UHRF1-binding protein 1-like

Overview
NameUHRF1-binding protein 1-like
Smed IDSMED30025510
Length (bp)3861
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UHRF1-binding protein 1-like (SMED30025510) t-SNE clustered cells

Violin plots show distribution of expression levels for UHRF1-binding protein 1-like (SMED30025510) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UHRF1-binding protein 1-like (SMED30025510) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UHRF1-binding protein 1-like (SMED30025510) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025510

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025510SMESG000044305.1 dd_Smed_v4_11401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025510SMESG000044305.1 dd_Smed_v4_11401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025510SMESG000044305.1 dd_Smed_v4_11401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30025510SMESG000044305.1 dd_Smed_v4_11401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025510SMESG000044305.1 dd_Smed_v4_11401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30025510SMESG000044305.1 dd_Smed_v4_11401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UHRF1-binding protein 1-like vs. Ensembl Human
Match: UHRF1BP1L (UHRF1 binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:29102])

HSP 1 Score: 327.02 bits (837), Expect = 9.437e-92
Identity = 231/750 (30.80%), Postives = 367/750 (48.93%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNI--RPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT-----------------------------------NTYTRK-----------SSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDN--------------VCQTNSDCDVIHQVVQEYHRS--NFFNGHTDF----------LFDISGSMGNVKTNTNKSG-KSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG++ NLELDE  L  +L+LP+W+ I +  CNK SI++ WT +K  PI L LD VI+ +   + PR PN       P+P A       YGF ++V++G+ + +N + I   AKAF AS EL++L + S   +W   D L+ TRI+   +G VL FKEI W   RIEA+  Q         PV+LITN +K+R+T+K+ L D ++I +K   IL DL WVLT SQ+KA + + +SL E I +S +  K  A    E T++S +    + +    ++N    N  +   KLF  +++KETS+H+++S ++ H C++       S   +  G+++   T   ID YPYH A  + +H+  + +  + +N W                                     +T T K           S      K ++M S  +VR  D +++ VSTA++  +     +  +     LP + +  +++ T++Y+  G    +P   LY Q+N L   +D  +I+WLN F L LK  L      N F+      + S   +H  + ++ +M +  +  +       D+P+ I IQ   +   N              + Q   DCD   +    + +S  NF   H  F          + +I    GN+    NK+  K++   D  +W +     WIDYEG KS   +P SF+DS  L++WI
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGELKNLELDEEVLQNMLDLPTWLAINKVFCNKASIRIPWTKLKTHPICLSLDKVIMEMSTCEEPRSPN------GPSPIATASGQSEYGFAEKVVEGISVSVNSIVIRIGAKAFNASFELSQLRIYSVNAHWEHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDDLLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAP---EPTQSSTVVASAQQVKTTQTSNAPDVN--DAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRITGGAMQLSFTQLTIDYYPYHKAGDSCNHWMYFSDATKTKNGWANELLHEFECNVEMLKQAVKDHNVGSPPKSPTHASPQHTQTEKDYPLKGTCRTPSVLSQQSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSPKSMICCNKKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSL------NQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHEQDTKMHEI--YKGNITPQLNKNTLKTSAATD--VWAVYFSQFWIDYEGMKSGKGRPISFVDSFPLSIWI 728          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Human
Match: UHRF1BP1 (UHRF1 binding protein 1 [Source:HGNC Symbol;Acc:HGNC:21216])

HSP 1 Score: 304.294 bits (778), Expect = 3.320e-84
Identity = 212/740 (28.65%), Postives = 346/740 (46.76%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKD-NINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEA----NGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-------QKLFQKYNLKETSYHVLVSRIEFHFCEEGD-QSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV-------------------------------------------------TNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNN--CLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQ-LIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGS--------------MGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISI 2002
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +LELP+W+ I R  CN+ SI++QWT +K  PI L LD V + ++  + PR PN      +    + YGF ++V++GM I +N + I   +KAF AS EL +L   S  PNW  SD L+ TRI    +G VL FKEI W + RIEA    NG QD   TP++LITN  ++++ +K+   D ++I SK  F+L DL WVLT SQ+KA + + ESL E       M K A + +  A     I P       S   +F  +  N         + F+K+++KE+SYH+L+SR++ H C++   +   +S N +  G+++        D YP+H A  +  H+  + E    R  W                                                  + +  R+ +F     N++  S  +VR +D+ +H VSTA + +      +S     H LP + +   ++ T++Y+       +P   LY Q+N L   +D  +++W N F L L   L+  +        ++ S   +H  I ++A   +++   +K    +  RPQ L+    G +  +     +  C  +  + + +  + FF+ + D    + G               M +     N            LW +    I +D+EG +++     +F+    L++W  +
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNVLELPTWLAITRVYCNRASIRIQWTKLKTHPICLCLDKVEVEMKTCEDPRPPNGQSPIALASGQSEYGFAEKVVEGMFIIVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSD-LRLTRITDPCRGEVLTFKEITWQTLRIEADATDNGDQDPVTTPLRLITNQGRIQIALKRRTKDCNVISSKLMFLLDDLLWVLTDSQLKAMMKYAESLSEA------MEKSAHQRKSLAPEPVQITPPAPSAQQSWAQAFGGSQGNSNSSSSRLSQYFEKFDVKESSYHLLISRLDLHICDDSQSREPGVSANRLMGGAMQLTFRKMAFDYYPFHWAGDSCKHWVRHCEAMETRGQWAQKLVMEFQSKMEKWHEETGLKPPWHLGVDSLFRRKADSLSSPRKNPLERSPSQGRQPAFQPPAWNRLRSSCMVVRVDDLDIHQVSTAGQPSKKPSTLLSCSRKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKL---EDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVAPFPLSIWACL 730          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Human
Match: UHRF1BP1 (UHRF1 binding protein 1 [Source:HGNC Symbol;Acc:HGNC:21216])

HSP 1 Score: 303.908 bits (777), Expect = 3.632e-84
Identity = 212/740 (28.65%), Postives = 346/740 (46.76%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKD-NINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEA----NGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-------QKLFQKYNLKETSYHVLVSRIEFHFCEEGD-QSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV-------------------------------------------------TNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNN--CLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQ-LIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGS--------------MGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISI 2002
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +LELP+W+ I R  CN+ SI++QWT +K  PI L LD V + ++  + PR PN      +    + YGF ++V++GM I +N + I   +KAF AS EL +L   S  PNW  SD L+ TRI    +G VL FKEI W + RIEA    NG QD   TP++LITN  ++++ +K+   D ++I SK  F+L DL WVLT SQ+KA + + ESL E       M K A + +  A     I P       S   +F  +  N         + F+K+++KE+SYH+L+SR++ H C++   +   +S N +  G+++        D YP+H A  +  H+  + E    R  W                                                  + +  R+ +F     N++  S  +VR +D+ +H VSTA + +      +S     H LP + +   ++ T++Y+       +P   LY Q+N L   +D  +++W N F L L   L+  +        ++ S   +H  I ++A   +++   +K    +  RPQ L+    G +  +     +  C  +  + + +  + FF+ + D    + G               M +     N            LW +    I +D+EG +++     +F+    L++W  +
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNVLELPTWLAITRVYCNRASIRIQWTKLKTHPICLCLDKVEVEMKTCEDPRPPNGQSPIALASGQSEYGFAEKVVEGMFIIVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSD-LRLTRITDPCRGEVLTFKEITWQTLRIEADATDNGDQDPVTTPLRLITNQGRIQIALKRRTKDCNVISSKLMFLLDDLLWVLTDSQLKAMMKYAESLSEA------MEKSAHQRKSLAPEPVQITPPAPSAQQSWAQAFGGSQGNSNSSSSRLSQYFEKFDVKESSYHLLISRLDLHICDDSQSREPGVSANRLMGGAMQLTFRKMAFDYYPFHWAGDSCKHWVRHCEAMETRGQWAQKLVMEFQSKMEKWHEETGLKPPWHLGVDSLFRRKADSLSSPRKNPLERSPSQGRQPAFQPPAWNRLRSSCMVVRVDDLDIHQVSTAGQPSKKPSTLLSCSRKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKL---EDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVAPFPLSIWACL 730          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Human
Match: UHRF1BP1L (UHRF1 binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:29102])

HSP 1 Score: 262.692 bits (670), Expect = 9.352e-76
Identity = 171/524 (32.63%), Postives = 273/524 (52.10%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNI--RPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT-----------------------------------NTYTRK-----------SSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSG 1408
            M   +K QILKHL+++TKNLSP+KI ++  KGEG++ NLELDE  L  +L+LP+W+ I +  CNK SI++ WT +K  PI L LD VI+ +   + PR PN       P+P A       YGF ++V++G+ + +N + I   AKAF AS EL++L + S   +W   D L+ TRI+   +G VL FKEI W   RIEA+  Q         PV+LITN +K+R+T+K+ L D ++I +K   IL DL WVLT SQ+KA + + +SL E I +S +  K  A    E T++S +    + +    ++N    N  +   KLF  +++KETS+H+++S ++ H C++       S   +  G+++   T   ID YPYH A  + +H+  + +  + +N W                                     +T T K           S      K ++M S  +VR  D +++ VSTA++  +     +  +     LP + +  +++ T++Y+  G
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGELKNLELDEEVLQNMLDLPTWLAINKVFCNKASIRIPWTKLKTHPICLSLDKVIMEMSTCEEPRSPN------GPSPIATASGQSEYGFAEKVVEGISVSVNSIVIRIGAKAFNASFELSQLRIYSVNAHWEHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDDLLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAP---EPTQSSTVVASAQQVKTTQTSNAPDVN--DAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRITGGAMQLSFTQLTIDYYPYHKAGDSCNHWMYFSDATKTKNGWANELLHEFECNVEMLKQAVKDHNVGSPPKSPTHASPQHTQTEKDYPLKGTCRTPSVLSQQSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSPKSMICCNKKSLYLPQEMSAVYIEFTEYYYPDG 512          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Human
Match: UHRF1BP1L (UHRF1 binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:29102])

HSP 1 Score: 93.9745 bits (232), Expect = 1.282e-18
Identity = 90/388 (23.20%), Postives = 153/388 (39.43%), Query Frame = 2
Query: 1067 VKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT-----------------------------------NTYTRK-----------SSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNCL--FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDN--------------VCQTNSDCDVIHQVVQEYHRS--NFFNGHTDF----------LFDISGSMGNVKTNTNKSG-KSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            ++   T   ID YPYH A  + +H+  + +  + +N W                                     +T T K           S      K ++M S  +VR  D +++ VSTA++  +     +  +     LP + +  +++ T++Y+  G    +P   LY Q+N L   +D  +I+WLN F L LK  L      N F+      + S   +H  + ++ +M +  +  +       D+P+ I IQ   +   N              + Q   DCD   +    + +S  NF   H  F          + +I    GN+    NK+  K++   D  +W +     WIDYEG KS   +P SF+DS  L++WI
Sbjct:    1 MQLSFTQLTIDYYPYHKAGDSCNHWMYFSDATKTKNGWANELLHEFECNVEMLKQAVKDHNVGSPPKSPTHASPQHTQTEKDYPLKGTCRTPSVLSQQSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSPKSMICCNKKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSL------NQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHEQDTKMHEI--YKGNITPQLNKNTLKTSAATD--VWAVYFSQFWIDYEGMKSGKGRPISFVDSFPLSIWI 378          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Celegans
Match: C44H4.4 (pep chromosome:WBcel235:X:14568854:14589101:-1 gene:WBGene00008094.1 transcript:C44H4.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C44H4.4)

HSP 1 Score: 243.047 bits (619), Expect = 6.527e-66
Identity = 193/762 (25.33%), Postives = 355/762 (46.59%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNP-------NAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEA------NGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKN-SVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKN-------------QIMESVTLVRFNDISMHCVSTAQKTNNCL--FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISISNSPSSEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETAPTSVSTINMILQIDK 2218
            MTS +KNQ++KHL+K+TKNL PE+I ++  KG   +  +E++E  LTE+LELPSW+KIKRA C  V++ V WT +K  PI + +D++ + VE+       N+ K     NP       ++YGF++++I+ M + I+ V I F +  F  S  L RLSV S+ P W+    L++TRI        L+FK++ W   RIEA      N  +     P++LIT+  K+R+ +KK++ D S+I ++ + IL D+ WV T+ Q+++AI F   + +++       KE+ K  +  T + N  P +    NS      +T+++   +F      +TSYH+ V +I+ H C++   +S    +  + +G+++  L    ID+YP   A   R  +  Y   + +   W  N  + +   ++ +               Q++    ++R +D+++ CVS      + L     S+   H LP+      ++    Y        +P + +Y Q+ P  ++ D  T+ W      +L + ++     +  L  +     Q  P I +  +MPR+ L                          N+    +D +   ++V      +  +   DF  +    + +  T+ +   K+   N  + + IC  P+WI+ +        P  FL  V     ++I      ++ ++ +  + + + VDHYQ L + R+ D  +  L  +  D   +  ++  P S  T++ +  I +
Sbjct:    1 MTSIIKNQLVKHLSKFTKNLKPEQISLDVLKGNSKLQFIEINEDVLTEILELPSWLKIKRAFCTGVAVNVPWTKLKTCPIQIFIDEINVDVELT------NEHKKQAKSNPLGNLGDSSSYGFMNKIIENMSLYISSVEINFDSDVFGGSFMLQRLSVESRSPGWAQVKDLRQTRITCSETNRTLMFKQLSWHLLRIEASAKTSKNEQRSKINAPLRLITSGGKIRIALKKNVNDGSVIHARIQTILDDILWVATLPQLRSAISFASYIAKLV-------KESQKNDVITTSSGNDNPFMKAAGNSATAD-ASTISSAYNIFY---FDQTSYHLHVKKIDLHLCDDAHTASDYPPDWDIESGAMQVTLYQVLIDVYPKAHAQSDRSTWMRYSNTNPIA-AWFRNHLSEQFLTLLGNAEGQTTRTRLERCWPQLIGFFVVLRVHDLTIQCVSDMNTKKDALTNLFESERHLHSLPSDQQIVHVEFGAFYHPHSDKLPVPNSAVYFQLGPFTISFDERTMRWCCYVAHALSSAIE-----DGNLIPENELDIQP-PTIKVNLVMPRLVL--------------------------NLPGPFTDFNFPRRLVTSMSTLSISSSQIDFKENSRFRILSESTDEHSDVKNQLINGLNKFHICTSPVWIEIDHGPQTKGFP--FLHDVSFNGILAIDK---DKVNVLVEPAEDVAVVVDHYQFLQLTRLGDKFTKFLDQLTLDMKHYNTNK--PKSDVTVDFLASIAR 705          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Fly
Match: CG34126 (gene:FBgn0083962 transcript:FBtr0290010)

HSP 1 Score: 268.47 bits (685), Expect = 6.311e-73
Identity = 162/409 (39.61%), Postives = 241/409 (58.92%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRK-------------PNKFKDNINPN-PNA-YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELI--INDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFC-EEGDQSSS---LSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M S +KNQ+LKHL+ YTKNLS +KI ++ F+GEG++ NLELDE  LTELLELPSW+++  A CN VS ++ WT +K  PI L LD+V I++E  +   +             P        P  P   Y FI +V+DG+ I +N V + F + AF AS++++R+ V SK P W+++D L+ TR+K   +G +L+FKE+ W + RIEA+  QD   TP++L+TN  + R+T++K L+D S++ S+   IL DL WVLT SQ+KAA+ F +SL  +I  +       A  + +A R     PE    +       S +    N Q++F  ++++ETSYH    RI+ H C +EGD  SS   L K     G+++  +T  Q+D YPYH+A   R H+  YKE      +W+
Sbjct:    1 MVSLIKNQLLKHLSIYTKNLSSDKINLSTFRGEGELSNLELDERVLTELLELPSWLRLTSAWCNHVSFRISWTKLKSVPITLTLDEVRITIETCNPTTRDAGGGSGAGGAGSPTAAASAALPQVPQGKYSFIHKVVDGITIVVNTVNVNFVSAAFTASVQMSRIRVESKTPKWANAD-LRLTRLKDAQKGIILIFKELSWQTVRIEASSTQDKSLTPLRLLTNHARCRITIRKRLSDCSLLASRLVLILDDLLWVLTDSQLKAALHFVDSLSGLIKAATH-----ATQKTKAARKMQTLPEYKAQVEQQQNRLSESAHTTNAQRMFNAFDVRETSYHFFSQRIDLHLCDDEGDGRSSYPDLDK----GGALQVSVTAFQVDYYPYHLAKSDRSHWAKYKEASVAPALWL 399          

HSP 2 Score: 94.7449 bits (234), Expect = 4.893e-19
Identity = 74/313 (23.64%), Postives = 138/313 (44.09%), Query Frame = 2
Query: 1217 IDDKNQIMESVTLVRFNDISMHCVST-AQKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNE-LKLSQCANSFLTSQE------------------PSSCQKHP-----AIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGH------------TD-FLFDISGSMGNVKTNTNKSGKSNRDN--------------DKSLWQICCEPIWIDYEGAKSYN-NKPKSFLDSVHLTLWI 1996
            +++  ++M S  ++R  D +++ V+T  +K     FVS D  R+  PA+      + T  Y+       LP + ++  +NP+ ++ D  +I+WLN+F L+L    L+ S  + S L  Q+                    + ++ P      + +EAIMPRI +        Q DRP+ +QIQV    + N+ +  S    + Q +      +   G             TD  L  ++ S  ++ +  + +G+    +               + +W I  +P+W+D+ GA+S   NK   F+D+V +TLW+
Sbjct:  491 LENLAKLMSSCVILRIEDFTLYRVTTSGKKAMPKEFVSGDKDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTLHPQQQLPRGSIASNGSNGTQMAAVNVEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSGFPSKEGDMCIVTDRILSHVAASDVSMMSPVSPTGQQLPRSASTQYLSRYVMWLEPRDVWCIKLDPVWVDFLGARSLGPNKSIPFVDAVPITLWL 803          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Fly
Match: CG34126 (gene:FBgn0083962 transcript:FBtr0329977)

HSP 1 Score: 268.47 bits (685), Expect = 7.057e-73
Identity = 157/409 (38.39%), Postives = 231/409 (56.48%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXX-------------XXXXXXXXXXXXXPRKPNKFKDNINPN-PNA-YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELI--INDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFC-EEGDQSSS---LSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M S +KNQ+LKHL+ YTKNLS +KI ++ F+GEG++ NLELDE  LTELLELPSW+++  A CN VS ++ WT +K  PI L                              P        P  P   Y FI +V+DG+ I +N V + F + AF AS++++R+ V SK P W+++D L+ TR+K   +G +L+FKE+ W + RIEA+  QD   TP++L+TN  + R+T++K L+D S++ S+   IL DL WVLT SQ+KAA+ F +SL  +I  +       A  + +A R     PE    +       S +    N Q++F  ++++ETSYH    RI+ H C +EGD  SS   L K     G+++  +T  Q+D YPYH+A   R H+  YKE      +W+
Sbjct:    1 MVSLIKNQLLKHLSIYTKNLSSDKINLSTFRGEGELSNLELDERVLTELLELPSWLRLTSAWCNHVSFRISWTKLKSVPITLTLDEVRITIETCNPTTRDAGGGSGAGGAGSPTAAASAALPQVPQGKYSFIHKVVDGITIVVNTVNVNFVSAAFTASVQMSRIRVESKTPKWANAD-LRLTRLKDAQKGIILIFKELSWQTVRIEASSTQDKSLTPLRLLTNHARCRITIRKRLSDCSLLASRLVLILDDLLWVLTDSQLKAALHFVDSLSGLIKAATH-----ATQKTKAARKMQTLPEYKAQVEQQQNRLSESAHTTNAQRMFNAFDVRETSYHFFSQRIDLHLCDDEGDGRSSYPDLDK----GGALQVSVTAFQVDYYPYHLAKSDRSHWAKYKEASVAPALWL 399          

HSP 2 Score: 86.6557 bits (213), Expect = 1.149e-16
Identity = 74/323 (22.91%), Postives = 139/323 (43.03%), Query Frame = 2
Query: 1217 IDDKNQIMESVTLVRFNDISMHCVST-AQKTNNCLFVSS----------DIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNE-LKLSQCANSFLTSQE------------------PSSCQKHP-----AIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGH------------TD-FLFDISGSMGNVKTNTNKSGKSNRDN--------------DKSLWQICCEPIWIDYEGAKSYN-NKPKSFLDSVHLTLWI 1996
            +++  ++M S  ++R  D +++ V+T  +K     FVS+          D  R+  PA+      + T  Y+       LP + ++  +NP+ ++ D  +I+WLN+F L+L    L+ S  + S L  Q+                    + ++ P      + +EAIMPRI +        Q DRP+ +QIQV    + N+ +  S    + Q +      +   G             TD  L  ++ S  ++ +  + +G+    +               + +W I  +P+W+D+ GA+S   NK   F+D+V +TLW+
Sbjct:  491 LENLAKLMSSCVILRIEDFTLYRVTTSGKKAMPKEFVSAQHKRKTKSSGDKDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTLHPQQQLPRGSIASNGSNGTQMAAVNVEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSGFPSKEGDMCIVTDRILSHVAASDVSMMSPVSPTGQQLPRSASTQYLSRYVMWLEPRDVWCIKLDPVWVDFLGARSLGPNKSIPFVDAVPITLWL 813          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Fly
Match: CG34126 (gene:FBgn0083962 transcript:FBtr0329975)

HSP 1 Score: 268.47 bits (685), Expect = 7.506e-73
Identity = 157/409 (38.39%), Postives = 231/409 (56.48%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXX-------------XXXXXXXXXXXXXPRKPNKFKDNINPN-PNA-YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELI--INDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFC-EEGDQSSS---LSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M S +KNQ+LKHL+ YTKNLS +KI ++ F+GEG++ NLELDE  LTELLELPSW+++  A CN VS ++ WT +K  PI L                              P        P  P   Y FI +V+DG+ I +N V + F + AF AS++++R+ V SK P W+++D L+ TR+K   +G +L+FKE+ W + RIEA+  QD   TP++L+TN  + R+T++K L+D S++ S+   IL DL WVLT SQ+KAA+ F +SL  +I  +       A  + +A R     PE    +       S +    N Q++F  ++++ETSYH    RI+ H C +EGD  SS   L K     G+++  +T  Q+D YPYH+A   R H+  YKE      +W+
Sbjct:    1 MVSLIKNQLLKHLSIYTKNLSSDKINLSTFRGEGELSNLELDERVLTELLELPSWLRLTSAWCNHVSFRISWTKLKSVPITLTLDEVRITIETCNPTTRDAGGGSGAGGAGSPTAAASAALPQVPQGKYSFIHKVVDGITIVVNTVNVNFVSAAFTASVQMSRIRVESKTPKWANAD-LRLTRLKDAQKGIILIFKELSWQTVRIEASSTQDKSLTPLRLLTNHARCRITIRKRLSDCSLLASRLVLILDDLLWVLTDSQLKAALHFVDSLSGLIKAATH-----ATQKTKAARKMQTLPEYKAQVEQQQNRLSESAHTTNAQRMFNAFDVRETSYHFFSQRIDLHLCDDEGDGRSSYPDLDK----GGALQVSVTAFQVDYYPYHLAKSDRSHWAKYKEASVAPALWL 399          

HSP 2 Score: 93.9745 bits (232), Expect = 6.952e-19
Identity = 74/313 (23.64%), Postives = 138/313 (44.09%), Query Frame = 2
Query: 1217 IDDKNQIMESVTLVRFNDISMHCVST-AQKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNE-LKLSQCANSFLTSQE------------------PSSCQKHP-----AIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGH------------TD-FLFDISGSMGNVKTNTNKSGKSNRDN--------------DKSLWQICCEPIWIDYEGAKSYN-NKPKSFLDSVHLTLWI 1996
            +++  ++M S  ++R  D +++ V+T  +K     FVS D  R+  PA+      + T  Y+       LP + ++  +NP+ ++ D  +I+WLN+F L+L    L+ S  + S L  Q+                    + ++ P      + +EAIMPRI +        Q DRP+ +QIQV    + N+ +  S    + Q +      +   G             TD  L  ++ S  ++ +  + +G+    +               + +W I  +P+W+D+ GA+S   NK   F+D+V +TLW+
Sbjct:  491 LENLAKLMSSCVILRIEDFTLYRVTTSGKKAMPKEFVSGDKDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTLHPQQQLPRGSIASNGSNGTQMAAVNVEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSGFPSKEGDMCIVTDRILSHVAASDVSMMSPVSPTGQQLPRSASTQYLSRYVMWLEPRDVWCIKLDPVWVDFLGARSLGPNKSIPFVDAVPITLWL 803          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Fly
Match: CG34126 (gene:FBgn0083962 transcript:FBtr0329974)

HSP 1 Score: 268.085 bits (684), Expect = 7.865e-73
Identity = 162/409 (39.61%), Postives = 241/409 (58.92%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRK-------------PNKFKDNINPN-PNA-YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELI--INDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFC-EEGDQSSS---LSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M S +KNQ+LKHL+ YTKNLS +KI ++ F+GEG++ NLELDE  LTELLELPSW+++  A CN VS ++ WT +K  PI L LD+V I++E  +   +             P        P  P   Y FI +V+DG+ I +N V + F + AF AS++++R+ V SK P W+++D L+ TR+K   +G +L+FKE+ W + RIEA+  QD   TP++L+TN  + R+T++K L+D S++ S+   IL DL WVLT SQ+KAA+ F +SL  +I  +       A  + +A R     PE    +       S +    N Q++F  ++++ETSYH    RI+ H C +EGD  SS   L K     G+++  +T  Q+D YPYH+A   R H+  YKE      +W+
Sbjct:    1 MVSLIKNQLLKHLSIYTKNLSSDKINLSTFRGEGELSNLELDERVLTELLELPSWLRLTSAWCNHVSFRISWTKLKSVPITLTLDEVRITIETCNPTTRDAGGGSGAGGAGSPTAAASAALPQVPQGKYSFIHKVVDGITIVVNTVNVNFVSAAFTASVQMSRIRVESKTPKWANAD-LRLTRLKDAQKGIILIFKELSWQTVRIEASSTQDKSLTPLRLLTNHARCRITIRKRLSDCSLLASRLVLILDDLLWVLTDSQLKAALHFVDSLSGLIKAATH-----ATQKTKAARKMQTLPEYKAQVEQQQNRLSESAHTTNAQRMFNAFDVRETSYHFFSQRIDLHLCDDEGDGRSSYPDLDK----GGALQVSVTAFQVDYYPYHLAKSDRSHWAKYKEASVAPALWL 399          

HSP 2 Score: 94.7449 bits (234), Expect = 4.282e-19
Identity = 74/313 (23.64%), Postives = 138/313 (44.09%), Query Frame = 2
Query: 1217 IDDKNQIMESVTLVRFNDISMHCVST-AQKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNE-LKLSQCANSFLTSQE------------------PSSCQKHP-----AIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGH------------TD-FLFDISGSMGNVKTNTNKSGKSNRDN--------------DKSLWQICCEPIWIDYEGAKSYN-NKPKSFLDSVHLTLWI 1996
            +++  ++M S  ++R  D +++ V+T  +K     FVS D  R+  PA+      + T  Y+       LP + ++  +NP+ ++ D  +I+WLN+F L+L    L+ S  + S L  Q+                    + ++ P      + +EAIMPRI +        Q DRP+ +QIQV    + N+ +  S    + Q +      +   G             TD  L  ++ S  ++ +  + +G+    +               + +W I  +P+W+D+ GA+S   NK   F+D+V +TLW+
Sbjct:  491 LENLAKLMSSCVILRIEDFTLYRVTTSGKKAMPKEFVSGDKDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTLHPQQQLPRGSIASNGSNGTQMAAVNVEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSGFPSKEGDMCIVTDRILSHVAASDVSMMSPVSPTGQQLPRSASTQYLSRYVMWLEPRDVWCIKLDPVWVDFLGARSLGPNKSIPFVDAVPITLWL 803          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Fly
Match: CG34126 (gene:FBgn0083962 transcript:FBtr0329976)

HSP 1 Score: 268.085 bits (684), Expect = 9.622e-73
Identity = 162/409 (39.61%), Postives = 241/409 (58.92%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRK-------------PNKFKDNINPN-PNA-YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELI--INDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFC-EEGDQSSS---LSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M S +KNQ+LKHL+ YTKNLS +KI ++ F+GEG++ NLELDE  LTELLELPSW+++  A CN VS ++ WT +K  PI L LD+V I++E  +   +             P        P  P   Y FI +V+DG+ I +N V + F + AF AS++++R+ V SK P W+++D L+ TR+K   +G +L+FKE+ W + RIEA+  QD   TP++L+TN  + R+T++K L+D S++ S+   IL DL WVLT SQ+KAA+ F +SL  +I  +       A  + +A R     PE    +       S +    N Q++F  ++++ETSYH    RI+ H C +EGD  SS   L K     G+++  +T  Q+D YPYH+A   R H+  YKE      +W+
Sbjct:    1 MVSLIKNQLLKHLSIYTKNLSSDKINLSTFRGEGELSNLELDERVLTELLELPSWLRLTSAWCNHVSFRISWTKLKSVPITLTLDEVRITIETCNPTTRDAGGGSGAGGAGSPTAAASAALPQVPQGKYSFIHKVVDGITIVVNTVNVNFVSAAFTASVQMSRIRVESKTPKWANAD-LRLTRLKDAQKGIILIFKELSWQTVRIEASSTQDKSLTPLRLLTNHARCRITIRKRLSDCSLLASRLVLILDDLLWVLTDSQLKAALHFVDSLSGLIKAATH-----ATQKTKAARKMQTLPEYKAQVEQQQNRLSESAHTTNAQRMFNAFDVRETSYHFFSQRIDLHLCDDEGDGRSSYPDLDK----GGALQVSVTAFQVDYYPYHLAKSDRSHWAKYKEASVAPALWL 399          

HSP 2 Score: 94.7449 bits (234), Expect = 4.745e-19
Identity = 74/313 (23.64%), Postives = 138/313 (44.09%), Query Frame = 2
Query: 1217 IDDKNQIMESVTLVRFNDISMHCVST-AQKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNE-LKLSQCANSFLTSQE------------------PSSCQKHP-----AIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGH------------TD-FLFDISGSMGNVKTNTNKSGKSNRDN--------------DKSLWQICCEPIWIDYEGAKSYN-NKPKSFLDSVHLTLWI 1996
            +++  ++M S  ++R  D +++ V+T  +K     FVS D  R+  PA+      + T  Y+       LP + ++  +NP+ ++ D  +I+WLN+F L+L    L+ S  + S L  Q+                    + ++ P      + +EAIMPRI +        Q DRP+ +QIQV    + N+ +  S    + Q +      +   G             TD  L  ++ S  ++ +  + +G+    +               + +W I  +P+W+D+ GA+S   NK   F+D+V +TLW+
Sbjct:  491 LENLAKLMSSCVILRIEDFTLYRVTTSGKKAMPKEFVSGDKDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTLHPQQQLPRGSIASNGSNGTQMAAVNVEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSGFPSKEGDMCIVTDRILSHVAASDVSMMSPVSPTGQQLPRSASTQYLSRYVMWLEPRDVWCIKLDPVWVDFLGARSLGPNKSIPFVDAVPITLWL 803          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Zebrafish
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-GENE-041210-177])

HSP 1 Score: 322.013 bits (824), Expect = 2.435e-90
Identity = 216/730 (29.59%), Postives = 362/730 (49.59%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKN-------------------------------QIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDC--DVIHQVVQEYHRSNFFNG---------------HTDF----------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD V++ +   D PR PN       P+P A       YGF ++V++G+ + +N + I  +AKAF AS EL++L V S   +W+  D L+ TRI   T+G +L FKE+ W   RIEA+ +Q+ +    + P++LITN +K+R+T+K+ + D ++I SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A    + T       ++     S     T ++    +LF  Y+++ETS+H+ ++ ++ H C++ +         +  G+++   ++  +D YP+H A     H+ +Y E  + R  W  +      S +   KN                               Q+M S  ++R  D S++ VS+A +  +     +S +     LP +      + T++Y+  G    +P   LY Q+N L L LD  +++WLN F L L+  L+          SQ+P   ++H  I ++ +M ++ +  D   T Q D+P+ + +Q   +   N  + +S C    +  ++Q +    FF                 H+ F          + D+   +     +TN + K+    D  LW +     W+DYEG++S   +P   +DS  LTLW+
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVVMEMSTCDEPRPPN------GPSPIATASGQSEYGFAEKVVEGISLSVNSIVIRISAKAFNASFELSQLQVYSVNTSWTTGD-LRYTRILDPTRGELLTFKEVSWQMIRIEADAIQNTEHEVVSAPIRLITNQSKIRVTLKRRMKDCNVIASKLTLILDDLLWVLTDSQLKAMVQYAKSLSESMEKSASQRKSMAPDTTQVTPAPPTAQQMRTQQASAAADQTASM---ARLFTAYDVRETSHHLQITHLDLHICDDTNAKDRGINKRLDGGAMQLSFSSISVDYYPFHKAGEGCLHWMHYGEATKSRETWARSLLDEFKSNVDMLKNAVSGQSQGSPQHGKISTSSSTSFSPPTPPRTQLMSSSIVLRMADFSIYQVSSADQPRSSPQTMISCNKKSLYLPQEMPAIHAEFTEYYFPDGKDYPVPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMDLYKLNDSQKP---EEHVDIKVDGLMLKLVIPADHEKT-QPDQPRSVSVQTSEMVATNT-RHSSACSRSSLEALLQAFQEQPFFTSLSSTFPRAPSSFSVLHSVFQRHAHEQDTRVHDVYRGLAPPSLSTN-ALKTPAATD--LWAMHFSQFWVDYEGSRSGRGRPTPCVDSFPLTLWV 712          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Zebrafish
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-GENE-041210-177])

HSP 1 Score: 322.013 bits (824), Expect = 2.726e-90
Identity = 216/730 (29.59%), Postives = 362/730 (49.59%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKN-------------------------------QIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDC--DVIHQVVQEYHRSNFFNG---------------HTDF----------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD V++ +   D PR PN       P+P A       YGF ++V++G+ + +N + I  +AKAF AS EL++L V S   +W+  D L+ TRI   T+G +L FKE+ W   RIEA+ +Q+ +    + P++LITN +K+R+T+K+ + D ++I SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A    + T       ++     S     T ++    +LF  Y+++ETS+H+ ++ ++ H C++ +         +  G+++   ++  +D YP+H A     H+ +Y E  + R  W  +      S +   KN                               Q+M S  ++R  D S++ VS+A +  +     +S +     LP +      + T++Y+  G    +P   LY Q+N L L LD  +++WLN F L L+  L+          SQ+P   ++H  I ++ +M ++ +  D   T Q D+P+ + +Q   +   N  + +S C    +  ++Q +    FF                 H+ F          + D+   +     +TN + K+    D  LW +     W+DYEG++S   +P   +DS  LTLW+
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVVMEMSTCDEPRPPN------GPSPIATASGQSEYGFAEKVVEGISLSVNSIVIRISAKAFNASFELSQLQVYSVNTSWTTGD-LRYTRILDPTRGELLTFKEVSWQMIRIEADAIQNTEHEVVSAPIRLITNQSKIRVTLKRRMKDCNVIASKLTLILDDLLWVLTDSQLKAMVQYAKSLSESMEKSASQRKSMAPDTTQVTPAPPTAQQMRTQQASAAADQTASM---ARLFTAYDVRETSHHLQITHLDLHICDDTNAKDRGINKRLDGGAMQLSFSSISVDYYPFHKAGEGCLHWMHYGEATKSRETWARSLLDEFKSNVDMLKNAVSGQSQGSPQHGKISTSSSTSFSPPTPPRTQLMSSSIVLRMADFSIYQVSSADQPRSSPQTMISCNKKSLYLPQEMPAIHAEFTEYYFPDGKDYPVPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMDLYKLNDSQKP---EEHVDIKVDGLMLKLVIPADHEKT-QPDQPRSVSVQTSEMVATNT-RHSSACSRSSLEALLQAFQEQPFFTSLSSTFPRAPSSFSVLHSVFQRHAHEQDTRVHDVYRGLAPPSLSTN-ALKTPAATD--LWAMHFSQFWVDYEGSRSGRGRPTPCVDSFPLTLWV 712          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Zebrafish
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-GENE-041210-177])

HSP 1 Score: 312.383 bits (799), Expect = 3.947e-87
Identity = 220/758 (29.02%), Postives = 369/758 (48.68%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEE---GDQSSSLS--------------------KNSVFN-----GSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKN-------------------------------QIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDC--DVIHQVVQEYHRSNFFNG---------------HTDF----------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD V++ +   D PR PN       P+P A       YGF ++V++G+ + +N + I  +AKAF AS EL++L V S   +W+  D L+ TRI   T+G +L FKE+ W   RIEA+ +Q+ +    + P++LITN +K+R+T+K+ + D ++I SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A    + T       ++     S     T ++    +LF  Y+++ETS+H+ ++ ++ H C++    D+ ++ S                    K++  N     G+++   ++  +D YP+H A     H+ +Y E  + R  W  +      S +   KN                               Q+M S  ++R  D S++ VS+A +  +     +S +     LP +      + T++Y+  G    +P   LY Q+N L L LD  +++WLN F L L+  L+          SQ+P   ++H  I ++ +M ++ +  D   T Q D+P+ + +Q   +   N  + +S C    +  ++Q +    FF                 H+ F          + D+   +     +TN + K+    D  LW +     W+DYEG++S   +P   +DS  LTLW+
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVVMEMSTCDEPRPPN------GPSPIATASGQSEYGFAEKVVEGISLSVNSIVIRISAKAFNASFELSQLQVYSVNTSWTTGD-LRYTRILDPTRGELLTFKEVSWQMIRIEADAIQNTEHEVVSAPIRLITNQSKIRVTLKRRMKDCNVIASKLTLILDDLLWVLTDSQLKAMVQYAKSLSESMEKSASQRKSMAPDTTQVTPAPPTAQQMRTQQASAAADQTASM---ARLFTAYDVRETSHHLQITHLDLHICDDTNAKDRGTTCSHIIQLTFTFGVVILKYVFSLKSAGINKRLDGGAMQLSFSSISVDYYPFHKAGEGCLHWMHYGEATKSRETWARSLLDEFKSNVDMLKNAVSGQSQGSPQHGKISTSSSTSFSPPTPPRTQLMSSSIVLRMADFSIYQVSSADQPRSSPQTMISCNKKSLYLPQEMPAIHAEFTEYYFPDGKDYPVPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMDLYKLNDSQKP---EEHVDIKVDGLMLKLVIPADHEKT-QPDQPRSVSVQTSEMVATNT-RHSSACSRSSLEALLQAFQEQPFFTSLSSTFPRAPSSFSVLHSVFQRHAHEQDTRVHDVYRGLAPPSLSTN-ALKTPAATD--LWAMHFSQFWVDYEGSRSGRGRPTPCVDSFPLTLWV 740          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Zebrafish
Match: uhrf1bp1 (UHRF1 binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-090312-82])

HSP 1 Score: 285.419 bits (729), Expect = 2.111e-78
Identity = 224/832 (26.92%), Postives = 377/832 (45.31%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGL----QDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNS-TNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT---------------------------NTYTRK-------SSFIIDDKN-----QIMESVTLVRFNDISMHCVSTA----QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT----NSDCDVIHQVVQEYHRSNF-----FNGHTDFLFDI-SGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGA-KSYNNKPKSFLDSVHLTLWI-------------------------------------------SISNSPSSEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETA-PTSV 2185
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +LELP+W+ + R  CNK +I++QWT +K  PI L LD V + +   + PR PN       P+P A       YGF ++V++GM + IN + I   ++AF AS +L +L   S  P W  SD L+ TR+    +G VL FKEI W S RIEA+ +    QD  +TP++LITN  ++R+ +K+ + D +++ SK  FIL DL WVLT SQ+KA I + +SL E + +S    K  A   L+    S     L  +  +    S + TL    + F  +++KE+SYH  +SR++ H C +    +  +      G+++        D YP+H       H+  +      R  W +                           ++  RK       SSF  +        ++  S  ++R +D+ +H VST     +KT + L  S +     LP  T    L  T++Y+       +P + LY Q+N L L +D P+++W+  F   L   L       +F   Q+ S   +H  I ++A   ++ +  +  +    DRPQ + I    + + N  Q+    +SD +  +         N      F      L  + S  + +   N +          + +W +    + + ++GA +    K   F++   ++LW+                                           S+ NSP++ + I+ +    +++ ++HYQ + + R+ D +      +  D    +K++++ P SV
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLSNLELDEEVLQNMLELPTWLAVTRVYCNKAAIRIQWTKLKTSPICLFLDKVEVEMRTCEEPRAPN------GPSPIAITAGQSEYGFAEKVVEGMSVIINSITIKVQSRAFHASFQLWQLQGCSLNPKWQKSD-LRYTRVTHPKRGEVLTFKEINWQSLRIEADAIESEDQDLGSTPLRLITNQGRIRIALKRRVKDCNVLASKLLFILDDLLWVLTDSQLKAIIRYAKSLSEAMEKSGQQRKSMAADTLQTAPPSPSTHSLWTDAPAPPEASGSCTL---AQYFDLHDVKESSYHTFISRLDLHICNDSSSEADEAPLPGTQGAMQLTFRKLGFDYYPFHRPGDGCQHWERHCGAMDSRAQWASKLLQDFQRRMEDLGIPGPQSEANVSAKDSPARKIKDRESQSSFSPERTQASALKKLRSSCMVIRVDDLDIHQVSTGGRHSRKTQSLL--SCNRKSLHLPENTPAIHLQFTEYYFPDIPGLPVPSSNLYAQLNGLQLCVDAPSVLWMTLFSRGLHRTLDQ---VKAFYHLQDSSKTDEHIDIRLDATQLKLIVPLESSILDHPDRPQSLSISFPQIILSNTRQSPHGAHSDLNSTYSSFSSRSFFNTTQCKPFPRDQSVLHPLPSAFLQHSLENESLLAYKRLSRSQDVWSVSLSRVTLGFDGARRGLRGKTLPFVEPFSMSLWMCHPDAFTKDSHCIEDDLKSPSRFSQEFSCAPNDLISNKTQQTESLINSPTASVHILAQSITPVKMWLNHYQFIALLRMKDYLGRLAEDLTRDSQAESKNKSSDPPSV 817          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Zebrafish
Match: uhrf1bp1 (UHRF1 binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-090312-82])

HSP 1 Score: 58.9214 bits (141), Expect = 4.585e-8
Identity = 42/162 (25.93%), Postives = 75/162 (46.30%), Query Frame = 2
Query: 1253 LVRFNDISMHCVSTA----QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT 1726
            ++R +D+ +H VST     +KT + L  S +     LP  T    L  T++Y+       +P + LY Q+N L L +D P+++W+  F   L   L       +F   Q+ S   +H  I ++A   ++ +  +  +    DRPQ + I    + + N  Q+
Sbjct:    2 VIRVDDLDIHQVSTGGRHSRKTQSLL--SCNRKSLHLPENTPAIHLQFTEYYFPDIPGLPVPSSNLYAQLNGLQLCVDAPSVLWMTLFSRGLHRTLDQ---VKAFYHLQDSSKTDEHIDIRLDATQLKLIVPLESSILDHPDRPQSLSISFPQIILSNTRQS 158          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Xenopus
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:NCBI gene;Acc:100170465])

HSP 1 Score: 315.849 bits (808), Expect = 2.839e-88
Identity = 225/746 (30.16%), Postives = 355/746 (47.59%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNP-------NAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-QKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIW---------------------------------VTNTYTR-----------KSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT----NSDCDVIHQVVQEYH-----RSNFFNGHTDF-----------------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD VI+ +   + PR  N       P+P       + YGF ++V++G+ + +N + I   AKAF AS EL++L + S  PNW   D L+ TRI+   +G VL FKEI W   RIEA+ +Q+      + PV+LITN +K+R+T+K+ L D +++ SK   +L DL WVLT SQ+KA   + +SL E I +S +  K  A      T  S   P    +  +   S T   N+   KLF+ +++KETSYH+++S ++ H C++           +  G+++   +   +D YPYH       H+ +Y +  + R  W                                  +  Y +            +SF    K+  M S  +VR  D  ++ VSTA +  +     +S +     LP + +   ++ T++Y+  G +  +P   LY Q+N L   LD  +I+WL+ F L L+  L      N F+      + S   +H  I I+ +M ++ +   K      D+P  I IQ   +   N  Q+     SD + I Q  ++Y       ++F   H  F                 + DI   M   K ++     S       +W I     W+DYEG K+   +P  F+DS   ++WI
Sbjct:    1 MAGLIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVIMEMSTCEEPRSCN------GPSPLVTASGQSEYGFAEKVVEGISLSVNSIIIRIRAKAFNASFELSQLRIYSVNPNWQHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADAIQNCDHEIMSAPVRLITNQSKIRVTLKRRLKDCNVLASKLILMLDDLLWVLTDSQLKAIFQYAKSLSEAIEKSTEQRKSMAS----ETTQSPPPPVSSQHIKTPQTSMTPEHNHAILKLFRDFDVKETSYHLVISHLDLHICDDIHSKERAFARRITGGAMQLSFSQLTVDYYPYHRDGDGCSHWMHYGDATKTRCSWAQELLHEFNCNIEMLRQAVKDYNPSSPIKTVPNASQQYGQTDFDQNVKKSSPTSFKEQPKSNPMSSSFVVRLADFYIYQVSTADQCRSSPKTMISCNKKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPNPNLYVQLNALQFTLDERSILWLSQFVLDLRQSL------NQFMAMYMLNDNSKSDEHVDIRIDGLMLKLIIPSQKKQDCHPDQPVAISIQTSEMIASNTRQSANCRRSDLEAIFQDFKDYDFYSETFTSFPRSHESFHILHPIFQRHAFEQDTKMHDIYKGMVAPKLDSKALSTSAA---MDIWAIHFTQFWVDYEGIKNGKGRPVGFIDSFPFSIWI 726          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Xenopus
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:NCBI gene;Acc:100170465])

HSP 1 Score: 315.464 bits (807), Expect = 4.718e-88
Identity = 225/746 (30.16%), Postives = 355/746 (47.59%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNP-------NAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-QKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIW---------------------------------VTNTYTR-----------KSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT----NSDCDVIHQVVQEYH-----RSNFFNGHTDF-----------------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD VI+ +   + PR  N       P+P       + YGF ++V++G+ + +N + I   AKAF AS EL++L + S  PNW   D L+ TRI+   +G VL FKEI W   RIEA+ +Q+      + PV+LITN +K+R+T+K+ L D +++ SK   +L DL WVLT SQ+KA   + +SL E I +S +  K  A      T  S   P    +  +   S T   N+   KLF+ +++KETSYH+++S ++ H C++           +  G+++   +   +D YPYH       H+ +Y +  + R  W                                  +  Y +            +SF    K+  M S  +VR  D  ++ VSTA +  +     +S +     LP + +   ++ T++Y+  G +  +P   LY Q+N L   LD  +I+WL+ F L L+  L      N F+      + S   +H  I I+ +M ++ +   K      D+P  I IQ   +   N  Q+     SD + I Q  ++Y       ++F   H  F                 + DI   M   K ++     S       +W I     W+DYEG K+   +P  F+DS   ++WI
Sbjct:    1 MAGLIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVIMEMSTCEEPRSCN------GPSPLVTASGQSEYGFAEKVVEGISLSVNSIIIRIRAKAFNASFELSQLRIYSVNPNWQHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADAIQNCDHEIMSAPVRLITNQSKIRVTLKRRLKDCNVLASKLILMLDDLLWVLTDSQLKAIFQYAKSLSEAIEKSTEQRKSMAS----ETTQSPPPPVSSQHIKTPQTSMTPEHNHAILKLFRDFDVKETSYHLVISHLDLHICDDIHSKERAFARRITGGAMQLSFSQLTVDYYPYHRDGDGCSHWMHYGDATKTRCSWAQELLHEFNCNIEMLRQAVKDYNPSSPIKTVPNASQQYGQTDFDQNVKKSSPTSFKEQPKSNPMSSSFVVRLADFYIYQVSTADQCRSSPKTMISCNKKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPNPNLYVQLNALQFTLDERSILWLSQFVLDLRQSL------NQFMAMYMLNDNSKSDEHVDIRIDGLMLKLIIPSQKKQDCHPDQPVAISIQTSEMIASNTRQSANCRRSDLEAIFQDFKDYDFYSETFTSFPRSHESFHILHPIFQRHAFEQDTKMHDIYKGMVAPKLDSKALSTSAA---MDIWAIHFTQFWVDYEGIKNGKGRPVGFIDSFPFSIWI 726          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Xenopus
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:NCBI gene;Acc:100170465])

HSP 1 Score: 304.294 bits (778), Expect = 2.039e-84
Identity = 226/718 (31.48%), Postives = 349/718 (48.61%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNP-------NAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-QKLFQKYNLKETSYHVLVSRIEFHFC------EEGDQSS------SLSKNSVFNGSVKFLLTNCQIDLYPYHV----ASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT----NSDCDVIHQVVQEYH-----RSNFFNGHTDF-----------------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD VI+ +   + PR  N       P+P       + YGF ++V++G+ + +N + I   AKAF AS EL++L + S  PNW   D L+ TRI+   +G VL FKEI W   RIEA+ +Q+      + PV+LITN +K+R+T+K+ L D +++ SK   +L DL WVLT SQ+KA   + +SL E I +S +  K  A      T  S   P    +  +   S T   N+   KLF+ +++KETSYH+++S ++ H C      E GD  S        +K             NC I++    V     S      PN  + +   +       +  +SF    K+  M S  +VR  D  ++ VSTA +  +     +S +     LP + +   ++ T++Y+  G +  +P   LY Q+N L   LD  +I+WL+ F L L+  L      N F+      + S   +H  I I+ +M ++ +   K      D+P  I IQ   +   N  Q+     SD + I Q  ++Y       ++F   H  F                 + DI   M   K ++     S       +W I     W+DYEG K+   +P  F+DS   ++WI
Sbjct:    1 MAGLIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVIMEMSTCEEPRSCN------GPSPLVTASGQSEYGFAEKVVEGISLSVNSIIIRIRAKAFNASFELSQLRIYSVNPNWQHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADAIQNCDHEIMSAPVRLITNQSKIRVTLKRRLKDCNVLASKLILMLDDLLWVLTDSQLKAIFQYAKSLSEAIEKSTEQRKSMAS----ETTQSPPPPVSSQHIKTPQTSMTPEHNHAILKLFRDFDVKETSYHLVISHLDLHICDDIHSKERGDGCSHWMHYGDATKTRCSWAQELLHEFNCNIEMLRQAVKDYNPSSPIKTVPNASQQYGQTDFDQNVKKSSPTSFKEQPKSNPMSSSFVVRLADFYIYQVSTADQCRSSPKTMISCNKKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPNPNLYVQLNALQFTLDERSILWLSQFVLDLRQSL------NQFMAMYMLNDNSKSDEHVDIRIDGLMLKLIIPSQKKQDCHPDQPVAISIQTSEMIASNTRQSANCRRSDLEAIFQDFKDYDFYSETFTSFPRSHESFHILHPIFQRHAFEQDTKMHDIYKGMVAPKLDSKALSTSAA---MDIWAIHFTQFWVDYEGIKNGKGRPVGFIDSFPFSIWI 698          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Xenopus
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:NCBI gene;Acc:100170465])

HSP 1 Score: 298.516 bits (763), Expect = 1.635e-82
Identity = 220/745 (29.53%), Postives = 351/745 (47.11%), Query Frame = 2
Query:   23 TSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNP-------NAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-QKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIW---------------------------------VTNTYTR-----------KSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT----NSDCDVIHQVVQEYH-----RSNFFNGHTDF-----------------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            T  L  ++L+  + +TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD VI+ +   + PR  N       P+P       + YGF ++V++G+ + +N + I   AKAF AS EL++L + S  PNW   D L+ TRI+   +G VL FKEI W   RIEA+ +Q+      + PV+LITN +K+R+T+K+ L D +++ SK   +L DL WVLT SQ+KA   + +SL E I +S +  K  A      T  S   P    +  +   S T   N+   KLF+ +++KETSYH+++S ++ H C++           +  G+++   +   +D YPYH       H+ +Y +  + R  W                                  +  Y +            +SF    K+  M S  +VR  D  ++ VSTA +  +     +S +     LP + +   ++ T++Y+  G +  +P   LY Q+N L   LD  +I+WL+ F L L+  L      N F+      + S   +H  I I+ +M ++ +   K      D+P  I IQ   +   N  Q+     SD + I Q  ++Y       ++F   H  F                 + DI   M   K ++     S       +W I     W+DYEG K+   +P  F+DS   ++WI
Sbjct:    2 TGLLNKKVLEK-SLFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVIMEMSTCEEPRSCN------GPSPLVTASGQSEYGFAEKVVEGISLSVNSIIIRIRAKAFNASFELSQLRIYSVNPNWQHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADAIQNCDHEIMSAPVRLITNQSKIRVTLKRRLKDCNVLASKLILMLDDLLWVLTDSQLKAIFQYAKSLSEAIEKSTEQRKSMAS----ETTQSPPPPVSSQHIKTPQTSMTPEHNHAILKLFRDFDVKETSYHLVISHLDLHICDDIHSKERAFARRITGGAMQLSFSQLTVDYYPYHRDGDGCSHWMHYGDATKTRCSWAQELLHEFNCNIEMLRQAVKDYNPSSPIKTVPNASQQYGQTDFDQNVKKSSPTSFKEQPKSNPMSSSFVVRLADFYIYQVSTADQCRSSPKTMISCNKKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPNPNLYVQLNALQFTLDERSILWLSQFVLDLRQSL------NQFMAMYMLNDNSKSDEHVDIRIDGLMLKLIIPSQKKQDCHPDQPVAISIQTSEMIASNTRQSANCRRSDLEAIFQDFKDYDFYSETFTSFPRSHESFHILHPIFQRHAFEQDTKMHDIYKGMVAPKLDSKALSTSAA---MDIWAIHFTQFWVDYEGIKNGKGRPVGFIDSFPFSIWI 725          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Xenopus
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:NCBI gene;Acc:100170465])

HSP 1 Score: 298.516 bits (763), Expect = 1.733e-82
Identity = 220/745 (29.53%), Postives = 351/745 (47.11%), Query Frame = 2
Query:   23 TSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNP-------NAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-QKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIW---------------------------------VTNTYTR-----------KSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT----NSDCDVIHQVVQEYH-----RSNFFNGHTDF-----------------LFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            T  L  ++L+  + +TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD VI+ +   + PR  N       P+P       + YGF ++V++G+ + +N + I   AKAF AS EL++L + S  PNW   D L+ TRI+   +G VL FKEI W   RIEA+ +Q+      + PV+LITN +K+R+T+K+ L D +++ SK   +L DL WVLT SQ+KA   + +SL E I +S +  K  A      T  S   P    +  +   S T   N+   KLF+ +++KETSYH+++S ++ H C++           +  G+++   +   +D YPYH       H+ +Y +  + R  W                                  +  Y +            +SF    K+  M S  +VR  D  ++ VSTA +  +     +S +     LP + +   ++ T++Y+  G +  +P   LY Q+N L   LD  +I+WL+ F L L+  L      N F+      + S   +H  I I+ +M ++ +   K      D+P  I IQ   +   N  Q+     SD + I Q  ++Y       ++F   H  F                 + DI   M   K ++     S       +W I     W+DYEG K+   +P  F+DS   ++WI
Sbjct:    2 TGLLNKKVLEK-SLFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVIMEMSTCEEPRSCN------GPSPLVTASGQSEYGFAEKVVEGISLSVNSIIIRIRAKAFNASFELSQLRIYSVNPNWQHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADAIQNCDHEIMSAPVRLITNQSKIRVTLKRRLKDCNVLASKLILMLDDLLWVLTDSQLKAIFQYAKSLSEAIEKSTEQRKSMAS----ETTQSPPPPVSSQHIKTPQTSMTPEHNHAILKLFRDFDVKETSYHLVISHLDLHICDDIHSKERAFARRITGGAMQLSFSQLTVDYYPYHRDGDGCSHWMHYGDATKTRCSWAQELLHEFNCNIEMLRQAVKDYNPSSPIKTVPNASQQYGQTDFDQNVKKSSPTSFKEQPKSNPMSSSFVVRLADFYIYQVSTADQCRSSPKTMISCNKKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPNPNLYVQLNALQFTLDERSILWLSQFVLDLRQSL------NQFMAMYMLNDNSKSDEHVDIRIDGLMLKLIIPSQKKQDCHPDQPVAISIQTSEMIASNTRQSANCRRSDLEAIFQDFKDYDFYSETFTSFPRSHESFHILHPIFQRHAFEQDTKMHDIYKGMVAPKLDSKALSTSAA---MDIWAIHFTQFWVDYEGIKNGKGRPVGFIDSFPFSIWI 725          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Mouse
Match: Uhrf1bp1l (UHRF1 (ICBP90) binding protein 1-like [Source:MGI Symbol;Acc:MGI:2442888])

HSP 1 Score: 333.954 bits (855), Expect = 3.138e-94
Identity = 230/754 (30.50%), Postives = 364/754 (48.28%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT-----------------------------------NTYTRKSSFIID-----------DKNQIMESVTLVRFNDISMHCVSTAQKTNNCL--FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTG-QSDRPQLIQIQVGTLTIDN--------------VCQTNSDCD-----------------VIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSG-KSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG++ NLELDE  L  +L+LP+W+ I +  CNK SI++ WT +K QPI L LD VI+ +   + PR PN       P+P A       YGF ++V++G+ + +N + I   AKAF AS EL++L + S    W   D L+ TRI+   +G VL FKEI W   RIEA+  Q         PV+LITN +K+R+T+K+ L D ++I +K   IL DL WVLT SQ+KA + + +SL E I +S +  K  A    E T++S +             +  +  +   KLF  +++KETS+H+++S ++ H C++       S   V  G+++   T   ID YPYH A  +  H+  + +  + +N W                                     +T T K S +              K ++M S  +VR  D +++ VSTA++  +     +S +     LP + +  +++ T++Y+  G    +P   LY Q+N L   +D  +I+WLN F L LK  L      N F+      + S   +H  I ++ +M +  + P ++  G   D+P  + IQ   +   N              +CQ   +CD                 ++H + Q +        H  +        GN+    NK+  K++   D  +W +     WIDYEG KS   +P SF+D+  L++WI
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGELKNLELDEEVLQNMLDLPTWLAISKVFCNKASIRIPWTKLKTQPICLSLDKVIMEMSTCEEPRAPN------GPSPIATASGQSEYGFAEKVVEGITVSVNSIVIRIGAKAFNASFELSQLRIYSVNAQWEHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDDLLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAP---EPTQSSTVTSSAQHVKTPQAANAPDLSDAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRVSGGAMQLSFTQLTIDYYPYHKAGDSCSHWMYFSDATKTKNGWANELLHEFECNVEMLKQAMKDRNLGSPPKSPTHASPQHTQTEKDSTLKGTPKTPSVLPQPSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSPKSMISCNKKSLYLPQEMSAIYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSL------NQFMAVYKLNDSSKSDEHVDIRVDGLMLKFVI-PSEVKAGCHQDQPHTVSIQSSEMIATNTRHCPNCRHSDLEALCQDFKECDFFSKTYTRFPKSCDSFNLLHPIFQRHAHEQDTKMHEVY-------KGNIIPKLNKNTLKTSAATD--VWAVYFSQFWIDYEGMKSGKGRPVSFVDAFPLSIWI 728          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Mouse
Match: Uhrf1bp1 (UHRF1 (ICBP90) binding protein 1 [Source:MGI Symbol;Acc:MGI:3041238])

HSP 1 Score: 293.508 bits (750), Expect = 6.382e-81
Identity = 202/728 (27.75%), Postives = 341/728 (46.84%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKD-NINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEA----NGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-----QKLFQKYNLKETSYHVLVSRIEFHFCEEGD-QSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV-------------------------------------------------TNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNN--CLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT-NSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKT-------NTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLW 1993
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + +LELDE  L  +LELP+W+ I R  CN+ SI++QWT +K  PI L LD V + ++  + PR PN      +    + YGF ++V++GM I +N + I   +KAF AS EL +L   S  PNW  SD L+ TRI    +G VL FKEI W + R+EA    NG QD   TP++LITN  ++++ +K+   D +++ SK  F+L DL WVLT SQ+KA + + ESL E + +S    K  A   ++ T      P       +   +F  +  +       + F+K+++KE+SYH+L+SR++ H C++   +   +S N +  G+++        D YP+H A  +  H+  + E    R  W                                                  + T  R+++F     N++  S  +VR +D+ +H VSTA + +      +S    RH LP +     +  T++Y+       +P   LY Q+N L   +D  +++W N F L L   L+  +       S+      +H  + ++A   +++   +     +  RPQ + +   ++   N     N     +  + + +  + FF         ++G    +           +          + LW +    I +D+EG +++     +F+    L++W
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTHLELDEEVLQNVLELPTWLAITRVYCNRASIQIQWTKLKTHPICLCLDKVEVEMQTCEDPRPPNGQSPIALASGQSEYGFAEKVVEGMFIVVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSD-LRLTRITDPRRGEVLTFKEITWQTLRVEADAIENGDQDPVTTPLRLITNQGRIQIALKRRTKDCNVVASKLTFLLDDLLWVLTDSQLKAMMKYAESLSEAMEKSAQQRKSLAPESVQTT------PPAPSAQQTWAQAFGGSQGSSSSSRLSQYFEKFDVKESSYHLLISRLDLHICDDSQSREPGVSANRLTGGAMQLTFRRMAFDYYPFHRAGDSCKHWVRHCEAMETRGHWAQQLVTEFQSRVEKQCEGGSVKPPWLLGVDPPFRRKADSFSSPGKTPLDKSPTQGRQAAFGAPAWNRLRSSCLVVRVDDLDIHQVSTAGQPSKKPSTLLSCSRKRHHLPPQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEASR---GRDEHVDVRLDAFWLKVSFPLETRELAKLHRPQALVLSTSSMIATNTRHAPNCTRPDLQSLFRGFAATEFFRCSYGHFPQVAGGFSLLHMLFLHHAFQMDSLPPQRLAASQDLWSLHFTQISLDFEGTENFRGHTLNFVAPFPLSIW 718          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Mouse
Match: Uhrf1bp1l (UHRF1 (ICBP90) binding protein 1-like [Source:MGI Symbol;Acc:MGI:2442888])

HSP 1 Score: 221.476 bits (563), Expect = 5.804e-61
Identity = 158/559 (28.26%), Postives = 260/559 (46.51%), Query Frame = 2
Query:  308 PRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT-----------------------------------NTYTRKSSFIID-----------DKNQIMESVTLVRFNDISMHCVSTAQKTNNCL--FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTG-QSDRPQLIQIQVGTLTIDNV--CQTNSDCDVIHQVVQEYHRSNFFN 1789
            PR PN       P+P A       YGF ++V++G+ + +N + I   AKAF AS EL++L + S    W   D L+ TRI+   +G VL FKEI W   RIEA+  Q         PV+LITN +K+R+T+K+ L D ++I +K   IL DL WVLT SQ+KA + + +SL E I +S +  K  A    E T++S +             +  +  +   KLF  +++KETS+H+++S ++ H C++       S   V  G+++   T   ID YPYH A  +  H+  + +  + +N W                                     +T T K S +              K ++M S  +VR  D +++ VSTA++  +     +S +     LP + +  +++ T++Y+  G    +P   LY Q+N L   +D  +I+WLN F L LK  L      N F+      + S   +H  I ++ +M +  + P ++  G   D+P  + IQ   +   N   C      D +  + Q++   +FF+
Sbjct:    9 PRAPN------GPSPIATASGQSEYGFAEKVVEGITVSVNSIVIRIGAKAFNASFELSQLRIYSVNAQWEHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDDLLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAP---EPTQSSTVTSSAQHVKTPQAANAPDLSDAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRVSGGAMQLSFTQLTIDYYPYHKAGDSCSHWMYFSDATKTKNGWANELLHEFECNVEMLKQAMKDRNLGSPPKSPTHASPQHTQTEKDSTLKGTPKTPSVLPQPSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSPKSMISCNKKSLYLPQEMSAIYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSL------NQFMAVYKLNDSSKSDEHVDIRVDGLMLKFVI-PSEVKAGCHQDQPHTVSIQSSEMIATNTRHCPNCRHSD-LEALCQDFKECDFFS 549          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Mouse
Match: Uhrf1bp1 (UHRF1 (ICBP90) binding protein 1 [Source:MGI Symbol;Acc:MGI:3041238])

HSP 1 Score: 123.25 bits (308), Expect = 1.367e-31
Identity = 71/161 (44.10%), Postives = 101/161 (62.73%), Query Frame = 2
Query:   65 YTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPN-KFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQG 544
            +TKNLSP+KI ++  KGEG + +LELDE  L  +LELP+W+ I R  CN+ SI++QWT +K  PI L LD V + ++  + PR PN +    +    + YGF ++V++GM I +N + I   +KAF AS EL +L   S  PNW  SD L+ TRI    +G
Sbjct:   17 FTKNLSPDKINLSTLKGEGQLTHLELDEEVLQNVLELPTWLAITRVYCNRASIQIQWTKLKTHPICLCLDKVEVEMQTCEDPRPPNGQSPIALASGQSEYGFAEKVVEGMFIVVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSD-LRLTRITDPRRG 176          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Mouse
Match: Uhrf1bp1 (UHRF1 (ICBP90) binding protein 1 [Source:MGI Symbol;Acc:MGI:3041238])

HSP 1 Score: 88.1965 bits (217), Expect = 5.266e-20
Identity = 52/117 (44.44%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  308 PRKPNKFKD-NINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEA----NGLQDGQATPVKLITN 643
            PR PN      +    + YGF ++V++GM I +N + I   +KAF AS EL +L   S  PNW  SD L+ TRI    +G VL FKEI W + R+EA    NG QD   TP++LITN
Sbjct:    7 PRPPNGQSPIALASGQSEYGFAEKVVEGMFIVVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSD-LRLTRITDPRRGEVLTFKEITWQTLRVEADAIENGDQDPVTTPLRLITN 122          
BLAST of UHRF1-binding protein 1-like vs. UniProt/SwissProt
Match: sp|A2RSJ4|UH1BL_MOUSE (UHRF1-binding protein 1-like OS=Mus musculus OX=10090 GN=Uhrf1bp1l PE=1 SV=2)

HSP 1 Score: 333.954 bits (855), Expect = 2.195e-93
Identity = 230/754 (30.50%), Postives = 364/754 (48.28%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT-----------------------------------NTYTRKSSFIID-----------DKNQIMESVTLVRFNDISMHCVSTAQKTNNCL--FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTG-QSDRPQLIQIQVGTLTIDN--------------VCQTNSDCD-----------------VIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSG-KSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG++ NLELDE  L  +L+LP+W+ I +  CNK SI++ WT +K QPI L LD VI+ +   + PR PN       P+P A       YGF ++V++G+ + +N + I   AKAF AS EL++L + S    W   D L+ TRI+   +G VL FKEI W   RIEA+  Q         PV+LITN +K+R+T+K+ L D ++I +K   IL DL WVLT SQ+KA + + +SL E I +S +  K  A    E T++S +             +  +  +   KLF  +++KETS+H+++S ++ H C++       S   V  G+++   T   ID YPYH A  +  H+  + +  + +N W                                     +T T K S +              K ++M S  +VR  D +++ VSTA++  +     +S +     LP + +  +++ T++Y+  G    +P   LY Q+N L   +D  +I+WLN F L LK  L      N F+      + S   +H  I ++ +M +  + P ++  G   D+P  + IQ   +   N              +CQ   +CD                 ++H + Q +        H  +        GN+    NK+  K++   D  +W +     WIDYEG KS   +P SF+D+  L++WI
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGELKNLELDEEVLQNMLDLPTWLAISKVFCNKASIRIPWTKLKTQPICLSLDKVIMEMSTCEEPRAPN------GPSPIATASGQSEYGFAEKVVEGITVSVNSIVIRIGAKAFNASFELSQLRIYSVNAQWEHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDDLLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAP---EPTQSSTVTSSAQHVKTPQAANAPDLSDAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRVSGGAMQLSFTQLTIDYYPYHKAGDSCSHWMYFSDATKTKNGWANELLHEFECNVEMLKQAMKDRNLGSPPKSPTHASPQHTQTEKDSTLKGTPKTPSVLPQPSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSPKSMISCNKKSLYLPQEMSAIYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSL------NQFMAVYKLNDSSKSDEHVDIRVDGLMLKFVI-PSEVKAGCHQDQPHTVSIQSSEMIATNTRHCPNCRHSDLEALCQDFKECDFFSKTYTRFPKSCDSFNLLHPIFQRHAHEQDTKMHEVY-------KGNIIPKLNKNTLKTSAATD--VWAVYFSQFWIDYEGMKSGKGRPVSFVDAFPLSIWI 728          
BLAST of UHRF1-binding protein 1-like vs. UniProt/SwissProt
Match: sp|A0JNW5|UH1BL_HUMAN (UHRF1-binding protein 1-like OS=Homo sapiens OX=9606 GN=UHRF1BP1L PE=1 SV=2)

HSP 1 Score: 327.02 bits (837), Expect = 4.532e-91
Identity = 231/750 (30.80%), Postives = 367/750 (48.93%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNI--RPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT-----------------------------------NTYTRK-----------SSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTS---QEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDN--------------VCQTNSDCDVIHQVVQEYHRS--NFFNGHTDF----------LFDISGSMGNVKTNTNKSG-KSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG++ NLELDE  L  +L+LP+W+ I +  CNK SI++ WT +K  PI L LD VI+ +   + PR PN       P+P A       YGF ++V++G+ + +N + I   AKAF AS EL++L + S   +W   D L+ TRI+   +G VL FKEI W   RIEA+  Q         PV+LITN +K+R+T+K+ L D ++I +K   IL DL WVLT SQ+KA + + +SL E I +S +  K  A    E T++S +    + +    ++N    N  +   KLF  +++KETS+H+++S ++ H C++       S   +  G+++   T   ID YPYH A  + +H+  + +  + +N W                                     +T T K           S      K ++M S  +VR  D +++ VSTA++  +     +  +     LP + +  +++ T++Y+  G    +P   LY Q+N L   +D  +I+WLN F L LK  L      N F+      + S   +H  + ++ +M +  +  +       D+P+ I IQ   +   N              + Q   DCD   +    + +S  NF   H  F          + +I    GN+    NK+  K++   D  +W +     WIDYEG KS   +P SF+DS  L++WI
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGELKNLELDEEVLQNMLDLPTWLAINKVFCNKASIRIPWTKLKTHPICLSLDKVIMEMSTCEEPRSPN------GPSPIATASGQSEYGFAEKVVEGISVSVNSIVIRIGAKAFNASFELSQLRIYSVNAHWEHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDDLLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAP---EPTQSSTVVASAQQVKTTQTSNAPDVN--DAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRITGGAMQLSFTQLTIDYYPYHKAGDSCNHWMYFSDATKTKNGWANELLHEFECNVEMLKQAVKDHNVGSPPKSPTHASPQHTQTEKDYPLKGTCRTPSVLSQQSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSPKSMICCNKKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSL------NQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHEQDTKMHEI--YKGNITPQLNKNTLKTSAATD--VWAVYFSQFWIDYEGMKSGKGRPISFVDSFPLSIWI 728          
BLAST of UHRF1-binding protein 1-like vs. UniProt/SwissProt
Match: sp|Q6NRZ1|UH1BL_XENLA (UHRF1-binding protein 1-like OS=Xenopus laevis OX=8355 GN=uhrf1bp1l PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.445e-88
Identity = 228/744 (30.65%), Postives = 358/744 (48.12%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNP-------NAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQ----DGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-QKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIW---------------------------------VTNTYTR-----------KSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNC--LFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQT----NSDCDVIHQVVQEY-----HRSNFFNGHTDF-----------------LFDISGSMGNVKTNTNK-SGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD VI+ +   + PR  N       P+P       + YGF ++V++G+ + +N + I   AKAF AS EL++L + S  P+W   D L+ TRI+   +G VL FKEI W   RIEA+ +Q    +  + PV+LITN +K+R+T+K+ L D +++ SK  F+L DL WVLT SQ+KA + + +SL E I +S +  K  A      T  S   P       +   S T   NN   KLF+ +++KETSYH+++S ++ H C++           V  G+++   +   +D YPYH       H+ +Y +  + R  W                                  +  Y +            ++F    K+  + S  +VR  D ++  VSTA +  +     +S +     LP + +   ++ T++Y+  G +  +P   LY Q+N L   LD  +++WLN F L L+    L Q    +  S   S   +H  I ++ +M +  +   K      D+P  I IQ   +   N  QT     SD + I Q  ++Y     + ++F   H  F                 + DI   +     +TN  S  + RD    +W I     W+DYEG KS   +P  F+DS   ++WI
Sbjct:    1 MAGLIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPISLSLDKVIMEMSTCEEPRSCN------GPSPLVTASGQSEYGFAEKVVEGISLSVNSIIIRIRAKAFNASFELSQLRIYSVNPSWQHGD-LRFTRIQDPQRGEVLTFKEINWQMIRIEADAIQSCDHEIMSAPVRLITNQSKIRITLKRRLKDCNVVASKLIFMLDDLLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAS----ETTQSPTPPVSSQQVKNPQTSTTPEQNNAILKLFRDFDVKETSYHLVISHLDLHICDDIHSKEKAFVRRVTGGAMQLSFSQLTVDYYPYHREGDGCSHWMHYGDATKTRCSWAQELLHEFNSNIEMLRQAVKDHNPSSPIRTVPNASQQYGQTGFDQNVKRSSPTAFGEPPKSNPLSSSFVVRLADFNIFQVSTADQCRSSPKTMISCNKKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPSPNLYVQLNALQFTLDEKSVLWLNQFVLDLRQ--SLDQFVAMYKLSDN-SKSDEHVDIRVDGLMLKFIIPSQKKQDCHPDQPAGISIQTSEMIGSNTRQTANCRRSDLEAIFQDFKDYDFYSKNFTSFPRSHDHFDILHPIFQRHAFEQDTKMHDIYKGLVAPTLDTNALSTSAARD----IWAIHFTQFWVDYEGIKSGKGRPVVFIDSFPFSIWI 726          
BLAST of UHRF1-binding protein 1-like vs. UniProt/SwissProt
Match: sp|Q6BDS2|URFB1_HUMAN (UHRF1-binding protein 1 OS=Homo sapiens OX=9606 GN=UHRF1BP1 PE=1 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.594e-83
Identity = 212/740 (28.65%), Postives = 346/740 (46.76%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKD-NINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEA----NGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNR-------QKLFQKYNLKETSYHVLVSRIEFHFCEEGD-QSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV-------------------------------------------------TNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNN--CLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQ-LIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGS--------------MGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISI 2002
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +LELP+W+ I R  CN+ SI++QWT +K  PI L LD V + ++  + PR PN      +    + YGF ++V++GM I +N + I   +KAF AS EL +L   S  PNW  SD L+ TRI    +G VL FKEI W + RIEA    NG QD   TP++LITN  ++++ +K+   D ++I SK  F+L DL WVLT SQ+KA + + ESL E       M K A + +  A     I P       S   +F  +  N         + F+K+++KE+SYH+L+SR++ H C++   +   +S N +  G+++        D YP+H A  +  H+  + E    R  W                                                  + +  R+ +F     N++  S  +VR +D+ +H VSTA + +      +S     H LP + +   ++ T++Y+       +P   LY Q+N L   +D  +++W N F L L   L+  +        ++ S   +H  I ++A   +++   +K    +  RPQ L+    G +  +     +  C  +  + + +  + FF+ + D    + G               M +     N            LW +    I +D+EG +++     +F+    L++W  +
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNVLELPTWLAITRVYCNRASIRIQWTKLKTHPICLCLDKVEVEMKTCEDPRPPNGQSPIALASGQSEYGFAEKVVEGMFIIVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSD-LRLTRITDPCRGEVLTFKEITWQTLRIEADATDNGDQDPVTTPLRLITNQGRIQIALKRRTKDCNVISSKLMFLLDDLLWVLTDSQLKAMMKYAESLSEA------MEKSAHQRKSLAPEPVQITPPAPSAQQSWAQAFGGSQGNSNSSSSRLSQYFEKFDVKESSYHLLISRLDLHICDDSQSREPGVSANRLMGGAMQLTFRKMAFDYYPFHWAGDSCKHWVRHCEAMETRGQWAQKLVMEFQSKMEKWHEETGLKPPWHLGVDSLFRRKADSLSSPRKNPLERSPSQGRQPAFQPPAWNRLRSSCMVVRVDDLDIHQVSTAGQPSKKPSTLLSCSRKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKL---EDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVAPFPLSIWACL 730          
BLAST of UHRF1-binding protein 1-like vs. TrEMBL
Match: R7V169 (Chorein_N domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_105822 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.156e-112
Identity = 261/860 (30.35%), Postives = 432/860 (50.23%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDG----QATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSN----IRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMT-RDHFPNYKEIHRMRNIWVTNT--------------YTR--------------------------------KSSFIIDDKNQIMESVTLVRFNDISMHCVSTA---QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDN--------VCQTNSDCDVIHQVVQEYHRSNFFNGHTDFL-----------------FDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI------------------SISNSPS-----------------------------SEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETAPTSVSTINMIL 2206
            M   +KNQILKHL+++TKNLSP KI ++  KGEG++ NLELDE+ LT+LL+LP+W+KI RA+CNKVSIK+QWT +K QPI L LD++++ +E  + PR P     N + +    YGF +R+IDGM + IN V + F A+ F AS++L+R+ V SK P W + D L+ TRIK   +G +L+FKE EW + RIEAN ++        TP++LI N +K+R+++KK L D  ++ S+ +  L DL WVLT SQ+ AA+ F  SL+++I +SN  +K+ A  +L+ T  ++     RP    N    N+  T +  +  +LF ++++ ETSYH+   R++ H C++           V  G+++  L     D YPYH A  + R H+  Y E    R+ WV +               YT                                 KS   +  + +++ES  + R  D S++ VSTA   +++    F+SSD  +  LP + ++   D T++Y+  G    +P + LY  +NP+ L +D+ T++WLNAF L+L  +  L Q         EP   ++H  I I A+MPRI L  ++  +   +RP+ +QIQ+  L   N        V + ++  D  +       R  F    TD L                 FD +     ++T++ K      D  K +W +  + IW ++ G  +  ++P  F++S  + LW                   S+S + +                             ++   + ++  R+ +++ HYQ + + R+++++ +A  L  E ++ F +   AP++  +I++IL
Sbjct:    1 MAGIIKNQILKHLSRFTKNLSPSKINVSTLKGEGNLSNLELDELVLTDLLDLPTWLKISRASCNKVSIKIQWTKLKSQPICLYLDEIVVEMETCETPRMPTSLDVNASYSSGGKYGFAERIIDGMFVSINSVVVNFKARTFAASIQLSRILVQSKTPLWQNGD-LRLTRIKDDLRGEILIFKEAEWQTLRIEANAMEGSTPSLSTTPLRLIANQSKIRISIKKRLIDCGMVASRLQVNLDDLLWVLTDSQLNAALGFINSLQDVIKKSNLQSKQLAAEKLKMTSPTHNPAQPRPPTTANMQQMNYG-TKSQQSMSRLFTQFDMIETSYHLYTGRVDLHLCDDAAPDDETYCRKVEGGAMQITLFKMAFDYYPYHPAGNSDRGHWVKYDENMGARDAWVQDLLSTFKEDVRTVRDFYTSPKTSPLHKNNQAPLAQQQQQQNNHQLKSPQAPKSVQKVPKQTKLLESCVVFRLEDFSLYRVSTASDHKRSTPKKFLSSDKRQLLLPPEMSSIHADYTEYYFPEGIDFPVPASNLYVVLNPIRLMMDFLTVLWLNAFTLNLLKKADLPQQV-------EP---KQHVDIKINALMPRIILPAEEDQSNVPERPEALQIQISRLMATNCRLDQKASVNELSASLDAFNAAKLYASRRKFPQKSTDLLNIPDSFCKHANKNDSPYFDKTVESVFMRTDSFK-----LDAAKDVWCVAIDQIWAEFLGLPNTRSRPVPFVESFPIVLWFIRPTPPAPVPPQHWPSSSSLSQTEADKAMSGQRASTQDIMTDSDTDLVLPPPALADAHALIRISSRVNVQITHYQYVFLMRLIETL-TANNLEMEQDSTFIRQGPAPSASMSISLIL 842          
BLAST of UHRF1-binding protein 1-like vs. TrEMBL
Match: A0A1Y1M422 (Chorein_N domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.834e-102
Identity = 245/812 (30.17%), Postives = 405/812 (49.88%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXX--XXXPRKPNKFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEI-------------------------HRMRNIWVTNTY--------------------TRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNCL-FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQ--KHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNV--CQTNSDCDVIHQVVQEYHRSNFFNG------HTDFLFDISGSMGNVKTNTNKSGKSNRDN-------------------DKSLWQICCEPIWIDYEGAKSYNN-KPKSFLDSVHLTLWI-----------SISNSP-SSEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETAPTSV 2185
            M S +KNQ+LKHL+++TKNLS +K+ ++ FKGEG++ NLEL+EI LT+LLELP W+++ +A CNKV+ ++QWT +K  PI L LD+V I  E      P        +    P  Y FI +VIDG+ + +N V I F + AF AS++++R+ + SK P W  SD L+ TR+K   +G +L+FKE+EW + RIEA   +D   TP++L+TN  + R+T+KK L+D  I+ S+   IL DL WVLT SQ+KAA+ F +SL  ++ ++  + ++A     +A R     PE   +  +      + ++   K+F +Y++ ETS+H L   I  H C++     S   N    G+++  +   Q+D YPYH+A   R H+P Y+E                          ++M++I ++ +                     T+  +++     ++M +  ++R ND S+  V+T+ K      F++ D  R  LP  T     +    Y+ +     LP   LY Q+NP+ ++ D  + +W N+F L+L           S L S++  S     +  + IEAI+P++T         Q DRP+ +  Q+   TI NV   + +S  D + + V  +H  + F G        DF       + ++ TN N        N                    K +W I  EP+W D+ GA++  N K   FLD+V +T+W+           S  N P +++I  +  + + + ++++HYQ L + R+ + IS     +  D +   K E + + V
Sbjct:    1 MVSIIKNQLLKHLSRFTKNLSADKVNLSTFKGEGELTNLELNEIVLTDLLELPCWLRLSKALCNKVTFRIQWTKLKSVPIHLNLDEVNIIAETCEELRPMSAQAGLSSYAGVPGKYSFIHKVIDGITVTVNTVNITFNSPAFTASVQVSRIILESKSPGWERSD-LRMTRLKEPDKGQLLIFKELEWQTVRIEAKSTKDKNLTPLRLLTNQARCRITIKKRLSDCFIMGSRLVIILDDLLWVLTDSQLKAALHFLDSLAGLVQKATALTRKA-----KAARKLEELPEYQAH-LAQQARAKDGVSAISKIFSRYDVVETSFHFLSQHIVLHLCDDPGLGRSCHPNLKDGGALQISVDRFQVDYYPYHLAKGDRKHWPRYREAAIPHTHWQEQSVIAFKSKLLDLIERNKMQHIPLSRSSKTETPVSPTSDSGKKPPQSPTQIKNYVSQQLAKLMTACAVIRINDFSLFKVTTSGKKQALKEFIAGDRERMSLPEDTNIVHAEFIYFYYPNDVPFPLPPPKLYMQVNPIQIHFDLDSCLWFNSFALNLH---------QSLLNSKQDISGNNIAYIDVKIEAILPKVTFESALDYHNQRDRPKTLSFQITRATITNVRSLEQSSRAD-LAKCVDFFHMGSLFFGTEFPSTANDFYIVTEKFLDHISTNDNIRSVPEELNVSSVNTLIEQLSREMLWIEAKDVWCISLEPVWGDFLGARAVGNSKAVPFLDAVPITVWLHAKMDPNSTIASTENGPKNADIHALAHISNLVSLQINHYQFLFLLRLSEEISELTTFLSLDSSRILKAENSGSMV 795          
BLAST of UHRF1-binding protein 1-like vs. TrEMBL
Match: A0A5N4APK8 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_07121 PE=4 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 2.081e-102
Identity = 245/812 (30.17%), Postives = 405/812 (49.88%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXX--XXXPRKPNKFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEI-------------------------HRMRNIWVTNTY--------------------TRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNCL-FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQ--KHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNV--CQTNSDCDVIHQVVQEYHRSNFFNG------HTDFLFDISGSMGNVKTNTNKSGKSNRDN-------------------DKSLWQICCEPIWIDYEGAKSYNN-KPKSFLDSVHLTLWI-----------SISNSP-SSEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETAPTSV 2185
            M S +KNQ+LKHL+++TKNLS +K+ ++ FKGEG++ NLEL+EI LT+LLELP W+++ +A CNKV+ ++QWT +K  PI L LD+V I  E      P        +    P  Y FI +VIDG+ + +N V I F + AF AS++++R+ + SK P W  SD L+ TR+K   +G +L+FKE+EW + RIEA   +D   TP++L+TN  + R+T+KK L+D  I+ S+   IL DL WVLT SQ+KAA+ F +SL  ++ ++  + ++A     +A R     PE   +  +      + ++   K+F +Y++ ETS+H L   I  H C++     S   N    G+++  +   Q+D YPYH+A   R H+P Y+E                          ++M++I ++ +                     T+  +++     ++M +  ++R ND S+  V+T+ K      F++ D  R  LP  T     +    Y+ +     LP   LY Q+NP+ ++ D  + +W N+F L+L           S L S++  S     +  + IEAI+P++T         Q DRP+ +  Q+   TI NV   + +S  D + + V  +H  + F G        DF       + ++ TN N        N                    K +W I  EP+W D+ GA++  N K   FLD+V +T+W+           S  N P +++I  +  + + + ++++HYQ L + R+ + IS     +  D +   K E + + V
Sbjct:    1 MVSIIKNQLLKHLSRFTKNLSADKVNLSTFKGEGELTNLELNEIVLTDLLELPCWLRLSKALCNKVTFRIQWTKLKSVPIHLNLDEVNIIAETCEELRPMSAQAGLSSYAGVPGKYSFIHKVIDGITVTVNTVNITFNSPAFTASVQVSRIILESKSPGWERSD-LRMTRLKEPDKGQLLIFKELEWQTVRIEAKSTKDKNLTPLRLLTNQARCRITIKKRLSDCFIMGSRLVIILDDLLWVLTDSQLKAALHFLDSLAGLVQKATALTRKA-----KAARKLEELPEYQAH-LAQQARAKDGVSAISKIFSRYDVVETSFHFLSQHIVLHLCDDPGLGRSCHPNLKDGGALQISVDRFQVDYYPYHLAKGDRKHWPRYREAAIPHTHWQEQSVIAFKSKLLDLIERNKMQHIPLSRSSKAETPVSPTSDSGKKPPQSPTQIKNYVSQQLAKLMTACAVIRINDFSLFKVTTSGKKQALKEFIAGDRERMSLPEDTNIVHAEFIYFYYPNDVPFPLPPPKLYMQVNPIQIHFDLDSCLWFNSFALNLH---------QSLLNSKQDISGNNIAYIDVKIEAILPKVTFESALDYHNQRDRPKTLSFQITRATITNVRSLEQSSRAD-LAKCVDFFHMGSLFFGTEFPSTANDFYIVTEKFLDHISTNDNIRSVPEELNVSSVNTLIEQLSREMLWIEAKDVWCISLEPVWGDFLGARAVGNSKAVPFLDAVPITVWLHAKMDPNSTIASTENGPKNADIHALAHISNLVSLQINHYQFLFLLRLSEEISELTTFLSLDSSRILKAENSGSMV 795          
BLAST of UHRF1-binding protein 1-like vs. TrEMBL
Match: N6U525 (Chorein_N domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=YQE_09724 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 3.473e-99
Identity = 250/822 (30.41%), Postives = 413/822 (50.24%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIR-PEL---IINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTR-KSSFI-IDDKN----------------------------------------------QIMESVTLVRFNDISMHCVSTAQKTNNCL-FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNV--CQTNSDCDVIHQVVQEYHRSNFFNGHTDF-------------LFDISGSMGNVK--------TNTNKSGKSNRDN-----DKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISISNSPSSEIGIIC------------KLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETAPTSVSTINMIL 2206
            M S +KNQ+LKHL+++TKNLS +KI ++ FKGEG++ NLEL+E  LT+LLELP W+++ +A CNKV+ ++ WT +K  PI L LD+V IS+E  +  R           +   Y FI +VIDG+ + +N V I F + AF A++++ R+SV S  P ++  D L  TR+KS  +G +L+FKE++W + RIEA   +D   TP++L+TN  + R+T+KK L+D  I+ S+   IL DL WVLT SQ+KAA+ F  SL  +I ++  + +     +L+A R   +  PE    +  +   N + T T     ++F +Y++ ETSYH + ++I FHFC++     S   N    G+++  +   Q+D YPYH+A   R H+P Y        +W    +   ++ F+ + D N                                              ++M +  ++R +D +++ V+T+ K      F+  D  R  LP + +    +   +Y+ S     LP    Y Q+NP+ +  D  T +WLN F L+L   L  ++       +++ +S   +  I +EAI+PR+          Q DRP+ + +QV   TI NV   + +S  D + + +  +  ++ F G TDF               D   +  NV+        T+   +G+  R +      K +W I  +P++ D+ GA+S  NKP  FLD+V +T+W+  +  P+S IG  C             + + + ++++HYQ L + R+ D  +  +  +  D +   K E   TS   I  IL
Sbjct:    1 MVSIIKNQLLKHLSRFTKNLSADKINLSTFKGEGELTNLELNEDVLTDLLELPCWLRLTKAWCNKVTFRITWTKLKTVPICLSLDEVNISIETCEELRSMATGPSPAQGSLGKYSFIHKVIDGITVTVNTVNIAFNSPAFVATLQIQRISVESVTPKFTRMD-LPLTRLKSPEKGQLLIFKELQWQTVRIEAKSTKDDTLTPLRLLTNQARCRITIKKRLSDCFILGSRLVIILDDLLWVLTDSQLKAALHFLNSLSGLIDKATRLTR-----KLKAARKLEVELPEYQAQLAQEALQNVA-TKTAKTSSRMFAQYDVVETSYHFMSNQIVFHFCDDPGDGRSSHPNLREGGALQISIKKFQVDFYPYHLAKGDRRHWPTYNASAVPHALWQEQAFASFRNKFVELLDHNKSQHVPLSRKPKGDQSNSTVPCGPESEKSTNPSSKEVRRRLEMQLNKLMTTSVVIRVDDFTVYRVTTSGKKQVLKEFLCGDRNRMSLPKEASIIHAEYIYYYYPSEVPFPLPAPKFYVQVNPIQIVFDRDTCLWLNCFLLNLYRSLLTTE-------AKDTASSFTYIDIKVEAILPRLNFESTAEYHNQRDRPKCLSMQVTRATITNVRSLEHSSRAD-LAKCIDSFSMASLFFG-TDFPSEIGDFYVVTEKFLDHIKAADNVRQQPLHLDVTSLESTGEELRRDLFWTEAKDVWCILLDPVYGDFLGAQSDINKPIPFLDAVPITIWLHAAFDPNSTIGDKCDKSCTADIHALAHISNLVSVQLNHYQYLFLLRLADQATELVTFLNIDSDNILKTEN--TSSMVIGAIL 804          
BLAST of UHRF1-binding protein 1-like vs. TrEMBL
Match: A0A1B6HUW7 (Chorein_N domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.20283 PE=4 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 4.895e-99
Identity = 246/809 (30.41%), Postives = 401/809 (49.57%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNIN-PNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTY--------------------TRKS---------------SFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNCL--FVSSDIARHKLP--AKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNV--CQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNK--SGKSNRDN----------------------------DKSLWQICCEPIWIDYEGAKSY-NNKPKSFLDSVHLTLWISISNSPSSEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETAPTSVSTINMILQIDKTSI 2227
            M S +KNQILKHL++YTKNLS +KI ++ FKGEG++ +LELDEI LT+LLELPSW+++  A CNKV+ ++QWT +K  PI L LD+V I+VE  +  R  +  +   +      Y FI +VIDGM I +N+V + F + AF A++++ R+ V SK P+W     L+ T++K   +G +L+FKE+EW + RIEA+  +D    P++L+TN T+ R+T+KK L+D  ++  +   +L DL WVLT SQ+KAA+ F +SL  +I +  ++ +       +A R   + PE      +         +    +F +Y+  ETSYH    +I+ H  ++     S   +    G+ +  L   Q+D YPYH+AS  R H+  YKE       W+T  +                    +R S               ++++    ++M +  ++R  D ++  V+T+ K       FV  D  RH +    +  T   + T +Y+       LP    Y  +NP+ ++LD  T++W+N+F L+L+  L L+  +N      + +    +  + IEAIMPR+ L       GQ DRP+ +   V   ++ NV   +  S  D + + V  Y   + F G      D     G++   T+K  S     DN                             K +W +  EP+W D+ G ++  NN+P  FLD+  LTLW  +    S +I  +  +   + ++V+HYQ L + R+ D ++     +  D      H   PTSV    ++ Q++ T +
Sbjct:   22 MVSLIKNQILKHLSRYTKNLSADKINLSTFKGEGELSSLELDEIVLTDLLELPSWLRLTSAWCNKVTFRIQWTKLKTVPIHLSLDEVHINVETCEELRSMSSHQSLASLGTATKYNFIHKVIDGMTICVNMVNVKFRSPAFTATVQILRIVVQSKTPDWKVVGDLRLTKLKEPKKGQILIFKELEWQTVRIEASSTKDRDLPPLRLLTNCTRCRITIKKRLSDCFVMGCRLALLLDDLLWVLTDSQLKAALCFIDSLSGLIKKDTEVTRTK-----KAARKLEVLPEYQAQ-LAQQARVAEARDTMSDIFARYDFIETSYHFFCQKIDLHLSDDPGPGRSCHPDLEAGGAFQINLHCFQVDYYPYHLASGDRHHWAKYKEGSSPHTQWLTQAHAVFRNTLLQLIESHSTHSPLSRDSQEPKATSSPSNNPVKNYVLSQLAKLMTACVILRIEDFTLFRVTTSAKKQQQPKEFVKGDRERHAMTHVPEIMTLHAEFTYYYYPGDVPFPLPPPKFYVLLNPIQIHLDVLTLLWINSFALNLQQSL-LNAASN------QDTVALSYIDVKIEAIMPRLILESVGEQVGQKDRPRSLHFTVSRASVTNVRSVERCSRAD-LAKCVNAYQLGSLFFGE-----DFPSRSGDLHVLTDKFISHVQCSDNVRPVPGTLPTSSVELALTHLHRELLWTEAKDVWCVLLEPVWGDFYGVRAVGNNRPVPFLDAFPLTLWAHVGPPASPDIRALAHVPSLVSLQVNHYQFLFLLRVADQLTELTTFLAMDSERIV-HRDTPTSVVVGALVPQLEVTFV 810          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Cavefish
Match: uhrf1bp1l (UHRF1 binding protein 1 like [Source:NCBI gene;Acc:103033711])

HSP 1 Score: 289.656 bits (740), Expect = 7.941e-80
Identity = 210/729 (28.81%), Postives = 356/729 (48.83%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKN-------------------------------QIMESVTLVRFNDISMHCVSTA--QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTN----SDCDVIHQVVQEYHRSN------------------FFNGHTD----FLFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD V++ +   D PR  N       P+P A       YGF ++V++G+ + +N + I  +AKAF AS EL++L V S   +W  SD L+ TRI+  T+G +L FKE+ W   RIEA+ +Q  +    + P++LITN +K+R+T+K+ + D +++ SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A    ++++ +   P           +  +   +  +LF  YN+ ETS+H+ ++ ++ H C++           +  G+++   ++  +D YP+H A  +  H+ +Y +  + R  W  +      S +   KN                               Q+M S  ++R  D S++ VSTA  ++++    +S +     LP +    + + T++Y+  G    +P   LY Q+N L L +D  +++WLN F L L+  L+          SQ+P    +H  + ++ +M ++ +  D+    Q D P+ I +Q   +   N   ++    SD + + Q  +E                        F  H       + D+   +     +TN + K+    D  LW +     W+DYEG      +P   +DS  LTLW+
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPITLSLDKVVMEMSTCDEPRPHN------GPSPIATASGQSEYGFAEKVVEGISLSVNSIVIRISAKAFNASFELSQLQVYSVNTSWVASD-LRFTRIQDPTRGEILTFKEVNWQMIRIEADAIQSSEHEVLSAPIRLITNQSKIRVTLKRKMKDCNVVASKLILILDDLLWVLTDSQLKAMVQYAKSLSEAMEKSALQRKSMAS---DSSQTAPAPPSAQQVHTQQASAAQDQSASMARLFNAYNVCETSHHLQITHLDLHICDDIHAKDRGFSKRIEGGAMQLSFSSITVDYYPFHRAGESCLHWMHYSDATKAREGWARSLLEDFRSNVDMLKNAVSGQTQSSPQHGKISTSSSSSFSPPPTPRTQMMSSSIVLRMADFSIYQVSTADQRRSSPKAMLSCNKKTLYLPQEMPAIYAEFTEYYFPDGKDYPIPCPNLYVQLNALQLVVDSRSLVWLNLFALDLRQSLEQFMELYKLDDSQKP---DEHVDVRVDGLMLKLVIPADQEQL-QPDLPRSISVQTSEMVATNTRHSSGCSRSDLESLLQAFREQAFFTSSSSSFPRSSSAFPVLHPVFQRHAHEQDTRVHDVYRGLAPPSLSTN-ALKTPSATD--LWALHFSQFWVDYEG----RGRPTPCVDSFPLTLWV 708          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Cavefish
Match: uhrf1bp1l (UHRF1 binding protein 1 like [Source:NCBI gene;Acc:103033711])

HSP 1 Score: 286.189 bits (731), Expect = 1.273e-78
Identity = 210/732 (28.69%), Postives = 356/732 (48.63%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRD---HFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKN-------------------------------QIMESVTLVRFNDISMHCVSTA--QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTN----SDCDVIHQVVQEYHRSN------------------FFNGHTD----FLFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD V++ +   D PR  N       P+P A       YGF ++V++G+ + +N + I  +AKAF AS EL++L V S   +W  SD L+ TRI+  T+G +L FKE+ W   RIEA+ +Q  +    + P++LITN +K+R+T+K+ + D +++ SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A    ++++ +   P           +  +   +  +LF  YN+ ETS+H+ ++ ++ H C++           +  G+++   ++  +D YP+H A    +   H+ +Y +  + R  W  +      S +   KN                               Q+M S  ++R  D S++ VSTA  ++++    +S +     LP +    + + T++Y+  G    +P   LY Q+N L L +D  +++WLN F L L+  L+          SQ+P    +H  + ++ +M ++ +  D+    Q D P+ I +Q   +   N   ++    SD + + Q  +E                        F  H       + D+   +     +TN + K+    D  LW +     W+DYEG      +P   +DS  LTLW+
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPITLSLDKVVMEMSTCDEPRPHN------GPSPIATASGQSEYGFAEKVVEGISLSVNSIVIRISAKAFNASFELSQLQVYSVNTSWVASD-LRFTRIQDPTRGEILTFKEVNWQMIRIEADAIQSSEHEVLSAPIRLITNQSKIRVTLKRKMKDCNVVASKLILILDDLLWVLTDSQLKAMVQYAKSLSEAMEKSALQRKSMAS---DSSQTAPAPPSAQQVHTQQASAAQDQSASMARLFNAYNVCETSHHLQITHLDLHICDDIHAKDRGFSKRIEGGAMQLSFSSITVDYYPFHRAGTNCESCLHWMHYSDATKAREGWARSLLEDFRSNVDMLKNAVSGQTQSSPQHGKISTSSSSSFSPPPTPRTQMMSSSIVLRMADFSIYQVSTADQRRSSPKAMLSCNKKTLYLPQEMPAIYAEFTEYYFPDGKDYPIPCPNLYVQLNALQLVVDSRSLVWLNLFALDLRQSLEQFMELYKLDDSQKPD---EHVDVRVDGLMLKLVIPADQEQL-QPDLPRSISVQTSEMVATNTRHSSGCSRSDLESLLQAFREQAFFTSSSSSFPRSSSAFPVLHPVFQRHAHEQDTRVHDVYRGLAPPSLSTN-ALKTPSATD--LWALHFSQFWVDYEG----RGRPTPCVDSFPLTLWV 711          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Cavefish
Match: uhrf1bp1l (UHRF1 binding protein 1 like [Source:NCBI gene;Acc:103033711])

HSP 1 Score: 273.092 bits (697), Expect = 1.821e-74
Identity = 208/710 (29.30%), Postives = 353/710 (49.72%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEE---GDQSSSL-------SKNSVFNGSVKFLLTNCQ--IDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTA--QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTN----SDCDVIHQVVQEYHRSN------------------FFNGHTD----FLFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ I +  CNK +I++ WT +K  PI L LD V++ +   D PR  N       P+P A       YGF ++V++G+ + +N + I  +AKAF AS EL++L V S   +W  SD L+ TRI+  T+G +L FKE+ W   RIEA+ +Q  +    + P++LITN +K+R+T+K+ + D +++ SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A    ++++ +   P           +  +   +  +LF  YN+ ETS+H+ ++ ++ H C++    D+  S               G  + LL + +  +D+    V+  T+   P + +I    +   +   T ++        Q+M S  ++R  D S++ VSTA  ++++    +S +     LP +    + + T++Y+  G    +P   LY Q+N L L +D  +++WLN F L L+  L+          SQ+P    +H  + ++ +M ++ +  D+    Q D P+ I +Q   +   N   ++    SD + + Q  +E                        F  H       + D+   +     +TN + K+    D  LW +     W+DYEG      +P   +DS  LTLW+
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQNMLDLPTWLAINKVFCNKAAIRIPWTKLKTHPITLSLDKVVMEMSTCDEPRPHN------GPSPIATASGQSEYGFAEKVVEGISLSVNSIVIRISAKAFNASFELSQLQVYSVNTSWVASD-LRFTRIQDPTRGEILTFKEVNWQMIRIEADAIQSSEHEVLSAPIRLITNQSKIRVTLKRKMKDCNVVASKLILILDDLLWVLTDSQLKAMVQYAKSLSEAMEKSALQRKSMAS---DSSQTAPAPPSAQQVHTQQASAAQDQSASMARLFNAYNVCETSHHLQITHLDLHICDDIHAKDRGESCLHWMHYSDATKAREGWARSLLEDFRSNVDMLKNAVSGQTQSS-PQHGKISTSSSSSFSPPPTPRT--------QMMSSSIVLRMADFSIYQVSTADQRRSSPKAMLSCNKKTLYLPQEMPAIYAEFTEYYFPDGKDYPIPCPNLYVQLNALQLVVDSRSLVWLNLFALDLRQSLEQFMELYKLDDSQKPD---EHVDVRVDGLMLKLVIPADQEQL-QPDLPRSISVQTSEMVATNTRHSSGCSRSDLESLLQAFREQAFFTSSSSSFPRSSSAFPVLHPVFQRHAHEQDTRVHDVYRGLAPPSLSTN-ALKTPSATD--LWALHFSQFWVDYEG----RGRPTPCVDSFPLTLWV 680          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Cavefish
Match: uhrf1bp1 (UHRF1 binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-090312-82])

HSP 1 Score: 263.462 bits (672), Expect = 9.103e-72
Identity = 182/571 (31.87%), Postives = 278/571 (48.69%), Query Frame = 2
Query:   14 YFMTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKD-NINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGL----QDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGS---VKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTR------KSSF--IIDDKN------------------------QIMESVTLVRFNDISMHCVSTAQKTNNCL--FVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAI 1600
            +F   FL   +   L+++TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ + R  CNK +I++QWT +K  PI L LD V + +   + PR PN      I P  + YGF ++V++GM + IN + I   A+AF AS EL +L   S  P W  +D L+ TRI    +G VL FKEI W S RIE + +    QD  +TP++LITN  ++R+ +K+ + D +++ SK  FIL DL WVLT SQ+KA I + +SL E + +S    K  A   L+    S     L            +TL    + F  +++KE+SYH  +SR++ H C   D SS+ +      GS   ++        D YP+H       H+  Y      R  W              S F   I D+N                        +   S  + R +D+ +H VST  + +      +S +    +LP  T    +  T++Y+       +P + LY Q+N L L +D P+++W+  F   L   L+      +F   Q+ S   +HP +
Sbjct:    6 FFFPVFLCPCV--PLSRFTKNLSPDKINLSTLKGEGQLSNLELDEEVLQNMLDLPTWLAVTRVYCNKAAIRIQWTKLKTSPICLFLDKVEVEMRTCEEPRPPNGPSPIAITPGQSEYGFAEKVVEGMSVIINSITIKVQARAFHASFELWQLQGYSLNPKWQKTD-LRYTRITHPKRGEVLTFKEINWQSLRIEVDAIESDDQDLGSTPLRLITNQGRIRIALKRRVKDCNVLASKLLFILDDLLWVLTDSQLKAVIHYAKSLSEAMEKSAQQGKSMAAESLQTAPPSPGPNPLWAEHPPAPVGTPSTL---AQYFDLHDVKESSYHTFISRLDLHICN--DSSSAETDEPPVPGSQGAMQLTFRKLGCDYYPFHRPGDGCRHWEGYCGAMDSRAQWAAKLLQEFQQRVDASGFPGPIADQNPPESARKSSPEGGVASRTSGTALKRFRSSCMVFRVDDLDIHQVSTGGRNSKRTQSLLSCNRKTLQLPENTPAIHMQFTEYYFPHSPGTPVPCSNLYAQLNGLQLCVDAPSLLWMALFSRGL---LRTLDQVKAFYHLQDSSKTDEHPVL 565          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Sea Lamprey
Match: uhrf1bp1l (UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-GENE-041210-177])

HSP 1 Score: 305.834 bits (782), Expect = 3.787e-88
Identity = 221/765 (28.89%), Postives = 369/765 (48.24%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGL----QDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLE---ATRNSNIRPE----LIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTN---------------------------TYTRKSSFIIDDKNQI---------------------MESVTLVRFNDISMHCVSTA---QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNV-----CQTNSDCDVIHQVVQEYHRSNFFNGHTDF---------------LF-----------------DISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWI 1996
            M + +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  + ++L+LP+W+ I R  CN+ ++++QWT +K  PI L LD V + +   + PR+PN       P+P A       YGF ++V++GM + ++ + +   A+AF AS +L++L V S  PNW  SD L+ TRI    +G VL FKE EW + RIE + +    Q+  ATP++LITN  ++R+ +K++LTD ++I SK   +L DL WVLT SQ+KA + + +SL E I +S    K  A  R++       +N+ P       +++      +   ++     F+++++KE SYH ++ R++ H C++       +K  V  G+++  +    +D YPYH A    +H+ +Y E    R  W +                            T    S F I + +++                     + S  ++R  DI ++ VSTA   Q T   L   +  A   LP + +   ++ TD+Y+       +P + LY Q+N L   +D  +I+W+N F L +   L+  +     L   E     +H  I ++ +M ++ L  +K+V  Q  RP  I +Q+  +   NV     CQ +   D+ H ++  +  SNF++G  DF               +F                 D++  +      T+ SG         +W +     W+DYEG      +P   +DS  +TLW+
Sbjct:    1 MAALIKKQILKHLSRFAKNLSPDKINVSTLKGEGHLSNLELDESVIQDVLDLPTWLAITRVFCNRAAVRIQWTKLKTHPISLFLDKVEVEMMTCEEPRRPN------GPSPIATISGQSEYGFAEKVVEGMSLSVSSIVVHVRAQAFNASFQLSQLRVYSVNPNWEGSD-LRFTRILDPNRGQVLTFKEAEWQTLRIEVDAIHSEEQEAAATPLRLITNQARLRIVLKRTLTDCNVISSKLTLLLDDLLWVLTDSQLKAVVKYAQSLAESIEKSTQQQKSLASHRVQHVCVQTPANLSPGSQSNTQVSEQPDPKGYKEAISC---FFERHDVKEPSYHSVIKRLDLHLCDDNSVCEEPTKRRVPGGAMQLTIHRLTLDYYPYHRAGQPCEHWQHYNESTEARMKWASGLLEEFRSQVAQLKVAAGDMGTVPPKLCTTRSLSDFSISNDHKVEGVSRGMGASASAAQPSNTKLLSSCLVLRVEDIDVYQVSTADMRQGTPQKLLSCNKKALF-LPPEMSAIHMEFTDYYFPEERQFPIPSSNLYVQLNALQFTMDARSILWMNRFMLDVNQSLEHFKA----LQGAEQVHPPEHIDIRVDGLMLKVVLPAEKVVE-QPGRPHAISLQISDMVTTNVRHGLNCQRS---DLKH-ILTRFQESNFYHG--DFTSFPKSAESMHSASPMFWRHAEGMDTKLYRIERDDVAADLTRDALKTHASG--------DVWAMHLSQFWVDYEG----RGRPLGCVDSFPVTLWL 731          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Nematostella
Match: EDO43237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ76])

HSP 1 Score: 223.787 bits (569), Expect = 6.311e-65
Identity = 134/377 (35.54%), Postives = 208/377 (55.17%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINP---NPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGL-QDGQAT---PVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKL-----FQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYH 1114
            M+  +KNQI K L ++TKNLSP KI +   KGEG++ NLELDE  L++LLELP W++I +A CNK+S K+ WT +K  PI LV                  + K N+       N YGF+++V+DGM ++IN V + F A  F A+ +++RL V S  P+W   D L+ TR+K  T+G VL FKEI W + RI+A    QD   T   P++LIT+ + + +T+KK + D S++ +  + +L D+ WVLT +Q++A + F  S+ + I       +E  + ++E   ++    +         +S +N  N   K      F K++L ETSYH+   RI+ H  +  D S     + +  G+++  +     D YPYH
Sbjct:    1 MSGLVKNQIAKQLARFTKNLSPNKISVKFLKGEGELHNLELDEKILSDLLELPPWLRITKADCNKISAKIHWTKLKTDPICLVG----------------GRLKQNVKSLEKATNQYGFVEKVVDGMYVQINSVLVSFKAPEFSANFQMSRLIVQSTTPDWK-PDDLRNTRLKDETKGEVLTFKEITWSTLRIDAFAREQDNSNTNSAPIRLITSQSSLHITIKKRIEDCSVLSACLKLLLDDILWVLTQTQLQALMKFMNSVNKTI-------EENRRTQIEPASSTTPTSQASQQHTHAQYSSSNLQNGPDKKESTTPFSKHDLLETSYHLRTGRIDLHLSD--DSSEVTPSDPLSGGAMQIRINKLATDYYPYH 351          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Medaka
Match: uhrf1bp1l (UHRF1 binding protein 1 like [Source:NCBI gene;Acc:101159151])

HSP 1 Score: 307.375 bits (786), Expect = 1.724e-85
Identity = 214/739 (28.96%), Postives = 360/739 (48.71%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAA---KIRLEATRNSNIRPEL--IINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTR-KSSFII--------------------------------------DDKNQIMESVTLVRFNDISMHCVSTA--QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIH--QVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSL----------------------WQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLW 1993
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  LL+LP+W+ I R  CNK +I++ WT +K  PI L LD V++ +   D PR PN       P+P A       YGF ++V++G+ + IN + I  +AKAF AS EL++L V S   +W+ SD L+ TRI+   +G +L FKEI W   RIEA+ +Q  +    + P++LITN +K+R+T+K+ + D +++ SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A   ++    T    +R +   +  D S   +         KLF  Y++ ETS+H+ ++ ++ H C++   +  ++   +  G+++    +  +D YP+H A  +  H+ +Y E  + R +W  +     KSS  +                                        K  +M S  ++R  D S++ VSTA  ++++    +S +     LP +     ++ T++Y+  G    +P   LY Q+N L L LD  +++W+N F L L+  L+          SQ+P    +H  I ++ +M ++ +  D   +  +D P+ I IQ   +   N  +  + C   H   ++Q +    FF+  ++     S S+  +     +  K      + +                      W +     W+DYE  +    +P+ F+DS  LT+W
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQSLLDLPTWLAINRVFCNKAAIRIPWTKLKTHPISLTLDKVVMEMSTCDEPRPPN------GPSPIATASGQSEYGFAEKVVEGLSLSINSIVIRISAKAFNASFELSQLQVYSVNTSWNPSD-LRFTRIQDPQRGEILTFKEISWQMIRIEADAIQSAEHEMLSAPIRLITNQSKIRVTLKRRIKDCNVVASKLILILDDLLWVLTDSQLKAMVQYAKSLSEAMEKSAQQRKSMATEDQVSSTPTSAQQVRTQQTPMAADQSATMA---------KLFSAYDVCETSHHLQITHLDLHICDDIHTTDKVNNKRITGGAMQLSFNSITLDYYPFHRAGDSCVHWMHYSEATKTREVWAKSLLDEFKSSMEMLKSAARDQQGPGSGRSSPQHGKIKTSSSSTSFSPPPPQTPKTHLMSSSIVLRMADFSIYQVSTADQRRSSPKTMISCNKKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKP---DEHVDIKVDGLMLKLVVPTDSDASCPADLPRSISIQSSEMVATNT-RHPTYCTRSHLEALLQAFEEEVFFSTSSNAFPHSSSSIPILHPVFQRHAKEEDTKQQEICRGLVVPTMCTDALKTPAATDVWALHFSQFWVDYEATRGGKGRPQPFVDSFPLTVW 719          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Medaka
Match: uhrf1bp1 (UHRF1 binding protein 1 [Source:NCBI gene;Acc:101163977])

HSP 1 Score: 295.434 bits (755), Expect = 7.741e-82
Identity = 217/741 (29.28%), Postives = 358/741 (48.31%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGL----QDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSV----FNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVT---NTYTRKSSF---------------------IIDDKN---------------------------QIMESVTLVRFNDISMHCVSTA----QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNV--CQTNSDCDVIHQVVQEYHRSNFFN--GHTDFLFDISG-----SMGNVKTNTNKSGKSNRDNDKS--LWQICCEPIWIDYEGAKSY-NNKPKSFLDSVHLTLWI 1996
            M   +K QILKHL+++TKNLSP+KI ++  KGEG + NLELDE  L  +L+LP+W+ + R  CNK +I++QWT +K  PI L LD V + +   + PR PN       P+P A       YGF ++V++GM ++IN + I   A+AF AS EL +L  +S  P W  SD L+ TRI    +G VL FKEI W S RIEA+ +    QD   TP++LITN  ++R+ +K+ + D +++ SK  FIL DL WVLT SQ+KA I + +SL E + +S    K    +  E+ + +   P L         S T+T  N  + F  Y++KE+SYH  +SR++ H C +   SSS+ ++        G+++        D YP H  +    H+  Y      +  W +     Y R++                       + D ++                           ++  S  ++R +D+ +H VST     +KTN+ L  +  + R  LP       L  T++Y+   SS  +P + LY Q+N L L +D  +I+W++ F   L + L       +F   Q+ +  ++H  I ++A   ++ +  D  +    +RPQ + + +  + + N   C   S  D +    +++   +FF       F  D S      S      N  +    NR   +S  +W +    + + ++GA+ +   K + F++   +++W+
Sbjct:    1 MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLSNLELDEEVLQNMLDLPTWLAVTRVYCNKAAIRIQWTKLKTSPICLFLDKVEVEMRTCEEPRPPN------GPSPIAITAGQSEYGFAEKVVEGMSVRINSITIKVHARAFHASFELWQLQGNSLNPKWQHSD-LRYTRITDPKRGEVLTFKEINWQSLRIEADAIESDDQDLGNTPLRLITNQGRIRIALKRRIKDCNVLASKLLFILDDLLWVLTDSQLKAIIHYAKSLSEAMEKSAQQRK---SMTAESLQTAPPSPGLHSLWTEPPPSSTSTPTNMSQYFDLYDVKESSYHTFISRLDLHICND---SSSMDEDEAPPPGLQGAMQLTFRKLGFDYYPIHRPADGCRHWERYNGAMEAQAQWASKLLQEYQRRAEACGFPGPHAELSEPTKDSPAKTVPDGQSSTNSNNWSKEQTTSRNSVTASAEASMKRLRSSCVVIRMDDVDIHQVSTRARQNKKTNSLLSCNRKLLR--LPDNVPAVHLQFTEYYFPDNSSLPVPTSNLYAQLNSLQLCVDSASILWISLFSKGLLHTLDQ---VKAFYHLQDSNKVEEHVDIRMDASQLKLIVPLDSSILDHPERPQSLSVIIPQMALSNTRHCPHGSRAD-LSSTCEKFSSCSFFQPAAGCPFPRDPSAFHPIPSAFTQHANEKELQPLNRKQLRSQDVWSLSLSHVTLGFDGARRFPKGKTQPFVEPFAVSVWM 722          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Medaka
Match: uhrf1bp1l (UHRF1 binding protein 1 like [Source:NCBI gene;Acc:101159151])

HSP 1 Score: 249.98 bits (637), Expect = 5.168e-67
Identity = 147/404 (36.39%), Postives = 234/404 (57.92%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAA---KIRLEATRNSNIRPEL--IINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  LL+LP+W+ I R  CNK +I++ WT +K  PI L LD V++ +   D PR PN       P+P A       YGF ++V++G+ + IN + I  +AKAF AS EL++L V S   +W+ SD L+ TRI+   +G +L FKEI W   RIEA+ +Q  +    + P++LITN +K+R+T+K+ + D +++ SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A   ++    T    +R +   +  D S   +         KLF  Y++ ETS+H+ ++ ++ H C++   +  ++   +  G+++    +  +D YP+H A  +  H+ +Y E  + R +W 
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQSLLDLPTWLAINRVFCNKAAIRIPWTKLKTHPISLTLDKVVMEMSTCDEPRPPN------GPSPIATASGQSEYGFAEKVVEGLSLSINSIVIRISAKAFNASFELSQLQVYSVNTSWNPSD-LRFTRIQDPQRGEILTFKEISWQMIRIEADAIQSAEHEMLSAPIRLITNQSKIRVTLKRRIKDCNVVASKLILILDDLLWVLTDSQLKAMVQYAKSLSEAMEKSAQQRKSMATEDQVSSTPTSAQQVRTQQTPMAADQSATMA---------KLFSAYDVCETSHHLQITHLDLHICDDIHTTDKVNNKRITGGAMQLSFNSITLDYYPFHRAGDSCVHWMHYSEATKTREVWA 388          

HSP 2 Score: 83.9593 bits (206), Expect = 1.054e-15
Identity = 64/282 (22.70%), Postives = 121/282 (42.91%), Query Frame = 2
Query: 1226 KNQIMESVTLVRFNDISMHCVSTA--QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIH--QVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSL----------------------WQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLW 1993
            K  +M S  ++R  D S++ VSTA  ++++    +S +     LP +     ++ T++Y+  G    +P   LY Q+N L L LD  +++W+N F L L+  L+          SQ+P    +H  I ++ +M ++ +  D   +  +D P+ I IQ   +   N  +  + C   H   ++Q +    FF+  ++     S S+  +     +  K      + +                      W +     W+DYE  +    +P+ F+DS  LT+W
Sbjct:  490 KTHLMSSSIVLRMADFSIYQVSTADQRRSSPKTMISCNKKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKP---DEHVDIKVDGLMLKLVVPTDSDASCPADLPRSISIQSSEMVATNT-RHPTYCTRSHLEALLQAFEEEVFFSTSSNAFPHSSSSIPILHPVFQRHAKEEDTKQQEICRGLVVPTMCTDALKTPAATDVWALHFSQFWVDYEATRGGKGRPQPFVDSFPLTVW 767          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Medaka
Match: uhrf1bp1l (UHRF1 binding protein 1 like [Source:NCBI gene;Acc:101159151])

HSP 1 Score: 249.98 bits (637), Expect = 5.778e-67
Identity = 147/404 (36.39%), Postives = 234/404 (57.92%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAA---KIRLEATRNSNIRPEL--IINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  LL+LP+W+ I R  CNK +I++ WT +K  PI L LD V++ +   D PR PN       P+P A       YGF ++V++G+ + IN + I  +AKAF AS EL++L V S   +W+ SD L+ TRI+   +G +L FKEI W   RIEA+ +Q  +    + P++LITN +K+R+T+K+ + D +++ SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A   ++    T    +R +   +  D S   +         KLF  Y++ ETS+H+ ++ ++ H C++   +  ++   +  G+++    +  +D YP+H A  +  H+ +Y E  + R +W 
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQSLLDLPTWLAINRVFCNKAAIRIPWTKLKTHPISLTLDKVVMEMSTCDEPRPPN------GPSPIATASGQSEYGFAEKVVEGLSLSINSIVIRISAKAFNASFELSQLQVYSVNTSWNPSD-LRFTRIQDPQRGEILTFKEISWQMIRIEADAIQSAEHEMLSAPIRLITNQSKIRVTLKRRIKDCNVVASKLILILDDLLWVLTDSQLKAMVQYAKSLSEAMEKSAQQRKSMATEDQVSSTPTSAQQVRTQQTPMAADQSATMA---------KLFSAYDVCETSHHLQITHLDLHICDDIHTTDKVNNKRITGGAMQLSFNSITLDYYPFHRAGDSCVHWMHYSEATKTREVWA 388          

HSP 2 Score: 83.5741 bits (205), Expect = 1.284e-15
Identity = 64/282 (22.70%), Postives = 121/282 (42.91%), Query Frame = 2
Query: 1226 KNQIMESVTLVRFNDISMHCVSTA--QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIH--QVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSL----------------------WQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLW 1993
            K  +M S  ++R  D S++ VSTA  ++++    +S +     LP +     ++ T++Y+  G    +P   LY Q+N L L LD  +++W+N F L L+  L+          SQ+P    +H  I ++ +M ++ +  D   +  +D P+ I IQ   +   N  +  + C   H   ++Q +    FF+  ++     S S+  +     +  K      + +                      W +     W+DYE  +    +P+ F+DS  LT+W
Sbjct:  490 KTHLMSSSIVLRMADFSIYQVSTADQRRSSPKTMISCNKKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKP---DEHVDIKVDGLMLKLVVPTDSDASCPADLPRSISIQSSEMVATNT-RHPTYCTRSHLEALLQAFEEEVFFSTSSNAFPHSSSSIPILHPVFQRHAKEEDTKQQEICRGLVVPTMCTDALKTPAATDVWALHFSQFWVDYEATRGGKGRPQPFVDSFPLTVW 767          
BLAST of UHRF1-binding protein 1-like vs. Ensembl Medaka
Match: uhrf1bp1l (UHRF1 binding protein 1 like [Source:NCBI gene;Acc:101159151])

HSP 1 Score: 249.98 bits (637), Expect = 5.915e-67
Identity = 147/404 (36.39%), Postives = 234/404 (57.92%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNA-------YGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQ----ATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAA---KIRLEATRNSNIRPEL--IINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWV 1183
            M   +K QILKHL+++ KNLSP+KI ++  KGEG + NLELDE  L  LL+LP+W+ I R  CNK +I++ WT +K  PI L LD V++ +   D PR PN       P+P A       YGF ++V++G+ + IN + I  +AKAF AS EL++L V S   +W+ SD L+ TRI+   +G +L FKEI W   RIEA+ +Q  +    + P++LITN +K+R+T+K+ + D +++ SK   IL DL WVLT SQ+KA + + +SL E + +S    K  A   ++    T    +R +   +  D S   +         KLF  Y++ ETS+H+ ++ ++ H C++   +  ++   +  G+++    +  +D YP+H A  +  H+ +Y E  + R +W 
Sbjct:    1 MAGLIKKQILKHLSRFAKNLSPDKINLSTLKGEGQLTNLELDEEVLQSLLDLPTWLAINRVFCNKAAIRIPWTKLKTHPISLTLDKVVMEMSTCDEPRPPN------GPSPIATASGQSEYGFAEKVVEGLSLSINSIVIRISAKAFNASFELSQLQVYSVNTSWNPSD-LRFTRIQDPQRGEILTFKEISWQMIRIEADAIQSAEHEMLSAPIRLITNQSKIRVTLKRRIKDCNVVASKLILILDDLLWVLTDSQLKAMVQYAKSLSEAMEKSAQQRKSMATEDQVSSTPTSAQQVRTQQTPMAADQSATMA---------KLFSAYDVCETSHHLQITHLDLHICDDIHTTDKVNNKRITGGAMQLSFNSITLDYYPFHRAGDSCVHWMHYSEATKTREVWA 388          

HSP 2 Score: 83.5741 bits (205), Expect = 1.144e-15
Identity = 64/282 (22.70%), Postives = 121/282 (42.91%), Query Frame = 2
Query: 1226 KNQIMESVTLVRFNDISMHCVSTA--QKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIH--QVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSL----------------------WQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLW 1993
            K  +M S  ++R  D S++ VSTA  ++++    +S +     LP +     ++ T++Y+  G    +P   LY Q+N L L LD  +++W+N F L L+  L+          SQ+P    +H  I ++ +M ++ +  D   +  +D P+ I IQ   +   N  +  + C   H   ++Q +    FF+  ++     S S+  +     +  K      + +                      W +     W+DYE  +    +P+ F+DS  LT+W
Sbjct:  490 KTHLMSSSIVLRMADFSIYQVSTADQRRSSPKTMISCNKKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKP---DEHVDIKVDGLMLKLVVPTDSDASCPADLPRSISIQSSEMVATNT-RHPTYCTRSHLEALLQAFEEEVFFSTSSNAFPHSSSSIPILHPVFQRHAKEEDTKQQEICRGLVVPTMCTDALKTPAATDVWALHFSQFWVDYEATRGGKGRPQPFVDSFPLTVW 767          
BLAST of UHRF1-binding protein 1-like vs. Planmine SMEST
Match: SMESG000044305.1 (SMESG000044305.1)

HSP 1 Score: 2409.41 bits (6243), Expect = 0.000e+0
Identity = 1212/1217 (99.59%), Postives = 1215/1217 (99.84%), Query Frame = 2
Query:   20 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWVKIKRAACNKVSIKVQWTLIKRQPXXXXXXXXXXXXXXXXXPRKPNKFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISISNSPSSEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISSALALIQEDENMFTKHETAPTSVSTINMILQIDKTSIRFEWPFSPVIVNSPTNCSSSLQMKILDNCDEEISETSDAQQQRNEKPIFEMESFNFKQSNISSEKTKIYNSCINSRQTSPINVNLDGSPILQPNRRSYTSLMSINNTLHNGRNIPSSTINLLNYKSVKNLIGGKISRRGSQNSLNTLDGDKLSIDSDTSDWISEGLINGIDMGEDPLNDSINGISIETDGLIEXXXXXXXXMNWVTFDIPDFKWIIATGESSFVKFGIFGNINIMESLRNDSLTKSKFEINHNEDSNSAKILGKIDXXXXXXXXTWDIKIVKESNFSILMSTLVSIGEVFEDEIPPSAKYSDIILPPTFRIHLLSSLYFEMVEDRPCNNLSCPSEHPSTIVKLPPGMIIIIDGVTVISFDYIHASHDKIVNGPIFCQRCSQRISNLQNYSMTQNSLPSSPTVNSCEHIRSERPVTKNKDNCGTHLKMILQLQQQNKLYQDEIIRLRQELQSLLKNQNELRNLIESPSTHFI 3670
            MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSW+KIKRAACNKVSIKVQWTLIKRQPIVLVLDDVIISVEVLDVPRKPNKFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISISNSPSSEIGIICKLRDRLEIR DHYQLLLVYRIMDSISSAL L+QEDENMFTKHETAPTSVSTINMILQIDKTSIRFEWPFSPVIVNSPTNCSSSLQ+KILDNCDEEISETSDAQQQRNEKPIFEMESFNFKQSNISSEKTKIYNSCINSRQTSPINVNLDGSPILQPNRRSYTSLMSINNTLHNGRNIPSSTINLLNYKSVKNLIGGKISRRGSQNSLNTLDGDKLSIDSDTSDWISEGLINGIDMGEDPLNDSINGISIETDGLIESNSSSSSSMNWVTFDIPDFKWIIATGESSFVKFGIFGNINIMESLRNDSLTKSKFEINHNEDSNSAKILGKIDSSSQSSPSTWDIKIVKESNFSILMSTLVSIGEVFEDEIPPSAKYSDIILPPTFRIHLLSSLYFEMVEDRPCNNLSCPSEHPSTIVKLPPGMIIIIDGVTVISFDYIHASHDKIVNGPIFCQRCSQRISNLQNYSMTQNSLPSSPTVNSCEHIRSERPVTKNKDNCGTHLKMILQLQQQNKLYQDEIIRLRQELQSLLKNQNELRNLIESPSTHFI
Sbjct:    1 MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELLELPSWLKIKRAACNKVSIKVQWTLIKRQPIVLVLDDVIISVEVLDVPRKPNKFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLSVSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQATPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAILFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTNTLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSVKFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFIIDDKNQIMESVTLVRFNDISMHCVSTAQKTNNCLFVSSDIARHKLPAKTTTFFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLKNELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDRPQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDISGSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFLDSVHLTLWISISNSPSSEIGIICKLRDRLEIRFDHYQLLLVYRIMDSISSALTLMQEDENMFTKHETAPTSVSTINMILQIDKTSIRFEWPFSPVIVNSPTNCSSSLQLKILDNCDEEISETSDAQQQRNEKPIFEMESFNFKQSNISSEKTKIYNSCINSRQTSPINVNLDGSPILQPNRRSYTSLMSINNTLHNGRNIPSSTINLLNYKSVKNLIGGKISRRGSQNSLNTLDGDKLSIDSDTSDWISEGLINGIDMGEDPLNDSINGISIETDGLIESNSSSSSSMNWVTFDIPDFKWIIATGESSFVKFGIFGNINIMESLRNDSLTKSKFEINHNEDSNSAKILGKIDSSSQSSPSTWDIKIVKESNFSILMSTLVSIGEVFEDEIPPSAKYSDIILPPTFRIHLLSSLYFEMVEDRPCNNLSCPSEHPSTIVKLPPGMIIIIDGVTVISFDYIHASHDKIVNGPIFCQRCSQRISNLQNYSMTQNSLPSSPTVNSCEHIRSERPVTKNKDNCGTHLKMILQLQQQNKLYQDEIIRLRQELQSLLKNQNELRNLIESPSTHFI 1217          
The following BLAST results are available for this feature:
BLAST of UHRF1-binding protein 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UHRF1BP1L9.437e-9230.80UHRF1 binding protein 1 like [Source:HGNC Symbol;A... [more]
UHRF1BP13.320e-8428.65UHRF1 binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
UHRF1BP13.632e-8428.65UHRF1 binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
UHRF1BP1L9.352e-7632.63UHRF1 binding protein 1 like [Source:HGNC Symbol;A... [more]
UHRF1BP1L1.282e-1823.20UHRF1 binding protein 1 like [Source:HGNC Symbol;A... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C44H4.46.527e-6625.33pep chromosome:WBcel235:X:14568854:14589101:-1 gen... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG341266.311e-7339.61gene:FBgn0083962 transcript:FBtr0290010[more]
CG341267.057e-7338.39gene:FBgn0083962 transcript:FBtr0329977[more]
CG341267.506e-7338.39gene:FBgn0083962 transcript:FBtr0329975[more]
CG341267.865e-7339.61gene:FBgn0083962 transcript:FBtr0329974[more]
CG341269.622e-7339.61gene:FBgn0083962 transcript:FBtr0329976[more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uhrf1bp1l2.435e-9029.59UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-... [more]
uhrf1bp1l2.726e-9029.59UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-... [more]
uhrf1bp1l3.947e-8729.02UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-... [more]
uhrf1bp12.111e-7826.92UHRF1 binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
uhrf1bp14.585e-825.93UHRF1 binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uhrf1bp1l2.839e-8830.16UHRF1 binding protein 1-like [Source:NCBI gene;Acc... [more]
uhrf1bp1l4.718e-8830.16UHRF1 binding protein 1-like [Source:NCBI gene;Acc... [more]
uhrf1bp1l2.039e-8431.48UHRF1 binding protein 1-like [Source:NCBI gene;Acc... [more]
uhrf1bp1l1.635e-8229.53UHRF1 binding protein 1-like [Source:NCBI gene;Acc... [more]
uhrf1bp1l1.733e-8229.53UHRF1 binding protein 1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uhrf1bp1l3.138e-9430.50UHRF1 (ICBP90) binding protein 1-like [Source:MGI ... [more]
Uhrf1bp16.382e-8127.75UHRF1 (ICBP90) binding protein 1 [Source:MGI Symbo... [more]
Uhrf1bp1l5.804e-6128.26UHRF1 (ICBP90) binding protein 1-like [Source:MGI ... [more]
Uhrf1bp11.367e-3144.10UHRF1 (ICBP90) binding protein 1 [Source:MGI Symbo... [more]
Uhrf1bp15.266e-2044.44UHRF1 (ICBP90) binding protein 1 [Source:MGI Symbo... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|A2RSJ4|UH1BL_MOUSE2.195e-9330.50UHRF1-binding protein 1-like OS=Mus musculus OX=10... [more]
sp|A0JNW5|UH1BL_HUMAN4.532e-9130.80UHRF1-binding protein 1-like OS=Homo sapiens OX=96... [more]
sp|Q6NRZ1|UH1BL_XENLA1.445e-8830.65UHRF1-binding protein 1-like OS=Xenopus laevis OX=... [more]
sp|Q6BDS2|URFB1_HUMAN1.594e-8328.65UHRF1-binding protein 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V1691.156e-11230.35Chorein_N domain-containing protein OS=Capitella t... [more]
A0A1Y1M4221.834e-10230.17Chorein_N domain-containing protein OS=Photinus py... [more]
A0A5N4APK82.081e-10230.17Uncharacterized protein OS=Photinus pyralis OX=705... [more]
N6U5253.473e-9930.41Chorein_N domain-containing protein (Fragment) OS=... [more]
A0A1B6HUW74.895e-9930.41Chorein_N domain-containing protein (Fragment) OS=... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
uhrf1bp1l7.941e-8028.81UHRF1 binding protein 1 like [Source:NCBI gene;Acc... [more]
uhrf1bp1l1.273e-7828.69UHRF1 binding protein 1 like [Source:NCBI gene;Acc... [more]
uhrf1bp1l1.821e-7429.30UHRF1 binding protein 1 like [Source:NCBI gene;Acc... [more]
uhrf1bp19.103e-7231.87UHRF1 binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
uhrf1bp1l3.787e-8828.89UHRF1 binding protein 1-like [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO432376.311e-6535.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uhrf1bp1l1.724e-8528.96UHRF1 binding protein 1 like [Source:NCBI gene;Acc... [more]
uhrf1bp17.741e-8229.28UHRF1 binding protein 1 [Source:NCBI gene;Acc:1011... [more]
uhrf1bp1l5.168e-6736.39UHRF1 binding protein 1 like [Source:NCBI gene;Acc... [more]
uhrf1bp1l5.778e-6736.39UHRF1 binding protein 1 like [Source:NCBI gene;Acc... [more]
uhrf1bp1l5.915e-6736.39UHRF1 binding protein 1 like [Source:NCBI gene;Acc... [more]
back to top
BLAST of UHRF1-binding protein 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000044305.10.000e+099.59SMESG000044305.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025510 ID=SMED30025510|Name=UHRF1-binding protein 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3861bp
GATTTTTTGAGACTATTTTATGACATCATTTTTAAAAAATCAGATTCTTA
AGCATTTAACAAAATATACAAAAAATCTCTCACCCGAAAAAATAAAAATT
AATGCGTTCAAAGGGGAAGGCGATGTTTGCAATTTAGAATTGGATGAAAT
CAAATTAACTGAATTATTGGAATTACCAAGTTGGGTCAAAATAAAACGGG
CTGCTTGTAACAAAGTTTCAATTAAAGTTCAGTGGACTCTAATCAAGCGG
CAACCTATTGTTTTAGTTCTCGATGATGTGATTATCAGCGTCGAAGTTCT
CGATGTTCCTAGAAAACCAAACAAATTCAAAGATAATATTAACCCAAACC
CGAACGCCTACGGATTCATTGACAGAGTCATTGATGGAATGATCATTAAA
ATCAACTTGGTTCGCATCGTGTTCACTGCCAAAGCTTTCAAAGCATCTAT
GGAGCTAACTCGACTGTCCGTATCTAGCAAGATGCCAAACTGGTCTGATT
CCGACCATTTAAAGAAGACGAGAATCAAATCCATTACTCAAGGTTGTGTA
TTATTATTTAAGGAAATCGAATGGGATTCTACTAGAATTGAAGCAAATGG
TCTTCAAGATGGCCAAGCTACCCCAGTCAAATTAATTACAAATGCAACCA
AAGTACGCTTAACGATGAAAAAGAGCTTAACGGATCAGTCCATTATTGAA
TCGAAAACCGAATTCATTTTAATCGACTTATTCTGGGTGCTGACTATTTC
ACAAATCAAGGCAGCCATTCTCTTTACCGAATCATTAAAGGAGATTATCT
CACAGTCCAATGACATGAATAAAGAGGCAGCAAAAATCCGTTTGGAGGCT
ACTAGAAATTCTAATATCCGACCGGAACTTATCATTAATGATAATTCAAC
AAATTGGTCATTTACCAACACTTTGAATAATCGACAGAAACTTTTCCAGA
AATACAATTTAAAAGAAACTTCTTATCACGTCCTTGTTTCGAGAATCGAA
TTTCATTTCTGTGAAGAAGGCGATCAAAGTTCATCTCTAAGCAAAAATTC
TGTTTTTAATGGATCAGTAAAATTTCTACTCACAAATTGTCAGATAGATC
TCTACCCATATCATGTAGCAAGTATGACAAGAGATCATTTCCCAAATTAT
AAAGAGATCCATCGTATGCGGAATATCTGGGTTACTAATACTTATACTCG
AAAGTCATCCTTTATAATTGACGATAAAAATCAAATAATGGAAAGTGTCA
CTCTTGTCAGGTTCAATGATATTAGCATGCATTGTGTTTCGACAGCTCAG
AAAACAAACAATTGTTTATTTGTTAGTTCAGACATAGCTCGCCATAAATT
ACCAGCGAAAACCACAACTTTCTTTCTCGATATTACTGATCACTATTGGC
GTTCGGGAAGTTCGCAGAATTTACCGGAAACCACTTTATACTGTCAAATA
AATCCTCTTAATTTGAATCTTGATTGGCCGACGATAATATGGCTCAATGC
ATTTCAATTGAGTTTAAAAAATGAATTGAAATTAAGTCAGTGCGCAAATA
GCTTCCTCACCAGTCAAGAGCCCTCAAGTTGTCAAAAGCACCCAGCAATT
CACATTGAAGCCATTATGCCTCGGATAACACTCTCGCCTGACAAAATTGT
AACCGGCCAGTCGGATCGTCCACAACTGATTCAAATCCAAGTTGGAACTT
TGACAATAGACAATGTTTGTCAAACGAATTCCGACTGTGACGTTATTCAC
CAGGTCGTTCAAGAATATCACAGATCCAATTTTTTCAATGGACATACAGA
TTTCCTATTTGACATTTCAGGCTCCATGGGCAATGTGAAAACTAACACGA
ATAAATCTGGAAAATCAAACAGAGACAACGACAAGTCTTTATGGCAAATA
TGCTGCGAACCTATTTGGATTGATTATGAAGGTGCAAAATCTTACAATAA
TAAGCCCAAATCCTTTCTCGATTCTGTTCATTTAACCCTTTGGATTAGTA
TTTCTAACAGTCCAAGTTCCGAAATCGGTATTATTTGTAAACTAAGAGAT
CGTTTAGAAATCAGAGTTGACCATTATCAGTTGCTATTAGTGTATAGGAT
AATGGATAGTATCTCATCGGCGTTAGCCTTAATACAGGAGGATGAAAATA
TGTTTACTAAACATGAAACGGCACCAACAAGTGTTAGTACAATTAATATG
ATATTACAGATTGATAAGACATCTATTCGCTTTGAATGGCCGTTTTCACC
GGTTATTGTCAATTCTCCAACAAACTGCTCCTCTTCGCTTCAAATGAAAA
TTCTCGATAATTGTGACGAAGAAATCTCAGAAACAAGCGATGCACAGCAA
CAAAGAAATGAAAAACCAATTTTTGAAATGGAATCTTTTAACTTTAAGCA
ATCAAACATTTCATCGGAAAAAACAAAAATCTATAACAGTTGTATAAATT
CTAGACAAACTAGTCCTATTAATGTTAATCTTGACGGATCACCAATACTA
CAGCCTAATAGGAGGTCTTACACGTCTCTCATGTCAATAAATAATACTTT
GCACAACGGCAGGAACATTCCATCTTCTACCATCAATTTGCTCAACTATA
AAAGCGTTAAAAATCTCATTGGTGGAAAGATTAGCAGAAGAGGATCTCAA
AATTCGCTGAATACCTTGGATGGTGACAAATTGTCAATTGATAGTGACAC
AAGCGATTGGATTAGTGAAGGCTTAATAAATGGGATAGATATGGGGGAGG
ATCCTTTGAATGATTCTATTAATGGGATATCAATCGAGACTGATGGTTTG
ATCGAGTCAAATTCATCGAGTTCTTCATCTATGAATTGGGTTACTTTTGA
TATTCCAGATTTCAAATGGATAATAGCTACAGGTGAATCATCATTTGTCA
AATTTGGAATCTTTGGAAATATAAATATTATGGAAAGTCTTAGAAATGAT
TCCTTGACTAAGTCGAAATTTGAAATAAATCATAATGAAGATTCCAATTC
AGCTAAAATATTGGGAAAGATTGATTCTTCTTCTCAAAGTTCTCCGTCGA
CTTGGGATATTAAAATTGTTAAAGAATCGAATTTTTCTATTCTTATGTCT
ACTCTAGTAAGTATTGGCGAGGTATTTGAGGATGAGATACCACCTTCAGC
AAAATACTCAGATATTATTTTACCACCGACTTTTCGCATTCATCTTTTGT
CATCTCTATATTTTGAGATGGTAGAAGACCGACCTTGCAATAATTTGTCA
TGTCCCTCTGAACATCCATCAACTATCGTTAAATTGCCTCCAGGAATGAT
TATAATTATCGATGGAGTGACTGTGATTTCTTTTGATTATATCCATGCCA
GTCATGATAAAATTGTAAATGGGCCAATTTTCTGTCAAAGATGTAGTCAA
CGAATCAGTAACTTACAGAATTACAGTATGACACAGAATTCTTTACCTTC
AAGTCCGACTGTAAACTCCTGTGAACATATCAGATCTGAGAGGCCAGTCA
CAAAAAATAAAGATAATTGCGGGACGCATTTGAAAATGATTTTACAACTC
CAACAACAAAACAAATTATATCAAGATGAAATTATCAGATTACGCCAGGA
ATTACAGAGCTTATTAAAAAATCAAAACGAATTACGGAATTTAATAGAAA
GTCCTTCAACCCATTTCATTTAGAAGTTTTTATTGTATACATTTATCTCT
TCTAGTCAATTAATCCTGCTGAATGTTCCATTGACGCTGTCCAATTCCGA
TTTTTCTAGTCCTAGATTTCATTTGAAATCATCAAATATACAATCAAACA
TTCGAATTTATTATTGTTATTGTTGTTGTTTATTACGTTTTATTTATAGA
TTCGACCAAAT
back to top

protein sequence of SMED30025510-orf-1

>SMED30025510-orf-1 ID=SMED30025510-orf-1|Name=SMED30025510-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1218bp
MTSFLKNQILKHLTKYTKNLSPEKIKINAFKGEGDVCNLELDEIKLTELL
ELPSWVKIKRAACNKVSIKVQWTLIKRQPIVLVLDDVIISVEVLDVPRKP
NKFKDNINPNPNAYGFIDRVIDGMIIKINLVRIVFTAKAFKASMELTRLS
VSSKMPNWSDSDHLKKTRIKSITQGCVLLFKEIEWDSTRIEANGLQDGQA
TPVKLITNATKVRLTMKKSLTDQSIIESKTEFILIDLFWVLTISQIKAAI
LFTESLKEIISQSNDMNKEAAKIRLEATRNSNIRPELIINDNSTNWSFTN
TLNNRQKLFQKYNLKETSYHVLVSRIEFHFCEEGDQSSSLSKNSVFNGSV
KFLLTNCQIDLYPYHVASMTRDHFPNYKEIHRMRNIWVTNTYTRKSSFII
DDKNQIMESVTLVRFNDISMHCVSTAQKTNNCLFVSSDIARHKLPAKTTT
FFLDITDHYWRSGSSQNLPETTLYCQINPLNLNLDWPTIIWLNAFQLSLK
NELKLSQCANSFLTSQEPSSCQKHPAIHIEAIMPRITLSPDKIVTGQSDR
PQLIQIQVGTLTIDNVCQTNSDCDVIHQVVQEYHRSNFFNGHTDFLFDIS
GSMGNVKTNTNKSGKSNRDNDKSLWQICCEPIWIDYEGAKSYNNKPKSFL
DSVHLTLWISISNSPSSEIGIICKLRDRLEIRVDHYQLLLVYRIMDSISS
ALALIQEDENMFTKHETAPTSVSTINMILQIDKTSIRFEWPFSPVIVNSP
TNCSSSLQMKILDNCDEEISETSDAQQQRNEKPIFEMESFNFKQSNISSE
KTKIYNSCINSRQTSPINVNLDGSPILQPNRRSYTSLMSINNTLHNGRNI
PSSTINLLNYKSVKNLIGGKISRRGSQNSLNTLDGDKLSIDSDTSDWISE
GLINGIDMGEDPLNDSINGISIETDGLIESNSSSSSSMNWVTFDIPDFKW
IIATGESSFVKFGIFGNINIMESLRNDSLTKSKFEINHNEDSNSAKILGK
IDSSSQSSPSTWDIKIVKESNFSILMSTLVSIGEVFEDEIPPSAKYSDII
LPPTFRIHLLSSLYFEMVEDRPCNNLSCPSEHPSTIVKLPPGMIIIIDGV
TVISFDYIHASHDKIVNGPIFCQRCSQRISNLQNYSMTQNSLPSSPTVNS
CEHIRSERPVTKNKDNCGTHLKMILQLQQQNKLYQDEIIRLRQELQSLLK
NQNELRNLIESPSTHFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005768endosome
GO:0005769early endosome
GO:0005829cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026728UHRF1BP1-like
IPR026854VPS13_N
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042802identical protein binding
GO:0042826histone deacetylase binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1174..1208
NoneNo IPR availablePANTHERPTHR22774:SF15UHRF1-BINDING PROTEIN 1coord: 394..661
NoneNo IPR availablePANTHERPTHR22774:SF15UHRF1-BINDING PROTEIN 1coord: 1..388
IPR026854Vacuolar protein sorting-associated protein 13, N-terminal domainPFAMPF12624Chorein_Ncoord: 3..93
e-value: 1.7E-13
score: 50.7
IPR026728UHRF1-binding protein 1-likePANTHERPTHR22774UNCHARACTERIZEDcoord: 394..661
IPR026728UHRF1-binding protein 1-likePANTHERPTHR22774UNCHARACTERIZEDcoord: 1..388