADNAGYDSADLVAKLRAAHTQGKNTYGLNMVNGTVGDMRDLGITESYQVKRQVLLSAAEAAEMIVRVDNIV 519          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO27411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B6])

HSP 1 Score: 53.5286 bits (127), Expect = 1.775e-7
Identity = 55/225 (24.44%), Postives = 100/225 (44.44%), Query Frame = 3
Query:  228 GAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTP------------EEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAK-----CEFQ 851
            G EA+ + ++    +A  +  ++GPKG + ++    G   +T DG T+   +E+  +     A+L+ +++ + + E GDGTT   VLA A+ +   + +  G +PI    G  +A    +  + +++     P             EIA  A +S   D    D+  E +K  GK+G      GK   D+  +++G+  D+    P      K AK     C F+
Sbjct:   24 GLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQI----AKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPLPLGYSVSRCHRPLAEIAVDAVLSV-ADLERKDVDFELIKVEGKEG------GKL--DDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFE 235          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Match: EDO34983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT4])

HSP 1 Score: 52.373 bits (124), Expect = 4.297e-7
Identity = 34/99 (34.34%), Postives = 55/99 (55.56%), Query Frame = 3
Query:  252 LVGVDILADAVAVTMGPKGRNVILEK--SWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
             VG   + D V  T+GPKG + IL+     G  ++T DG T+ K I +     N  A+++ +++   ++E GDGTT+ TVLA  + KE  + +S   +P
Sbjct:    3 FVGAIAIGDLVKSTLGPKGMDKILQSFGQNGDIQVTNDGATILKAIGI----DNPAAKILVELSKVQDDEVGDGTTSVTVLASELLKEAEKLVSCKIHP 97          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: hspd1 (heat shock protein family D (Hsp60) member 1 [Source:NCBI gene;Acc:101163801])

HSP 1 Score: 813.527 bits (2100), Expect = 0.000e+0
Identity = 397/554 (71.66%), Postives = 469/554 (84.66%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCT--YAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            MFR+A  +R ++          T  YAKDVKFGA+AR+ ML GVD+LADAVAVTMGPKGR VI+E+SWGSPK+TKDGVTVAK I+LKDK++NIGARLVQDVANNTNEEAGDGTT ATVLARAIAKEGF+ ISKGANP++ RRGVMMAV+ V+  L+ +SKPVTTPEEIAQVATISANGD  IG++IS AMKKVG+ G ITVKDGKTL DELE+IEGMKFDRGYISPYFINT KG KCEFQDA++L SEKKISS+QS++P LE+ +Q +KPL+IVAEDVDGEAL+ LVLNRLK+GLQV AVKAPGFGDNRKN LKDMA ATGG VFGDEA    +E++Q HD G+  EV ITKDDTL+++G G   D++KR  EI +++  +TS+YEKEK+ ERL+KLS+GVAV+KVGG+S+VEVNEKKDR TDALNATRAAVEEGIVPGGG AL+RCIP LD LK    DQKIG++I+R++L  P  TIA NAGV+ S+VVE++     E+GYDAM  EYVNM+EKGIIDPTKVVRTAL+DA+GVASLL+TAE VVTE+ KE+K
Sbjct:    1 MFRLATVMRQVRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGARLVQDVANNTNEEAGDGTTTATVLARAIAKEGFDNISKGANPVEIRRGVMMAVEAVIGELQRLSKPVTTPEEIAQVATISANGDTEIGNIISNAMKKVGRKGVITVKDGKTLQDELEIIEGMKFDRGYISPYFINTAKGQKCEFQDAYLLLSEKKISSVQSIVPALEIANQHRKPLVIVAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAVATGGTVFGDEALGLALEDIQAHDFGKVGEVQITKDDTLLLRGGGNPADVEKRAAEIAEQLESTTSDYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPFLDTLKAANSDQKIGVDIIRRSLRIPAMTIAKNAGVDGSLVVERILQGGAELGYDAMQGEYVNMVEKGIIDPTKVVRTALMDAAGVASLLSTAEAVVTELPKEEK 554          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 63.5438 bits (153), Expect = 3.440e-10
Identity = 39/129 (30.23%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  231 AEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV 617
            A+ R + +     +ADAV  ++GPKG + +++   G   IT DG T+ K +++     +  A+++ +++   + EAGDGTT+  ++A A+ +   + + KG +P         AVD  V  L  MS+PV
Sbjct:   28 AQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQV----LHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSRPV 152          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:101158813])

HSP 1 Score: 57.3806 bits (137), Expect = 3.676e-8
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 3
Query:  168 LQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSW--GSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
            L ++ VN  RS     D +    AR +  VG   + D V  T+GPKG + IL      G+  +T DG T+ K I +     N  A+++ D++   ++E GDGTT+ TVLA  + +E    I+K  +P
Sbjct:    4 LSMAPVNIFRS---GADEEKAETARLSSFVGAIAIGDLVKSTLGPKGMDKILLSGGKSGTVTVTNDGATILKAIGV----DNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHP 123          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:101158813])

HSP 1 Score: 55.0694 bits (131), Expect = 1.398e-7
Identity = 42/125 (33.60%), Postives = 65/125 (52.00%), Query Frame = 3
Query:  174 LSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSW--GSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANP 542
            ++ VN  RS     D +    AR +  VG   + D V  T+GPKG + IL      G+  +T DG T+ K I +     N  A+++ D++   ++E GDGTT+ TVLA  + +E    I+K  +P
Sbjct:    1 MAPVNIFRS---GADEEKAETARLSSFVGAIAIGDLVKSTLGPKGMDKILLSGGKSGTVTVTNDGATILKAIGV----DNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHP 118          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:101173660])

HSP 1 Score: 51.2174 bits (121), Expect = 3.075e-6
Identity = 31/117 (26.50%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  267 ILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPV 617
            ++A+AV  T+GP+G + ++  + G   I+ DG T+ K +++     +  A+ + D+A + + E GDGTT+ T+LA    ++    + +  +P    R    A +  V+ +K ++  V
Sbjct:   58 VIAEAVRTTLGPRGMDKLMVDARGKATISNDGATILKLLDVV----HPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLRQLKPFVEESLHPQTIIRAFRTATNLAVSKIKEIAVSV 170          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000065325.1 (SMESG000065325.1)

HSP 1 Score: 1116.29 bits (2886), Expect = 0.000e+0
Identity = 552/552 (100.00%), Postives = 552/552 (100.00%), Query Frame = 3
Query:  138 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 1793
            MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK
Sbjct:    1 MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVAVIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKEDK 552          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000005331.1 (SMESG000005331.1)

HSP 1 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 305/529 (57.66%), Postives = 423/529 (79.96%), Query Frame = 3
Query:  204 TYAKDVKFGAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVKDGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKISSIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKAPGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITKDDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEK-MQERLSKLSNGVAVIKVGG-SSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALDNLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKV---FSMQNEMGYDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTE 1775
            T+AK++KFG+EAR+ M+ GV++L   V+ T+GPKGRNVI+E S GSP ITKDGVTVA++I L+++ QN+GA++++D+A NTN+++GDGT+ ATVLA +IAKE F +I+KG N I+ R G++  VD VV  L  M+K +T+PEE++QVA+ISAN D S+G++ISEA++KVGK GT+T+++G TL+D LE+I G+KFDRGYISPYFIN+DKG+KCEFQ+AFIL S++KI  + S++PVLE+ + Q  PLLI+AEDVD EAL+AL++N+LKL LQ+CAVK+PGFG+NR   L D+A ATGG +FG + +   IE V+L  LGRA+E+ I+++DTL++ G+G    I+ RIE ++DE+ +  + YE+E+ ++ERLSKLSNG+AV+++GG SSE+E+ EKK RY DAL  T+AA++EGIV GGG AL+RCI  LD L   T DQ IGI +V++AL +PCYTIA NAGVN  +VVE++     + N++GYDA+NDEYV+M ++GIIDP KVVRTAL  A+G ASLL T+E VV +
Sbjct:   16 TFAKEIKFGSEARAQMMEGVELLTKVVSRTLGPKGRNVIIENSNGSPIITKDGVTVAENIILENRIQNLGAKILRDIAKNTNDKSGDGTSTATVLACSIAKEAFNRINKGVNVIELRNGILKGVDLVVKELNNMAKQITSPEELSQVASISANNDHSVGNMISEAIRKVGKTGTVTIQNGNTLNDTLELINGLKFDRGYISPYFINSDKGSKCEFQNAFILLSQRKIFDVLSIVPVLELINSQNVPLLIIAEDVDSEALSALIMNKLKLNLQICAVKSPGFGENRLEILNDIAIATGGFLFGQQGDRIPIEAVKLEHLGRAKEIHISRNDTLIIGGQGNEGKIRSRIERLEDELQIVGNNYERERNLKERLSKLSNGIAVVRIGGCSSEIELREKKARYIDALQVTQAALDEGIVAGGGLALLRCIGDLD-LLDVTGDQNIGIAVVKEALKSPCYTIARNAGVNGDLVVERLLKQLEIGNDIGYDALNDEYVDMFDRGIIDPVKVVRTALTGAAGAASLLITSEVVVVD 543          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.808e-10
Identity = 56/226 (24.78%), Postives = 103/226 (45.58%), Query Frame = 3
Query:  231 AEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEE--IAQVATISANGDRSIGDLISEAMKKVGKDGTITVKD------------------GKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEF 848
            A  R++ ++    +ADA+  ++GPKG + ++++  G   IT DG T+ K +    K  +  AR++ +++   + EAGDGTT   VLA +      + +SKG +P        +A       ++ MS PV   +   + ++A+ S N    +    S  +  +  D  + ++D                  G T+ D  E+++G+  DR   S   + T + AK  F
Sbjct:   26 AAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRM----KLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNS--KVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDT-ELVDGLIIDRRVESLCNVFTVENAKIGF 244          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.054e-10
Identity = 56/226 (24.78%), Postives = 103/226 (45.58%), Query Frame = 3
Query:  231 AEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKPVTTPEE--IAQVATISANGDRSIGDLISEAMKKVGKDGTITVKD------------------GKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEF 848
            A  R++ ++    +ADA+  ++GPKG + ++++  G   IT DG T+ K +    K  +  AR++ +++   + EAGDGTT   VLA +      + +SKG +P        +A       ++ MS PV   +   + ++A+ S N    +    S  +  +  D  + ++D                  G T+ D  E+++G+  DR   S   + T + AK  F
Sbjct:   35 AAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRM----KLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNS--KVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDT-ELVDGLIIDRRVESLCNVFTVENAKIGF 253          
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Match: SMESG000078668.1 (SMESG000078668.1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.989e-9
Identity = 52/207 (25.12%), Postives = 101/207 (48.79%), Query Frame = 3
Query:  228 GAEARSAMLVGVDILADAVAVTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVANNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVVASLKAMSKP--VTTPEEIAQVATISANGDRSIG-----------DLISEAMKKVGK-----DGTITVKDGKTLHDELEVIEGMKFDR 794
            G+  RS+ +     +AD V  ++GP+G + ++++S G   +T DG T+ K    + K  +  A+++  ++ + + EAGDGTT+  V+A ++     + + KG +P         A +     LK  S+   ++  E + ++A+ S N  + +G           D +  A+ K        D  IT+K G T+ D + +++G+  DR
Sbjct:   16 GSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILK----RMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNS-KVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTV-LVDGLIIDR 216          
The following BLAST results are available for this feature:
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPD10.000e+072.38heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD10.000e+072.38heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD12.714e-11875.21heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD11.046e-11075.11heat shock protein family D (Hsp60) member 1 [Sour... [more]
HSPD11.521e-5685.19heat shock protein family D (Hsp60) member 1 [Sour... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-600.000e+068.12Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-600.000e+068.12Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-604.008e-9362.34Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-601.155e-8064.29Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
hsp-601.155e-8064.29Chaperonin homolog Hsp-60, mitochondrial [Source:... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsp60A0.000e+072.96gene:FBgn0015245 transcript:FBtr0073434[more]
Hsp60A0.000e+072.96gene:FBgn0015245 transcript:FBtr0073435[more]
Hsp60C0.000e+069.38gene:FBgn0031728 transcript:FBtr0079112[more]
Hsp60C0.000e+069.38gene:FBgn0031728 transcript:FBtr0079111[more]
Hsp60C0.000e+069.38gene:FBgn0031728 transcript:FBtr0079110[more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+073.91heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
hspd10.000e+073.91heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
cct42.140e-830.17chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct79.784e-728.07chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct58.344e-623.53chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+072.27heat shock protein family D (Hsp60) member 1 [Sour... [more]
hspd10.000e+072.56heat shock protein family D (Hsp60) member 1 [Sour... [more]
cct44.118e-830.08chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct44.488e-830.08chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct45.158e-829.85chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspd10.000e+072.38heat shock protein 1 (chaperonin) [Source:MGI Symb... [more]
Hspd15.694e-9773.76heat shock protein 1 (chaperonin) [Source:MGI Symb... [more]
Hspd12.248e-6383.76heat shock protein 1 (chaperonin) [Source:MGI Symb... [more]
Cct41.409e-827.40chaperonin containing Tcp1, subunit 4 (delta) [Sou... [more]
Cct25.641e-832.28chaperonin containing Tcp1, subunit 2 (beta) [Sour... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63039|CH60_RAT0.000e+072.3860 kDa heat shock protein, mitochondrial OS=Rattus... [more]
sp|P63038|CH60_MOUSE0.000e+072.3860 kDa heat shock protein, mitochondrial OS=Mus mu... [more]
sp|P18687|CH60_CRIGR0.000e+072.3860 kDa heat shock protein, mitochondrial OS=Cricet... [more]
sp|Q5ZL72|CH60_CHICK0.000e+072.0260 kDa heat shock protein, mitochondrial OS=Gallus... [more]
sp|O02649|CH60A_DROME0.000e+072.96Heat shock protein 60A OS=Drosophila melanogaster ... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481NV520.000e+095.29Heat shock protein 60 OS=Dugesia japonica OX=6161 ... [more]
A0A3Q0KC410.000e+081.66Heat shock protein HSP60, putative OS=Schistosoma ... [more]
A0A4Z2DXW10.000e+079.4960 kDa heat shock protein OS=Schistosoma japonicum... [more]
A0A183K6N70.000e+078.35Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A0R3U1G10.000e+076.82Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+073.77heat shock protein family D (Hsp60) member 1 [Sour... [more]
cct42.238e-931.03chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct21.784e-731.50chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct22.826e-731.50chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct74.162e-727.50chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+072.93heat shock 60 protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
cct75.295e-1032.48chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct49.938e-1027.91chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
ENSPMAT00000002094.12.318e-932.31pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
cct51.336e-723.12chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HSP600.000e+057.63Tetradecameric mitochondrial chaperonin; required ... [more]
TCM626.392e-1422.77Protein involved in assembly of the succinate dehy... [more]
CCT55.242e-1323.88Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT41.846e-831.07Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT21.134e-734.41Subunit beta of the cytosolic chaperonin Cct ring ... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490300.000e+070.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279901.326e-11052.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349811.252e-922.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274111.775e-724.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349834.297e-734.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspd10.000e+071.66heat shock protein family D (Hsp60) member 1 [Sour... [more]
cct43.440e-1030.23chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct23.676e-833.86chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct21.398e-733.60chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct73.075e-626.50chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
back to top
BLAST of 60 kDa heat shock protein, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065325.10.000e+0100.00SMESG000065325.1[more]
SMESG000005331.10.000e+057.66SMESG000005331.1[more]
SMESG000060610.11.808e-1024.78SMESG000060610.1[more]
SMESG000060610.12.054e-1024.78SMESG000060610.1[more]
SMESG000078668.12.989e-925.12SMESG000078668.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025522 ID=SMED30025522|Name=60 kDa heat shock protein, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1974bp
CTAGAAATTTTCTAGTGAATATATAATAATATATAATTCTGAGAGAAATA
GTAATATTTCTGATTTCTAGAATCAATTTGTTTAAAATAATATTTATCAC
TACATATTTCTAGAACATTTGCTTTTCAAATTAAAACATGTTTAGAATTG
CAAGATCTTTGAGATTATTACAACTTTCCAAAGTTAATACTTTGCGATCT
TGTACATACGCGAAAGATGTCAAATTTGGAGCTGAAGCCAGGTCTGCCAT
GCTTGTTGGTGTTGACATATTAGCCGATGCAGTCGCAGTCACCATGGGAC
CAAAGGGTCGCAACGTTATCTTAGAAAAGTCTTGGGGATCCCCAAAGATA
ACTAAAGATGGCGTCACTGTAGCTAAAGATATAGAACTCAAAGATAAATT
CCAAAATATTGGAGCGCGATTGGTTCAAGATGTAGCAAATAATACAAATG
AAGAGGCGGGTGACGGTACTACTGCAGCAACAGTATTAGCTCGAGCTATT
GCGAAAGAAGGATTTGAAAAAATCAGCAAAGGTGCGAATCCTATTGATTT
CAGACGAGGGGTTATGATGGCAGTTGATAATGTTGTTGCATCATTGAAAG
CCATGTCTAAGCCAGTAACAACCCCCGAGGAAATAGCCCAAGTAGCTACC
ATTTCGGCCAATGGTGACAGAAGCATTGGAGACTTAATCTCGGAAGCAAT
GAAAAAAGTTGGCAAAGACGGAACAATAACTGTCAAAGATGGTAAAACAT
TGCACGATGAGTTAGAAGTAATTGAAGGAATGAAATTTGATCGTGGCTAT
ATTTCTCCTTATTTCATAAATACTGATAAAGGAGCTAAATGCGAATTTCA
AGATGCATTTATACTTTTTTCAGAGAAAAAGATTTCCAGTATTCAATCTT
TAATTCCGGTTTTAGAAATGACACATCAACAGAAAAAACCATTATTAATT
GTTGCTGAAGATGTTGACGGAGAAGCCTTGACAGCGTTGGTGTTAAATAG
ATTGAAATTAGGTTTGCAAGTATGCGCTGTTAAAGCGCCAGGTTTTGGAG
ATAACCGCAAAAATACTCTTAAAGATATGGCCACAGCAACTGGTGGAGTC
GTTTTCGGCGATGAAGCTGAGACTTTTAAAATTGAAAACGTTCAGTTGCA
TGACTTAGGCCGCGCTCAAGAAGTTTTAATTACCAAAGATGATACATTAG
TAATGAAAGGCAAGGGTATCCATAAAGATATTCAAAAGCGAATTGAAGAA
ATAAAGGATGAAATTGCTCTGTCCACAAGTGAATATGAGAAAGAAAAAAT
GCAAGAGAGACTTTCAAAATTATCTAATGGCGTCGCTGTTATTAAAGTCG
GTGGTAGTAGTGAGGTCGAGGTGAATGAAAAAAAAGATAGATATACGGAT
GCTTTAAATGCTACCAGAGCAGCAGTCGAGGAAGGTATTGTTCCAGGAGG
AGGTACCGCTCTTATCAGATGTATTCCAGCACTAGATAACTTAAAACCTA
AAACTGAAGATCAAAAAATTGGTATTGAAATCGTTAGAAAAGCTTTGACT
ACGCCATGCTACACAATAGCTCACAATGCCGGAGTTAATGCATCAGTCGT
GGTTGAAAAAGTTTTCAGTATGCAAAATGAAATGGGTTATGATGCTATGA
ATGATGAATATGTCAATATGATTGAAAAGGGTATTATTGATCCGACTAAA
GTCGTGCGAACAGCTTTAGTTGATGCATCAGGAGTTGCTTCATTATTGAC
GACAGCAGAAACTGTTGTGACAGAGATTATCAAGGAAGATAAGGCAGGTG
CAATGGGAGGTATGGGTGGCATGGGAGGAATGGGCGGCATGGGTGGAATG
GGAGGTATGATGTAAAGAGATTGTTGAAATTGCATTTTAGTTTTATACAA
TAAAATTTGTGCATTTATTAATTGGCTTGTTTTTTGTCAATAAATAAACA
TTAACATAAAGTTTTAAAAAAAAA
back to top

protein sequence of SMED30025522-orf-1

>SMED30025522-orf-1 ID=SMED30025522-orf-1|Name=SMED30025522-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MFRIARSLRLLQLSKVNTLRSCTYAKDVKFGAEARSAMLVGVDILADAVA
VTMGPKGRNVILEKSWGSPKITKDGVTVAKDIELKDKFQNIGARLVQDVA
NNTNEEAGDGTTAATVLARAIAKEGFEKISKGANPIDFRRGVMMAVDNVV
ASLKAMSKPVTTPEEIAQVATISANGDRSIGDLISEAMKKVGKDGTITVK
DGKTLHDELEVIEGMKFDRGYISPYFINTDKGAKCEFQDAFILFSEKKIS
SIQSLIPVLEMTHQQKKPLLIVAEDVDGEALTALVLNRLKLGLQVCAVKA
PGFGDNRKNTLKDMATATGGVVFGDEAETFKIENVQLHDLGRAQEVLITK
DDTLVMKGKGIHKDIQKRIEEIKDEIALSTSEYEKEKMQERLSKLSNGVA
VIKVGGSSEVEVNEKKDRYTDALNATRAAVEEGIVPGGGTALIRCIPALD
NLKPKTEDQKIGIEIVRKALTTPCYTIAHNAGVNASVVVEKVFSMQNEMG
YDAMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKE
DKAGAMGGMGGMGGMGGMGGMGGMM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000039gamma neoblast
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027410TCP-1-like_intermed_sf
IPR001844Chaprnin_Cpn60
IPR027413GROEL-like_equatorial_sf
IPR002423Cpn60/TCP-1
IPR027409GroEL-like_apical_dom_sf
IPR018370Chaperonin_Cpn60_CS
Vocabulary: biological process
TermDefinition
GO:0042026protein refolding
GO:0006457protein folding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 220..247
NoneNo IPR availablePANTHERPTHR45633:SF1760 KDA HEAT SHOCK PROTEIN, MITOCHONDRIALcoord: 1..425
NoneNo IPR availablePANTHERPTHR45633FAMILY NOT NAMEDcoord: 1..425
IPR001844Chaperonin Cpn60PRINTSPR00298CHAPERONIN60coord: 148..171
score: 59.68
coord: 279..300
score: 83.74
coord: 231..256
score: 52.19
IPR001844Chaperonin Cpn60CDDcd03344GroELcoord: 1..404
e-value: 0.0
score: 661.844
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 71..256
e-value: 1.5E-170
score: 569.4
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 64..257
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 2..403
e-value: 9.5E-52
score: 176.2
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 2..397
e-value: 1.5E-170
score: 569.4
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 254..404
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 17..291
e-value: 1.5E-170
score: 569.4
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 17..84
IPR018370Chaperonin Cpn60, conserved sitePROSITEPS00296CHAPERONINS_CPN60coord: 286..297