C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30025511
Length (bp)3817
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30025511) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30025511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30025511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30025511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025511SMESG000027290.1 SmedASXL_015129SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025511SMESG000027290.1 SmedASXL_015129SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30025511SMESG000027290.1 dd_Smed_v4_6459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025511SMESG000027290.1 dd_Smed_v4_6459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025511SMESG000027290.1 Contig49995newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025511SMESG000027290.1 Contig49995uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A5J4P1U5 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0013679 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.265e-41
Identity = 107/326 (32.82%), Postives = 152/326 (46.63%), Query Frame = 3
Query: 1269 LMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIP-------------------SEGPFRHFEMTQHLVSAHNRADIA-IVWNDCPIAGKKCNECSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNAS----------------------PELT-----------SLCFCLYCGVGVRR 2087
            L+ C +C F       L  HL G+ P   TKCA C  S+ + +  LCA KAH+LLH+G FIMCP+CGF PP  L P+  E+ LR+HLR+VCFHFNL+Q+++C  C    SKA++T   +  H+F+ H     +C  C+     P                   S  P    E +Q + S      +  +V     + G +C  C EI  +RDS+  H  + H T    G   +RCFG+C+R+   +DEF+ H + C    ++    +    P AS                      P LT            LCFC +CG+G RR
Sbjct:  459 LLRCLLCRFRTNDPRHLSEHLTGNRPVVPTKCALCGQSICIRQPNLCAVKAHLLLHLGYFIMCPQCGFTPPAYLAPDAAELCLRVHLRFVCFHFNLLQVHVCTQC-QGRSKAYHTFAHLCQHMFESHTKRVYACLWCARQTAGPNARSASAEPYQTGQTVNSRSANPMEQTEQSQAIGSDRTPGSLVHLVPAVDFLCGSQCPHCEEIFERRDSFAQHFRSAHCT-SQSGVCCYRCFGSCRRLCFDLDEFRQHLTSCRCARDLYTSTFGACKPRASTTTRFPSMADRTDNNVSVAPGDPNLTCRTIANTVREHRLCFCFHCGIGARR 782          

HSP 2 Score: 70.4774 bits (171), Expect = 2.943e-8
Identity = 35/115 (30.43%), Postives = 58/115 (50.43%), Query Frame = 3
Query: 2997 GITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVL-DTTCISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDSSDTNKRAKQTINSSK 3338
            G T    ++   LC +CG +  + D WE+H L+  +      GL+L  P  +VL       YRCY+C+ RF  +  C  H+   H +  + +NW +L D+SD+ +  K   +S +
Sbjct: 1404 GGTRCSDTSKSMLCVLCGEQ-QTTDTWEEHALSHRNPQMSWNGLNLFEPQRIVLTQRQSKVYRCYICDRRFVTRFGCQRHLTGLHKMAKARINWDLLYDNSDSGRIVKTVTDSRR 1517          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A158RAG1 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9244 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.066e-40
Identity = 136/493 (27.59%), Postives = 207/493 (41.99%), Query Frame = 3
Query: 1269 LMHCFMC-NFVCESHSDLISHLQG---DWPNSVTKCAFCTLSVPLNKE--YLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICS-------TNNNIPSEGPFR----------------HFEMTQHL--VSAHNRADIAIVWNDCPIAGKKCNECSEIIAQRDSYFSHMTNNH--------------------KTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNA---SPELTS-------------LCFCLYCGVGVRRKRL-----ENGEIETQSEPQMFANLSLTHEHEQDHILCETNITA---------CPWCPNRM------------------SAKINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAA-IDNPLSLHCHAIPQMLGTASSNGSSSK 2447
            ++ C +C NF   S + L +HL G   D   S  KCA C LSV  N+    LC+ KAH+LLH+ I++MCP+CGF PPPDL P   EI LRLHLR+VCFHFNL+++ +C   G    + F T      H F+ H     +C +C        T   +  +   R                H +    L   SA   + +A V          C+EC+ + +    +  H ++ H                    +    +    +RCFG C     +I E + H   CS  I+   + +   L N    +P   S             LC CLYC +  R+        + GE  + S  + F++L   H HE  HI+  T   A         CPWC  ++                  S    ++  H+  H   N +++W  +R +++N +RN++V C+C    +D+PL+L  HA      T +  GS  +
Sbjct:  439 VLRCLLCGNFRTNSAAALRAHLNGSGSDADASPAKCALCALSVVHNRRDMMLCSIKAHLLLHLNIYLMCPQCGFTPPPDLTPSLAEICLRLHLRFVCFHFNLVKVLLCSK-GSCRDRIFLTMESFVQHWFEVHTARKYACQLCGSLGHQSKTEEGVADDAVIRLNGLIYDFSDLASVCMHLQERHSLSVTSAPTFSQVAYV----------CSECAFVSSIPVDFADHFSSTHCRPSEANTTTAATGAAPPHSRQSPCESHCFYRCFGDCSHFSPNIKELRGHVRTCSFAISTLRRAFGGQLFNGTQVAPGSASAFAAATGDGKGNPLCLCLYCDISRRKTDPFVSLNDEGEAFSSSTSKAFSDLHRLHAHE--HIVHVTGGAAAVAVSGQVGCPWCGEKLTLMPAPAPASITTTSAAPSNHTEDLINHLRRHAAANPYVAWQMERVRRFNESRNEVVVCHCQTGWLDSPLALMAHASAFPTATNTFRGSRKR 918          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A5K3FRJ5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.899e-40
Identity = 155/549 (28.23%), Postives = 239/549 (43.53%), Query Frame = 3
Query: 1101 FLNDWNVDMFNSFQRAPKDQ---RYYLLPMARKDVVQSHKFYSDHYRAANQKLKEYPV--ELMHCFMC-NFVCESHSDLISHLQG--DWPNSV-TKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPH--CGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNN---NIPSEGP-----------------FRHFEMT-QHLVSAHNRADI-AIVWNDCPIAGKKCNECSEIIAQRDSYFSHMTNNH----KTLIV------KGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELT-----------------------SLCFCLYCGVGVRRKRLENGEIETQSEPQ-----------------------------MFANLSLTHEHE-QDHILCE--TNITACPWCPNRMSA-------KINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAA-IDNPLSLHCHAIPQMLGTASS 2429
            FL+ W+  + NS   A K+         P A +D V+        Y A     +  P    ++ C MC +F   S + L  HL G    P++V  +CAFC+LSV  N   LC+ KAH+L H+GIF++CP+CGF PPPDL P   EI LRLHLR+ CFHFN+ ++++C    C D   K F T      H F+ H     +C +CS  N    +   G                  FR F     HL   H  A   A  ++     G +C+ECS I     ++  H +  H     + +V      + +SA+ CFG CKR+    +EF+ H   C   + V ++ +  +  N +P+ +                        LCFCLYCG+G+++  +      T   PQ                              F +L   H HE  +H++C   +    CPWC +++           N + +H+  H   N +++W+  R ++++    D++ C C +  +D+PL+L  HA      TASS
Sbjct:  359 FLSAWHARVTNSGATAQKNGLGGTPSPPPAATRDQVE------QAYTALLGCGRSNPDFHRVLRCLMCGDFRTNSPTALRHHLSGVPGSPDTVLARCAFCSLSVSHNSG-LCSVKAHILFHLGIFLVCPQCGFTPPPDLPPPLAEICLRLHLRFSCFHFNVAKVFVCTRTTCSD---KIFLTMENFVHHWFEAHTARKYACQLCSGANLQSKVEDTGDGACANRLNPRNQLYSYDFRDFAAVCSHLQERHALAPASASTYSQI---GYECSECSYITPVPVTFAGHFSTAHCRPGDSTVVGCPTTCEVRSAYNCFGECKRLFFDANEFRRHLRVCPHAVAVLSRTFGENCLNITPQPSEAAASESGTESVSQMTTTTVADSPLCFCLYCGIGLKKPPVRRSSQSTSPAPQNQAVSLPVRGGSGEERASERPRGDAKSTVTFPDLGSLHSHEISNHVVCVGVSGQIGCPWCGDKVQLVSSDPLDHANGLVEHLSMHARANPYVAWHLDRTRRFSERPGDVIVCQCQSGCLDSPLALMAHA--SAFPTASS 892          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A068WQZ4 (Neurabin 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000342400 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.225e-39
Identity = 130/490 (26.53%), Postives = 207/490 (42.24%), Query Frame = 3
Query: 1269 LMHCFMCNFVC-ESHSDLISHLQGDWPN---SVTKCAFCTLSVPLNKE--YLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICST---NNNIPSEGPFRHFEMTQHLVSAHNRADIAIV-----------WNDCPI---AGKKCNECSEIIAQRDSYFSHMTNNH--------------------KTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTS----------------LCFCLYCGVGVRRKRL-----ENGEIETQSEPQMFANLSLTHEHEQDHILCETNITA---------CPWC-------PNRMSAKI-----------NEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAA-IDNPLSLHCHAIPQMLGTASSNGSSSKHLALT 2462
            ++ C +C   C  + ++L +HL G       S+ KCA C LSV  N++   LC+ KAH+L H+ IF+MCP+CGF PPPDL P   EI LRLHLR+VCFHFNL+++ +C        + F T      H F+ H     +C +C +      I  +           L+  ++ +D+A V               P       KC+EC+ + +    +  H ++ H                    +    + +  +RCFG C +    I E ++H   CS  I+   + +     N++   +                 LC CLYC +  R+        + GE  +    + F +L   H HE  HI+  T   A         CPWC       P    A I            ++  H+  H   N +++W  +R +++N +R ++V C+C    +D+PL+L  HA      T +  GS  + L  T
Sbjct:  416 VLRCLLCGEFCTNTGANLRTHLNGRVSGADVSLAKCALCALSVVHNRKDMVLCSIKAHLLFHLDIFLMCPQCGFTPPPDLTPSLAEICLRLHLRFVCFHFNLVKVLLCSR-ASCRERIFLTMESFVQHWFEVHTARKYACQLCGSLGHQRKIEVDAADDAVVRLNGLI--YDFSDLASVCIHLQERHSLSATSAPTFSQVAYKCSECTFVSSVPVEFADHFSSAHCRLGEVSTITAAAGAAAPQSRQSPCEAQCFYRCFGDCSQFLHDIGELRTHMRTCSFAISTLKRAFGEQFLNSTQAASGSVSASAAVTGEGKGNPLCLCLYCDISRRKTDPFVSGNDEGEANSSLASRAFDDLRRLHAHE--HIVHVTGGAAAVAVSGQVGCPWCGEKLTLMPTPAPASIITPSAAPSNHTEDLINHLRGHATANPYVAWQVERVRRFNESRGEVVICHCQTGWLDSPLALMAHASAFPTATNTFRGSRKRLLGDT 900          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A068XVG9 (Neurabin 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000342400 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 8.616e-39
Identity = 132/490 (26.94%), Postives = 208/490 (42.45%), Query Frame = 3
Query: 1269 LMHCFMCNFVC-ESHSDLISHLQGDWPN---SVTKCAFCTLSVPLNKE--YLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICST---NNNIPSEGPFRHFEMTQHLVSAHNRADIAIV-----------WNDCPI---AGKKCNECSEIIAQRDSYFSHMTNNHKTL--------------------IVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTS----------------LCFCLYCGVGVRRKRL-----ENGEIETQSEPQMFANLSLTHEHEQDHILCETNITA---------CPWC-------PNRMSAKI-----------NEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAA-IDNPLSLHCHAIPQMLGTASSNGSSSKHLALT 2462
            ++ C +C   C  + ++L +HL G       S+ KCA C LSV  N++   LC+ KAH+L H+ IF+MCP+CGF PPPDL P   EI LRLHLR+VCFHFNL+++ +C        + F T      H F+ H     +C +C +      I  +G          L+  ++ +D+A V               P       KC+EC+ + +    +  H ++ H  L                      + +  +RCFG C +    I E ++H   CS  I+     +     N++   +                 LC CLYC +  R+        + GE  +    + F +L   H HE  HI+  T   A         CPWC       P    A I            ++  H+  H   N +++W  +R +++N +R+++V C+C    +D+PL+L  HA      T +  GS  + L  T
Sbjct:  416 VLRCLLCGEFCTNTGANLRTHLNGRVSGADVSLAKCALCALSVVHNRKDMILCSIKAHLLFHLDIFLMCPQCGFTPPPDLTPSLAEICLRLHLRFVCFHFNLVKVLLCSR-ASCRERIFLTMESFVQHWFEVHTARKYACQLCGSLGQQRKIEVDGADDAVVRLNGLI--YDFSDLASVCIHLQERHSLSATSAPTFSQVAYKCSECTFVSSVPVEFADHFSSAHCRLGEVSTITAAAGAAAPQSRQSPCEAQCFYRCFGDCSQFLHDIGELRTHMRTCSFAISTLKCAFGEQFLNSTQAASGSISASAAVTGEGKGNPLCLCLYCDISRRKTDPFVSGNDEGEANSSLTSRAFDDLRRLHAHE--HIVHVTGGAAAVAVSGQVGCPWCGEKLTLMPTPAPASIITASAAPSNHTEDLINHLRGHATANPYVAWQMERVRRFNESRDEVVICHCQTGWLDSPLALMAHASAFPTATNTFRGSRKRLLGDT 900          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: znf687b (zinc finger protein 687b-like [Source:NCBI gene;Acc:103031314])

HSP 1 Score: 55.4546 bits (132), Expect = 4.448e-7
Identity = 81/410 (19.76%), Postives = 133/410 (32.44%), Query Frame = 3
Query:  810 YSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSKVIKMTNICQIVIHLLTNH------KISTIAMDKLSFKSFLNINDSVE------------EVNEDFEEMAKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYL-LPMARKDVVQSHKFYSDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFI-MCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIPSEGPFRHFEMTQ-HLVSAH---NRADIAIVWN------------------DCPIAGKK-----CNECSEIIAQRDSYFSHMTNNHKTLIVKGK 1898
            Y C  C   F        H  R+       C HC+K +   N C +++H   +       + S + M  ++ +  +   D+                N+     A ST     ++          N  +RAP+     + LP  + +V+Q H F                     C  C       ++L++H Q       + C  C  S P+     C+  AH  +H      +CP CG +          + + + HL   C HF     Y C  C       F   N +  HI   H   F  C  C           F+     Q H+ S H     A   +++                   D  +A +K     C +C+++ AQ+ S   H+   H+ L  K +
Sbjct:  687 YRCLECGDAFALERSLARHYDRRSLRIEVTCNHCAKRLAFFNKCSLLLHAREHKERGLVMQCSHLVMRPVTVEQMIGQQDTTPIGMLSPSPQLSSPSNQSGVPPA-STSSPLKDSPTQATASTPLNPARRAPQSPHALMPLPCKKGEVLQYHNF--------------------KCPECQVQFSGKAELVAHFQQIRATPNSTCTLC--SPPMMLPNGCSVSAHQRIHKHRAPHVCPECGGI--------ARQASFQTHLEEACLHFARRIGYRCSSC----QVVFGGLNSIKSHIQTAHCEVFHKCPNCPMA--------FKSASSAQAHISSQHPTLTTAQAKMIYKCVMCDTVFTQKPLLYMHFDTHLAKQKVHVFKCPDCTKLYAQKGSMMEHIKTAHRGLTGKAE 1053          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: znf532 (zinc finger protein 532 [Source:ZFIN;Acc:ZDB-GENE-060531-40])

HSP 1 Score: 52.373 bits (124), Expect = 8.306e-7
Identity = 61/259 (23.55%), Postives = 90/259 (34.75%), Query Frame = 3
Query: 2892 FSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTTCISYRCYLC---NHRFDKKISCANHMKDNHSIDDSELNW--GMLTDSSDTNKRAKQTINS------------SKMCLSTYPSKRLKVEDS-------LNTEESVYVCGICPFQCNARKEMIDHAISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRI 3596
              ++ + C  C+E       FS R +   H+K  HG     +    + C  C   F S      H    H +G RK+                  Y C+ C      F K+    NH++  H I D + +   GM   S +    + +T N             ++    T P KRL+V  +           +  YVC  C F    R+E   H I  H             + C +C L F S  S   HL +VHR+
Sbjct:  757 LKNSGWTCSECQE------HFSEREVYVSHVKRVHG-----KPIKKYPCRQCDRSFSSSHSLRRHIRINH-EGIRKV------------------YTCWYCEDTKRTFTKRFMLENHIRLMHGIKDPDFSQMPGMSAGSDEAENTSPETGNKRRGSGDEGRVPEARAQAITRPVKRLRVGGAGGASGPEAGGPDRPYVCAKCEFTTEKREEFQRH-IPQH-------RTDGIAWQCSECGLCFTSQPSLNRHLYIVHRM 977          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000027290.1 (SMESG000027290.1)

HSP 1 Score: 2401.32 bits (6222), Expect = 0.000e+0
Identity = 1152/1156 (99.65%), Postives = 1154/1156 (99.83%), Query Frame = 3
Query:  168 MQPRTIDNDLIIVAEDIPAVRTHCLLSKYKVKNESIINETVDLTQMASPPASEVTLRNPVQYQIRPQYQINPIRFRNELSNQPFLNICSQSNTMQTNNHQRNLITDIHINRNRTGPTYINGNVSNTAIVSNGSNVQPILPSNISINPKPPQPNIELDLTDSNKDLAVTSLPDLLGFIHNRKGCTNATELQNIGSVNMHEFLKSTPAESFSRKGFYSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSKVIKMTNICQIVIHLLTNHKISTIAMDKLSFKSFLNINDSVEEVNEDFEEMAKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYLLPMARKDVVQSHKFYSDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIPSEGPFRHFEMTQHLVSAHNRADIAIVWNDCPIAGKKCNECSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTSLCFCLYCGVGVRRKRLENGEIETQSEPQMFANLSLTHEHEQDHILCETNITACPWCPNRMSAKINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAAIDNPLSLHCHAIPQMLGTASSNGSSSKHLALTDSIHREFLTAPRHRVPGTCPMCTESDIITNSIDMSWHIFFKHRNILCYVCKNFRLLNADNSPKCRITMWNHVYSCLRRHTPRFNLKSGLTLLQSIANCETVMSDCTVFDLKKSGEIHVGLFADPGDPDDQALSSGNTELAKSAFSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTTCISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDSSDTNKRAKQTINSSKMCLSTYPSKRLKVEDSLNTEESVYVCGICPFQCNARKEMIDHAISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRISNPTLFMEQFSDS 3635
            MQPRTIDNDLIIVAEDIPAVRTHCLLSKYKVKNESIINETVDLTQMASPPASEVTLRNPVQYQIRPQYQINPIRFRNELSNQPFLNICSQSNTMQTNNHQRNLITDIHINRNR+GPTYINGNVSNTAIVSNGSNVQPILPSNISINPKPPQPNIELDLTDSNKDLAVTSLPDLLGFIHNRKGCTNATELQNIGSVNMHEFLKSTPAESFSRKGFYSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSKVIKMTNICQIVIHLLTNHKISTIAMDKLSFKSFLNINDSVEEVNEDFEEMAKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYLLPMARKDVVQSHKFYSDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIPSEGPFRHFEMTQHLVSAHNRADIA VWNDCPI GKKCNECSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTSLCFCLYCGVGVRRKRLENGEIETQSEPQMFANLSLTHEHEQDHILCETN+TACPWCPNRMSAKINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAAIDNPLSLHCHAIPQMLGTASSNGSSSKHLALTDSIHREFLTAPRHRVPGTCPMCTESDIITNSIDMSWHIFFKHRNILCYVCKNFRLLNADNSPKCRITMWNHVYSCLRRHTPRFNLKSGLTLLQSIANCETVMSDCTVFDLKKSGEIHVGLFADPGDPDDQALSSGNTELAKSAFSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTTCISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDSSDTNKRAKQTINSSKMCLSTYPSKRLKVEDSLNTEESVYVCGICPFQCNARKEMIDHAISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRISNPTLFMEQFSDS
Sbjct:    1 MQPRTIDNDLIIVAEDIPAVRTHCLLSKYKVKNESIINETVDLTQMASPPASEVTLRNPVQYQIRPQYQINPIRFRNELSNQPFLNICSQSNTMQTNNHQRNLITDIHINRNRSGPTYINGNVSNTAIVSNGSNVQPILPSNISINPKPPQPNIELDLTDSNKDLAVTSLPDLLGFIHNRKGCTNATELQNIGSVNMHEFLKSTPAESFSRKGFYSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSKVIKMTNICQIVIHLLTNHKISTIAMDKLSFKSFLNINDSVEEVNEDFEEMAKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYLLPMARKDVVQSHKFYSDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIPSEGPFRHFEMTQHLVSAHNRADIANVWNDCPIPGKKCNECSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTSLCFCLYCGVGVRRKRLENGEIETQSEPQMFANLSLTHEHEQDHILCETNVTACPWCPNRMSAKINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAAIDNPLSLHCHAIPQMLGTASSNGSSSKHLALTDSIHREFLTAPRHRVPGTCPMCTESDIITNSIDMSWHIFFKHRNILCYVCKNFRLLNADNSPKCRITMWNHVYSCLRRHTPRFNLKSGLTLLQSIANCETVMSDCTVFDLKKSGEIHVGLFADPGDPDDQALSSGNTELAKSAFSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTTCISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDSSDTNKRAKQTINSSKMCLSTYPSKRLKVEDSLNTEESVYVCGICPFQCNARKEMIDHAISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRISNPTLFMEQFSDS 1156          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000027290.1 (SMESG000027290.1)

HSP 1 Score: 2397.08 bits (6211), Expect = 0.000e+0
Identity = 1152/1159 (99.40%), Postives = 1154/1159 (99.57%), Query Frame = 3
Query:  168 MQPRTIDNDLIIVAEDIPAVRTHCLLSKYKVKNESIINETVDLTQMASPPASEVTLRNPVQYQIRPQYQINPIRFRNELSNQPFLNICSQSNTMQTNNHQRNLITDIHINRNRTGPTYINGNVSNTAIVSNGSNVQPILPSNISINPKPPQPNIELDLTDSNKDLAVTSLPDLLGFIHNRKGCTNATELQNIGSVNMHEFLKSTPAESFSRKGFYSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSKVIKMTNICQIVIHLLTNHKISTIAMDKLSFKSFLNINDSVEEVNEDFEEMAKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYLLPMARKDVVQSHKFYSDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIPSEGPFRHFEMTQHLVSAHNRADIAIVWNDCPIAGKKCNECSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTSLCFCLYCGVGVRRKRLENGEIETQSEPQMFANLSLTHEHEQDHILCETNITACPWCPNRMSAKINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAAIDNPLSLHCHAIPQMLGTASSNGSSSKHLALTDSIHREFLTAPRHRVPGTCPMCTESDIITNSIDMSWHIFFKHRNILCYVCKNFRLLNADNSPKCRITMWNHVYSCLRRHTPRFNLKSGLTLLQSIANCETVMSDCTVFDLKKSGEIHVGLFADPGDPDDQALSSGNTELAKSAFSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTTCISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDS---SDTNKRAKQTINSSKMCLSTYPSKRLKVEDSLNTEESVYVCGICPFQCNARKEMIDHAISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRISNPTLFMEQFSDS 3635
            MQPRTIDNDLIIVAEDIPAVRTHCLLSKYKVKNESIINETVDLTQMASPPASEVTLRNPVQYQIRPQYQINPIRFRNELSNQPFLNICSQSNTMQTNNHQRNLITDIHINRNR+GPTYINGNVSNTAIVSNGSNVQPILPSNISINPKPPQPNIELDLTDSNKDLAVTSLPDLLGFIHNRKGCTNATELQNIGSVNMHEFLKSTPAESFSRKGFYSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSKVIKMTNICQIVIHLLTNHKISTIAMDKLSFKSFLNINDSVEEVNEDFEEMAKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYLLPMARKDVVQSHKFYSDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIPSEGPFRHFEMTQHLVSAHNRADIA VWNDCPI GKKCNECSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTSLCFCLYCGVGVRRKRLENGEIETQSEPQMFANLSLTHEHEQDHILCETN+TACPWCPNRMSAKINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAAIDNPLSLHCHAIPQMLGTASSNGSSSKHLALTDSIHREFLTAPRHRVPGTCPMCTESDIITNSIDMSWHIFFKHRNILCYVCKNFRLLNADNSPKCRITMWNHVYSCLRRHTPRFNLKSGLTLLQSIANCETVMSDCTVFDLKKSGEIHVGLFADPGDPDDQALSSGNTELAKSAFSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTTCISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDS   SDTNKRAKQTINSSKMCLSTYPSKRLKVEDSLNTEESVYVCGICPFQCNARKEMIDHAISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRISNPTLFMEQFSDS
Sbjct:    1 MQPRTIDNDLIIVAEDIPAVRTHCLLSKYKVKNESIINETVDLTQMASPPASEVTLRNPVQYQIRPQYQINPIRFRNELSNQPFLNICSQSNTMQTNNHQRNLITDIHINRNRSGPTYINGNVSNTAIVSNGSNVQPILPSNISINPKPPQPNIELDLTDSNKDLAVTSLPDLLGFIHNRKGCTNATELQNIGSVNMHEFLKSTPAESFSRKGFYSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSKVIKMTNICQIVIHLLTNHKISTIAMDKLSFKSFLNINDSVEEVNEDFEEMAKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYLLPMARKDVVQSHKFYSDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCAFCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITLRLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRSCSICSTNNNIPSEGPFRHFEMTQHLVSAHNRADIANVWNDCPIPGKKCNECSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHRSECSECINVKNKLYQPHLPNASPELTSLCFCLYCGVGVRRKRLENGEIETQSEPQMFANLSLTHEHEQDHILCETNVTACPWCPNRMSAKINEMTQHMETHLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAAIDNPLSLHCHAIPQMLGTASSNGSSSKHLALTDSIHREFLTAPRHRVPGTCPMCTESDIITNSIDMSWHIFFKHRNILCYVCKNFRLLNADNSPKCRITMWNHVYSCLRRHTPRFNLKSGLTLLQSIANCETVMSDCTVFDLKKSGEIHVGLFADPGDPDDQALSSGNTELAKSAFSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQSADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTTCISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDSSVVSDTNKRAKQTINSSKMCLSTYPSKRLKVEDSLNTEESVYVCGICPFQCNARKEMIDHAISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRISNPTLFMEQFSDS 1159          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P1U52.265e-4132.82Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A158RAG11.066e-4027.59Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A5K3FRJ53.899e-4028.23Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068WQZ44.225e-3926.53Neurabin 1 OS=Echinococcus granulosus OX=6210 GN=E... [more]
A0A068XVG98.616e-3926.94Neurabin 1 OS=Echinococcus multilocularis OX=6211 ... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf687b4.448e-719.76zinc finger protein 687b-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf5328.306e-723.55zinc finger protein 532 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000027290.10.000e+099.65SMESG000027290.1[more]
SMESG000027290.10.000e+099.40SMESG000027290.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025511 ID=SMED30025511|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3817bp
GCTACTGTGGTTAAGTTATAATTAATAATTTAGTAGTTTATATTTTTTGT
AATATTTTTTATGTAAAGTAATTTTTTATATTTCTTCTGATGATATGAAT
AAAAAATTTGAATTATGAAATTTCCAAAATATATAATATTAATAAATTTT
TATGGTTTTATCAGTTAATGCAACCGAGGACTATTGATAATGATTTAATA
ATTGTGGCCGAAGATATTCCCGCCGTACGAACTCATTGCTTACTTTCAAA
GTACAAGGTTAAAAATGAAAGTATCATAAATGAAACTGTAGATTTGACTC
AAATGGCTTCACCACCAGCTAGTGAAGTCACCCTTAGAAATCCAGTGCAA
TATCAAATTCGTCCACAATATCAAATAAATCCAATTCGTTTTCGAAATGA
GTTATCAAATCAACCGTTCTTGAATATTTGCTCTCAAAGTAACACCATGC
AAACTAACAATCATCAAAGGAATCTCATTACAGACATTCATATTAATCGA
AACAGGACTGGGCCAACTTACATTAATGGGAATGTTTCTAATACCGCTAT
CGTAAGTAATGGAAGCAATGTACAGCCGATTTTGCCAAGCAATATTTCAA
TTAATCCCAAACCGCCTCAACCAAATATTGAGCTAGATTTAACGGACTCT
AATAAAGATTTAGCAGTGACAAGTCTACCGGATTTGCTCGGTTTCATACA
CAATAGAAAAGGCTGTACAAATGCTACCGAATTGCAGAATATCGGCAGTG
TCAATATGCACGAATTTCTAAAATCCACTCCGGCCGAATCGTTTTCCCGA
AAAGGATTCTATTCTTGTGCTGGTTGCTCATCAAAATTCACATCGTCAGA
TATGTATAACTTTCATTTAAGGCGGCAAATCGGAGATTTCTCATATGATT
GTGTGCACTGCTCGAAAGTGATAAAAATGACGAATATTTGCCAGATCGTT
ATCCATCTGCTCACTAATCATAAAATATCCACTATTGCAATGGATAAGCT
GTCCTTTAAGTCGTTTCTAAACATTAATGATTCAGTTGAAGAAGTAAATG
AAGATTTTGAAGAAATGGCAAAGAGTACAATAAAAAAATGTATTGAGAAC
TTTCTCAACGATTGGAACGTCGACATGTTCAATTCATTTCAAAGAGCACC
GAAAGACCAGCGATATTATCTATTACCGATGGCCAGGAAAGATGTTGTTC
AATCTCATAAGTTTTACTCTGACCATTATCGAGCAGCCAATCAGAAATTG
AAAGAATATCCCGTCGAGCTCATGCATTGTTTCATGTGTAATTTCGTGTG
TGAAAGCCACAGTGATCTCATCAGCCATCTACAAGGCGACTGGCCTAACA
GCGTGACAAAATGTGCCTTCTGTACCCTTTCGGTTCCGCTGAACAAGGAA
TACCTCTGTGCCGCAAAGGCGCATGTCCTACTGCACATGGGCATTTTCAT
CATGTGTCCTCGATGCGGATTTGTGCCTCCACCCGATTTGAATCCAGAGG
AATTTGAAATAACTCTTCGACTTCACCTGAGATATGTTTGCTTTCATTTC
AACTTAATCCAAATTTATATTTGTCCACACTGTGGCGATTCAAATAGCAA
AGCTTTTAATACTTCAAATCAAGTTACGATGCATATTTTTGATGAGCATC
TAACTGAATTCAGATCCTGTTCGATTTGCAGTACTAATAACAATATTCCT
AGCGAAGGGCCATTCAGACACTTTGAAATGACTCAGCATCTAGTCTCAGC
CCATAACAGAGCAGATATTGCTATCGTGTGGAATGATTGCCCCATTGCTG
GCAAGAAGTGCAACGAATGTTCAGAGATTATTGCACAACGCGATTCATAT
TTTTCACACATGACGAATAATCACAAAACTCTAATTGTCAAAGGCAAGTC
AGCATTTCGATGTTTCGGAACCTGCAAAAGAATCCACCAATCTATCGACG
AGTTTCAAAGTCACAGATCTGAATGTTCCGAGTGCATTAATGTCAAAAAC
AAATTATATCAGCCTCATTTACCCAACGCTTCTCCTGAATTGACTTCTTT
ATGTTTCTGCCTTTATTGTGGAGTTGGAGTTCGTCGCAAACGACTCGAAA
ATGGTGAAATTGAAACCCAAAGTGAACCGCAAATGTTTGCAAATCTCAGC
CTTACACATGAACACGAACAAGATCATATCTTATGCGAGACGAATATCAC
AGCCTGCCCGTGGTGCCCCAATCGAATGTCGGCTAAAATCAATGAAATGA
CTCAGCACATGGAGACTCATTTACCAGAAAATTGGTTTCTATCATGGTAC
ACAAAACGAGCACAAAAATACAATTATAATCGGAATGATATAGTGAATTG
CTATTGCTTTGCCGCAATCGATAATCCGTTGTCACTTCACTGCCATGCCA
TACCCCAGATGCTGGGAACTGCCAGTTCGAATGGATCTTCATCCAAGCAT
TTGGCATTGACTGACTCTATTCACAGGGAATTCCTTACTGCACCTCGGCA
CCGAGTTCCCGGTACCTGCCCCATGTGTACCGAATCAGATATTATTACCA
ACTCAATAGATATGTCGTGGCATATTTTTTTTAAACACAGAAATATACTC
TGCTACGTATGCAAAAATTTCCGCCTACTAAATGCTGATAACAGTCCAAA
ATGCCGCATTACAATGTGGAATCATGTATATTCGTGTTTGAGACGGCATA
CTCCACGATTCAACTTGAAATCTGGCCTCACGTTGTTACAATCAATCGCG
AATTGTGAAACAGTTATGTCAGATTGCACTGTATTTGATTTGAAAAAGTC
TGGTGAAATCCACGTTGGATTATTTGCTGATCCTGGCGATCCGGATGATC
AAGCTCTCAGTAGTGGCAATACAGAACTTGCGAAAAGTGCATTTTCTGAT
ACGAAATTCGAGTGTGGATTTTGCAGAGAAACTGCAATCCAGTCGAATTT
CTTTTCCTCGAGAACATTGCTCAATGAGCACCTGAAAGCCTGTCATGGTA
TCACAGCGGATCAGCAGAGTGCTGACGATTTCCTATGTTACATTTGCGGG
CTCAAATTTGACTCCCGTGACAAGTGGGAAGATCACACGCTTGCAGAGCA
CTCTAAAGGTTTTAGAAAACTCGGACTCAGCTTAATCAATCCGACATCCG
TCGTTCTCGATACTACTTGTATCTCATATCGGTGTTATCTATGTAATCAC
AGATTCGATAAAAAGATATCATGTGCCAATCACATGAAGGATAACCATTC
CATTGATGATAGTGAGCTCAATTGGGGCATGTTAACCGATTCATCAGATA
CTAATAAAAGAGCAAAACAGACAATCAATAGTTCTAAAATGTGTTTGTCC
ACATATCCATCTAAGCGTCTAAAAGTCGAAGATAGCTTGAATACAGAGGA
AAGCGTATATGTTTGCGGAATCTGCCCGTTTCAGTGCAATGCACGGAAAG
AAATGATCGATCATGCAATCTCATTCCACGTGAAGTCGTCAGAGAAATCA
TTGAACAGCACTAACTGCTTTGTGTGTCCAGATTGCGCTCTCTCCTTCAT
TTCCAACAGATCTCGTGCTATTCATCTGAAACTTGTCCATAGAATCTCTA
ATCCCACTTTGTTTATGGAGCAATTTTCAGATAGTTGAATGGAATAATAA
TGGCGCCAACACAGATGCCAATCACTATGAGGCGAAAATATTCTGTACAA
TAATATGTAAATTTCAAATGTTTTTATTGCTCATAGTTGATATAATATGA
GGAAGTTGTTGAATGTTTTTCTATTTTGGTTATTATTGATTTGTGTGATA
TTTTCCATTGATTTTTG
back to top

protein sequence of SMED30025511-orf-1

>SMED30025511-orf-1 ID=SMED30025511-orf-1|Name=SMED30025511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1157bp
MQPRTIDNDLIIVAEDIPAVRTHCLLSKYKVKNESIINETVDLTQMASPP
ASEVTLRNPVQYQIRPQYQINPIRFRNELSNQPFLNICSQSNTMQTNNHQ
RNLITDIHINRNRTGPTYINGNVSNTAIVSNGSNVQPILPSNISINPKPP
QPNIELDLTDSNKDLAVTSLPDLLGFIHNRKGCTNATELQNIGSVNMHEF
LKSTPAESFSRKGFYSCAGCSSKFTSSDMYNFHLRRQIGDFSYDCVHCSK
VIKMTNICQIVIHLLTNHKISTIAMDKLSFKSFLNINDSVEEVNEDFEEM
AKSTIKKCIENFLNDWNVDMFNSFQRAPKDQRYYLLPMARKDVVQSHKFY
SDHYRAANQKLKEYPVELMHCFMCNFVCESHSDLISHLQGDWPNSVTKCA
FCTLSVPLNKEYLCAAKAHVLLHMGIFIMCPRCGFVPPPDLNPEEFEITL
RLHLRYVCFHFNLIQIYICPHCGDSNSKAFNTSNQVTMHIFDEHLTEFRS
CSICSTNNNIPSEGPFRHFEMTQHLVSAHNRADIAIVWNDCPIAGKKCNE
CSEIIAQRDSYFSHMTNNHKTLIVKGKSAFRCFGTCKRIHQSIDEFQSHR
SECSECINVKNKLYQPHLPNASPELTSLCFCLYCGVGVRRKRLENGEIET
QSEPQMFANLSLTHEHEQDHILCETNITACPWCPNRMSAKINEMTQHMET
HLPENWFLSWYTKRAQKYNYNRNDIVNCYCFAAIDNPLSLHCHAIPQMLG
TASSNGSSSKHLALTDSIHREFLTAPRHRVPGTCPMCTESDIITNSIDMS
WHIFFKHRNILCYVCKNFRLLNADNSPKCRITMWNHVYSCLRRHTPRFNL
KSGLTLLQSIANCETVMSDCTVFDLKKSGEIHVGLFADPGDPDDQALSSG
NTELAKSAFSDTKFECGFCRETAIQSNFFSSRTLLNEHLKACHGITADQQ
SADDFLCYICGLKFDSRDKWEDHTLAEHSKGFRKLGLSLINPTSVVLDTT
CISYRCYLCNHRFDKKISCANHMKDNHSIDDSELNWGMLTDSSDTNKRAK
QTINSSKMCLSTYPSKRLKVEDSLNTEESVYVCGICPFQCNARKEMIDHA
ISFHVKSSEKSLNSTNCFVCPDCALSFISNRSRAIHLKLVHRISNPTLFM
EQFSDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 215..235
e-value: 210.0
score: 1.5
coord: 955..978
e-value: 7.9
score: 14.2
coord: 1081..1104
e-value: 1.6
score: 17.7
coord: 678..701
e-value: 7.5
score: 14.4
coord: 1004..1027
e-value: 2.1
score: 17.4
coord: 914..943
e-value: 15.0
score: 11.8
coord: 782..807
e-value: 140.0
score: 3.0
coord: 467..494
e-value: 0.27
score: 20.3
coord: 546..569
e-value: 6.4
score: 15.0
coord: 369..389
e-value: 130.0
score: 3.5
coord: 243..268
e-value: 98.0
score: 4.5
coord: 1118..1141
e-value: 0.88
score: 18.6
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 1120..1141
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 957..978
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 548..569
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 1006..1027
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 1118..1146
score: 9.473
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 1004..1032
score: 9.016
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 891..982
e-value: 3.2E-5
score: 25.8
NoneNo IPR availablePANTHERPTHR24408:SF38MEP-1, ISOFORM A-RELATEDcoord: 905..1145
coord: 210..530
NoneNo IPR availablePANTHERPTHR24408FAMILY NOT NAMEDcoord: 210..530
NoneNo IPR availablePANTHERPTHR24408FAMILY NOT NAMEDcoord: 905..1145