Integrator complex subunit 2

Overview
NameIntegrator complex subunit 2
Smed IDSMED30025506
Length (bp)1632
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integrator complex subunit 2 (SMED30025506) t-SNE clustered cells

Violin plots show distribution of expression levels for Integrator complex subunit 2 (SMED30025506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integrator complex subunit 2 (SMED30025506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integrator complex subunit 2 (SMED30025506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025506SMESG000061179.1 SmedASXL_015478SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025506SMESG000061179.1 SmedASXL_015478SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30025506SMESG000061179.1 dd_Smed_v4_7197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025506SMESG000061179.1 dd_Smed_v4_7197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 135.576 bits (340), Expect = 7.439e-33
Identity = 94/380 (24.74%), Postives = 178/380 (46.84%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSEL--ELLRKSLFLNQEATIIQMLLEKCLPNENEMGDC--------------KKSA---------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  DQ++ RC P+++I L ++   +L+S+ Y     +++    T        +           E+  E L+ +L   Q++  +Q+LLE CLP E E  +                 SA               L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  783 ASELIPYAEVLTSNMSQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFVRQQKYTQNDLMIDP--LIVLRCDQRVHRCPPLMDITLHMLNGYLLASKAY-----LSAHLKETEQDRPSQNNTIGLVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYAFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1137          
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 135.576 bits (340), Expect = 7.439e-33
Identity = 94/380 (24.74%), Postives = 178/380 (46.84%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSEL--ELLRKSLFLNQEATIIQMLLEKCLPNENEMGDC--------------KKSA---------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  DQ++ RC P+++I L ++   +L+S+ Y     +++    T        +           E+  E L+ +L   Q++  +Q+LLE CLP E E  +                 SA               L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  783 ASELIPYAEVLTSNMSQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFVRQQKYTQNDLMIDP--LIVLRCDQRVHRCPPLMDITLHMLNGYLLASKAY-----LSAHLKETEQDRPSQNNTIGLVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYAFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1137          
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 135.576 bits (340), Expect = 8.118e-33
Identity = 94/380 (24.74%), Postives = 178/380 (46.84%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSEL--ELLRKSLFLNQEATIIQMLLEKCLPNENEMGDC--------------KKSA---------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  DQ++ RC P+++I L ++   +L+S+ Y     +++    T        +           E+  E L+ +L   Q++  +Q+LLE CLP E E  +                 SA               L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  775 ASELIPYAEVLTSNMSQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFVRQQKYTQNDLMIDP--LIVLRCDQRVHRCPPLMDITLHMLNGYLLASKAY-----LSAHLKETEQDRPSQNNTIGLVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYAFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1129          
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Match: INTS2 (integrator complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:29241])

HSP 1 Score: 135.576 bits (340), Expect = 8.118e-33
Identity = 94/380 (24.74%), Postives = 178/380 (46.84%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSEL--ELLRKSLFLNQEATIIQMLLEKCLPNENEMGDC--------------KKSA---------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  DQ++ RC P+++I L ++   +L+S+ Y     +++    T        +           E+  E L+ +L   Q++  +Q+LLE CLP E E  +                 SA               L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  775 ASELIPYAEVLTSNMSQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFVRQQKYTQNDLMIDP--LIVLRCDQRVHRCPPLMDITLHMLNGYLLASKAY-----LSAHLKETEQDRPSQNNTIGLVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYAFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1129          
BLAST of Integrator complex subunit 2 vs. Ensembl Celegans
Match: ZC376.6 (pep chromosome:WBcel235:V:14185691:14192156:1 gene:WBGene00013877.1 transcript:ZC376.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC376.6)

HSP 1 Score: 51.9878 bits (123), Expect = 9.751e-7
Identity = 62/285 (21.75%), Postives = 117/285 (41.05%), Query Frame = 1
Query:  652 LLVNVDQKIFRCAPILEILLRIVE--STILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKS-----ALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPM--LIWVS-NEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEK 1476
            LL   D++I    P     +R +   S ++        M+I  +   + I+ K   +++C    +K  E ELL  S    Q + +I  L+E C  +   M D            +I++I C +IH  F+    L  +V  Q +P   +   V+GIP++      + +M L   +  +  F +   + I   Y ++ S + A  + +    +VHSL    E P    +W     A++ +   FP+L  ++   +  V+    + + +    L        DP+ E+
Sbjct:  865 LLFRCDRRILSSPPHFNCFVRALNFFSKMVRIENRLKTMEIQHKAMASAIAHKN--TLYCLELDRK--EKELLTGSYLDTQHSVLIHALIEVC--DSKRMKDDPSDFSLLEKRRQIRRIACEYIHRTFLDYEGLIRVVLHQRFPLRQVRDLVEGIPALFAGNGLILEM-LTLPEQQRRFFAVVFAAEICRKYRVRESLETARVVCD----IVHSLHKHGELPSSYKLWKHVAPALMLLAVEFPSLADSINRLLTRVATAAKNRLAVRCGMLAG------DPRHEE 1132          
BLAST of Integrator complex subunit 2 vs. Ensembl Celegans
Match: ZC376.6 (pep chromosome:WBcel235:V:14185691:14192156:1 gene:WBGene00013877.1 transcript:ZC376.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC376.6)

HSP 1 Score: 51.6026 bits (122), Expect = 1.329e-6
Identity = 62/285 (21.75%), Postives = 114/285 (40.00%), Query Frame = 1
Query:  652 LLVNVDQKIFRCAPILEILLRIVE--STILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKS-----ALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPM--LIWVS-NEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEK 1476
            LL   D++I    P     +R +   S ++        M+I  +   + I+ K   S   +     R E ELL  S    Q + +I  L+E C  +   M D            +I++I C +IH  F+    L  +V  Q +P   +   V+GIP++      + +M L   +  +  F +   + I   Y ++ S + A  + +    +VHSL    E P    +W     A++ +   FP+L  ++   +  V+    + + +    L        DP+ E+
Sbjct:  865 LLFRCDRRILSSPPHFNCFVRALNFFSKMVRIENRLKTMEIQHKAMASAIAHKNTLSFSSYCLELDRKEKELLTGSYLDTQHSVLIHALIEVC--DSKRMKDDPSDFSLLEKRRQIRRIACEYIHRTFLDYEGLIRVVLHQRFPLRQVRDLVEGIPALFAGNGLILEM-LTLPEQQRRFFAVVFAAEICRKYRVRESLETARVVCD----IVHSLHKHGELPSSYKLWKHVAPALMLLAVEFPSLADSINRLLTRVATAAKNRLAVRCGMLAG------DPRHEE 1136          
BLAST of Integrator complex subunit 2 vs. Ensembl Fly
Match: IntS2 (gene:FBgn0030858 transcript:FBtr0074480)

HSP 1 Score: 117.857 bits (294), Expect = 2.538e-27
Identity = 97/356 (27.25%), Postives = 178/356 (50.00%), Query Frame = 1
Query:  349 QKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAP-ILEILLRIVESTILSSRTYW-YNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGD-CKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
            ++L +   E+   Y  ++V H+  +   S      V   +   Y  IW++L  ++P  +  +++     +N S+T          +  F  E ++E P+E+L  +  + +F C+P +L ILLRI++ ++ +S+TY   +MQ+  +         + ++++           E LR +L  +QE+  + +LLE      ++  D      L EIQ II  ++H  FISEP L  +VH QTYP+S++P+ V  +PS+HI +++V + FLN  +  K +F +DL SH+ L Y+I  S  ++   L   Q+ + S+     +   +     A+VR  +TFP L       ++T   + +S
Sbjct:  733 KQLLQMPPETQAQYGQQLVKHLPMVFAKS------VPRYVKDLYNDIWLRLNAVLPTTLWIMSLRAI--TNGSDT--------MDRRTFANESLLE-PMEVL--SCPRFVF-CSPYLLMILLRILKGSLAASKTYLNVHMQMQQKQVLDKNGMMQTDAIW-----------EDLRTTLIASQESAAVHILLEVLDYIASKATDRVSHLELREIQGIIGTYVHQAFISEPSLAKLVHFQTYPKSVIPMMVASVPSMHICIDFVHE-FLNVTEMEKQIFTIDLTSHLVLNYSIPKSLGVSKFCLNVIQTTL-SMLTASTKCRFLRNVMPAMVRFVETFPILADDCVNILMTTGRILHS 1055          
BLAST of Integrator complex subunit 2 vs. Ensembl Zebrafish
Match: ints2 (integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-050522-148])

HSP 1 Score: 136.732 bits (343), Expect = 2.307e-33
Identity = 102/408 (25.00%), Postives = 189/408 (46.32%), Query Frame = 1
Query:  304 ILTNGCDCSNLVNYSQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRK----SLFLNQEATIIQMLLEKCL----------------------------PNENEMGDCKK-----------SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAV 1398
            +L+ G     ++ +   L+  D   LIPYA  +  ++   L+L D+    V  R+L     +W+ L  +MPR++  +T+N  Q          S++K  ++  +TQ  ++ +P  ++++  D ++FRC P+++I L ++   +L+S+ Y     +N+    T    ++ ++V     S +    E+ R+    +L   Q++  +Q+LLE CL                            P   ++GD              S L E+Q +IC  +H MFI++P++  +VH Q YPQ LLP+TV GIPS+HI L+++ ++ L      K +F + L+SH+   Y +  S  +A   +    +++  L    +R      +   +V   K FP L       ++ V  V
Sbjct:  753 VLSGGPRLLRILEHLTLLSAGD---LIPYAEALTANMG--LLLEDT----VSRRILQTVNKLWMVLNTVMPRRLWVMTVNALQ----------SSVKLLRQQRYTQNDLMVDP--LIVLRCDPRVFRCPPLMDITLHMLNGYLLASKAY-----LNAHLKETAEFERQAQTVSNLGLSGQPDTPEVTREELKNALLAAQDSAAVQILLEVCLASPQEELQLSGGGAGDSLLRCIQSAPGFPMRRQVGDTGAQGGRKAEGGLLSDLREVQCLICCLLHQMFIADPNIAKLVHFQGYPQPLLPLTVAGIPSMHICLDFIPEL-LAQPQLEKQIFAIQLLSHLCTQYALPKSLSVARLAISVMGTLLTVLTR-AKRFAFFMPTLSCLVSFCKAFPPLFDDAMSLLVQVGQV 1132          
BLAST of Integrator complex subunit 2 vs. Ensembl Zebrafish
Match: ints2 (integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-050522-148])

HSP 1 Score: 136.732 bits (343), Expect = 2.502e-33
Identity = 102/408 (25.00%), Postives = 189/408 (46.32%), Query Frame = 1
Query:  304 ILTNGCDCSNLVNYSQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRK----SLFLNQEATIIQMLLEKCL----------------------------PNENEMGDCKK-----------SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAV 1398
            +L+ G     ++ +   L+  D   LIPYA  +  ++   L+L D+    V  R+L     +W+ L  +MPR++  +T+N  Q          S++K  ++  +TQ  ++ +P  ++++  D ++FRC P+++I L ++   +L+S+ Y     +N+    T    ++ ++V     S +    E+ R+    +L   Q++  +Q+LLE CL                            P   ++GD              S L E+Q +IC  +H MFI++P++  +VH Q YPQ LLP+TV GIPS+HI L+++ ++ L      K +F + L+SH+   Y +  S  +A   +    +++  L    +R      +   +V   K FP L       ++ V  V
Sbjct:  731 VLSGGPRLLRILEHLTLLSAGD---LIPYAEALTANMG--LLLEDT----VSRRILQTVNKLWMVLNTVMPRRLWVMTVNALQ----------SSVKLLRQQRYTQNDLMVDP--LIVLRCDPRVFRCPPLMDITLHMLNGYLLASKAY-----LNAHLKETAEFERQAQTVSNLGLSGQPDTPEVTREELKNALLAAQDSAAVQILLEVCLASPQEELQLSGGGAGDSLLRCIQSAPGFPMRRQVGDTGAQGGRKAEGGLLSDLREVQCLICCLLHQMFIADPNIAKLVHFQGYPQPLLPLTVAGIPSMHICLDFIPEL-LAQPQLEKQIFAIQLLSHLCTQYALPKSLSVARLAISVMGTLLTVLTR-AKRFAFFMPTLSCLVSFCKAFPPLFDDAMSLLVQVGQV 1110          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 138.272 bits (347), Expect = 9.197e-34
Identity = 95/359 (26.46%), Postives = 171/359 (47.63%), Query Frame = 1
Query:  367 DSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNE---NEMGDCKK---------SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
             +  LIPYA  I  ++ QLL      +V V  R+L     +W+ L  +MPR++  +T+N  Q            LK  +   +TQ  ++ +P  ++++  D +I RC PI++I L ++   +L+S+ Y  N  +          S    +             E L+ +L   Q++  +Q+LLE CL  E   ++   C +           L E+Q +IC  +H MFI++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R +    +   +V   + FP L   +   ++ +  VC S
Sbjct:  745 SASDLIPYAEVITANMIQLL------NVGVPRRILQTVNKLWMTLNTVMPRRLWVMTVNALQ----------PPLKLARHHKYTQNDLMIDP--LIVLRCDPRIQRCPPIMDITLHMLNGYLLASKAY-LNSYLKETADQDMKPSPNNTAALAGQVEAMEVTREELKNALLAAQDSAAVQILLEICLSAEEGKDQNPACSQLLEGEESLLCNLREVQCLICCLLHQMFIADPNIAKLVHFQGYPCQLLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSMARLAINVMGTLLTVLTQ-AKRFLFFMPTLPCLVSFCQAFPPLYEDIMSLLIQIGQVCAS 1082          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 138.272 bits (347), Expect = 1.002e-33
Identity = 95/359 (26.46%), Postives = 171/359 (47.63%), Query Frame = 1
Query:  367 DSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNE---NEMGDCKK---------SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
             +  LIPYA  I  ++ QLL      +V V  R+L     +W+ L  +MPR++  +T+N  Q            LK  +   +TQ  ++ +P  ++++  D +I RC PI++I L ++   +L+S+ Y  N  +          S    +             E L+ +L   Q++  +Q+LLE CL  E   ++   C +           L E+Q +IC  +H MFI++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R +    +   +V   + FP L   +   ++ +  VC S
Sbjct:  790 SASDLIPYAEVITANMIQLL------NVGVPRRILQTVNKLWMTLNTVMPRRLWVMTVNALQ----------PPLKLARHHKYTQNDLMIDP--LIVLRCDPRIQRCPPIMDITLHMLNGYLLASKAY-LNSYLKETADQDMKPSPNNTAALAGQVEAMEVTREELKNALLAAQDSAAVQILLEICLSAEEGKDQNPACSQLLEGEESLLCNLREVQCLICCLLHQMFIADPNIAKLVHFQGYPCQLLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSMARLAINVMGTLLTVLTQ-AKRFLFFMPTLPCLVSFCQAFPPLYEDIMSLLIQIGQVCAS 1127          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 138.272 bits (347), Expect = 1.048e-33
Identity = 95/359 (26.46%), Postives = 171/359 (47.63%), Query Frame = 1
Query:  367 DSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNE---NEMGDCKK---------SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
             +  LIPYA  I  ++ QLL      +V V  R+L     +W+ L  +MPR++  +T+N  Q            LK  +   +TQ  ++ +P  ++++  D +I RC PI++I L ++   +L+S+ Y  N  +          S    +             E L+ +L   Q++  +Q+LLE CL  E   ++   C +           L E+Q +IC  +H MFI++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R +    +   +V   + FP L   +   ++ +  VC S
Sbjct:  770 SASDLIPYAEVITANMIQLL------NVGVPRRILQTVNKLWMTLNTVMPRRLWVMTVNALQ----------PPLKLARHHKYTQNDLMIDP--LIVLRCDPRIQRCPPIMDITLHMLNGYLLASKAY-LNSYLKETADQDMKPSPNNTAALAGQVEAMEVTREELKNALLAAQDSAAVQILLEICLSAEEGKDQNPACSQLLEGEESLLCNLREVQCLICCLLHQMFIADPNIAKLVHFQGYPCQLLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSMARLAINVMGTLLTVLTQ-AKRFLFFMPTLPCLVSFCQAFPPLYEDIMSLLIQIGQVCAS 1107          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 137.887 bits (346), Expect = 1.203e-33
Identity = 95/359 (26.46%), Postives = 171/359 (47.63%), Query Frame = 1
Query:  367 DSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNE---NEMGDCKK---------SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
             +  LIPYA  I  ++ QLL      +V V  R+L     +W+ L  +MPR++  +T+N  Q            LK  +   +TQ  ++ +P  ++++  D +I RC PI++I L ++   +L+S+ Y  N  +          S    +             E L+ +L   Q++  +Q+LLE CL  E   ++   C +           L E+Q +IC  +H MFI++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R +    +   +V   + FP L   +   ++ +  VC S
Sbjct:  772 SASDLIPYAEVITANMIQLL------NVGVPRRILQTVNKLWMTLNTVMPRRLWVMTVNALQ----------PPLKLARHHKYTQNDLMIDP--LIVLRCDPRIQRCPPIMDITLHMLNGYLLASKAY-LNSYLKETADQDMKPSPNNTAALAGQVEAMEVTREELKNALLAAQDSAAVQILLEICLSAEEGKDQNPACSQLLEGEESLLCNLREVQCLICCLLHQMFIADPNIAKLVHFQGYPCQLLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSMARLAINVMGTLLTVLTQ-AKRFLFFMPTLPCLVSFCQAFPPLYEDIMSLLIQIGQVCAS 1109          
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:595088])

HSP 1 Score: 137.887 bits (346), Expect = 1.315e-33
Identity = 95/359 (26.46%), Postives = 171/359 (47.63%), Query Frame = 1
Query:  367 DSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNE---NEMGDCKK---------SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
             +  LIPYA  I  ++ QLL      +V V  R+L     +W+ L  +MPR++  +T+N  Q            LK  +   +TQ  ++ +P  ++++  D +I RC PI++I L ++   +L+S+ Y  N  +          S    +             E L+ +L   Q++  +Q+LLE CL  E   ++   C +           L E+Q +IC  +H MFI++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R +    +   +V   + FP L   +   ++ +  VC S
Sbjct:  787 SASDLIPYAEVITANMIQLL------NVGVPRRILQTVNKLWMTLNTVMPRRLWVMTVNALQ----------PPLKLARHHKYTQNDLMIDP--LIVLRCDPRIQRCPPIMDITLHMLNGYLLASKAY-LNSYLKETADQDMKPSPNNTAALAGQVEAMEVTREELKNALLAAQDSAAVQILLEICLSAEEGKDQNPACSQLLEGEESLLCNLREVQCLICCLLHQMFIADPNIAKLVHFQGYPCQLLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSMARLAINVMGTLLTVLTQ-AKRFLFFMPTLPCLVSFCQAFPPLYEDIMSLLIQIGQVCAS 1124          
BLAST of Integrator complex subunit 2 vs. Ensembl Mouse
Match: Ints2 (integrator complex subunit 2 [Source:MGI Symbol;Acc:MGI:1917672])

HSP 1 Score: 134.806 bits (338), Expect = 1.166e-32
Identity = 91/378 (24.07%), Postives = 177/378 (46.83%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKSA-----------------------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  D+++ RC P++++ L ++   +L+S+ Y  +  +         S      +    D+ + +  EL + +L   Q++  +Q+LLE CLP E E      S                              L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  776 ASELIPYAEVLTSNMNQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFIRQQKYTQNDLMIDP--LIVLRCDRRVHRCPPLMDVTLHMLNGYLLASKAY-LSAHLKETAEQDRPSPNNTVGLVGQTDAPEVTREEL-KNALLAAQDSAAVQILLEICLPTEEEKAKGANSDISLRNTQGVTTISTPSKETEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYSFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1131          
BLAST of Integrator complex subunit 2 vs. Ensembl Mouse
Match: Ints2 (integrator complex subunit 2 [Source:MGI Symbol;Acc:MGI:1917672])

HSP 1 Score: 134.806 bits (338), Expect = 1.166e-32
Identity = 91/378 (24.07%), Postives = 177/378 (46.83%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKSA-----------------------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  D+++ RC P++++ L ++   +L+S+ Y  +  +         S      +    D+ + +  EL + +L   Q++  +Q+LLE CLP E E      S                              L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  776 ASELIPYAEVLTSNMNQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFIRQQKYTQNDLMIDP--LIVLRCDRRVHRCPPLMDVTLHMLNGYLLASKAY-LSAHLKETAEQDRPSPNNTVGLVGQTDAPEVTREEL-KNALLAAQDSAAVQILLEICLPTEEEKAKGANSDISLRNTQGVTTISTPSKETEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYSFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1131          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q9H0H0|INT2_HUMAN (Integrator complex subunit 2 OS=Homo sapiens OX=9606 GN=INTS2 PE=1 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 3.572e-32
Identity = 94/380 (24.74%), Postives = 178/380 (46.84%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSEL--ELLRKSLFLNQEATIIQMLLEKCLPNENEMGDC--------------KKSA---------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  DQ++ RC P+++I L ++   +L+S+ Y     +++    T        +           E+  E L+ +L   Q++  +Q+LLE CLP E E  +                 SA               L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  783 ASELIPYAEVLTSNMSQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFVRQQKYTQNDLMIDP--LIVLRCDQRVHRCPPLMDITLHMLNGYLLASKAY-----LSAHLKETEQDRPSQNNTIGLVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYAFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1137          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q80UK8|INT2_MOUSE (Integrator complex subunit 2 OS=Mus musculus OX=10090 GN=Ints2 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 8.154e-32
Identity = 91/378 (24.07%), Postives = 177/378 (46.83%), Query Frame = 1
Query:  370 SESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKSA-----------------------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            +  LIPYA  +  ++ QLL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  D+++ RC P++++ L ++   +L+S+ Y  +  +         S      +    D+ + +  EL + +L   Q++  +Q+LLE CLP E E      S                              L E+Q +IC  +H M+I++P++  +VH Q YP  LLP+TV GIPS+HI L+++ ++     +  K +F + L+SH+ + Y +  S  +A   +    +++  L    +R      +  ++V   + FP L   +   ++ +  VC S + 
Sbjct:  776 ASELIPYAEVLTSNMNQLL------NSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------IKFIRQQKYTQNDLMIDP--LIVLRCDRRVHRCPPLMDVTLHMLNGYLLASKAY-LSAHLKETAEQDRPSPNNTVGLVGQTDAPEVTREEL-KNALLAAQDSAAVQILLEICLPTEEEKAKGANSDISLRNTQGVTTISTPSKETEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQ-AKRYSFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVA 1131          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q5ZKU4|INT2_CHICK (Integrator complex subunit 2 OS=Gallus gallus OX=9031 GN=INTS2 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 3.143e-28
Identity = 90/373 (24.13%), Postives = 170/373 (45.58%), Query Frame = 1
Query:  379 LIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCK---------------KSA------------LTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            LIPYA  +  ++  LL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S          +K  ++  +TQ  ++ +P  ++++  DQ++ R  P+++I L ++   +L+S+ Y     +N+    T     +                E L+ +L   Q++  +Q+LLE CLP E E                    KS+            L E+Q +IC  +H M+I++P++  +VH Q YP  LL +TV GIPS+HI L+++ ++     +  K +F + L+S + + Y +  S  +A   +    +++  L    +R      +   +V   + FP L   +   ++ +  VC S + 
Sbjct:  778 LIPYAEVLTSNMNCLL------NAGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPS----------VKIVRQQKYTQNDLMIDP--LIVLRCDQRVHRSPPLMDITLHMLNGYLLASKAY-----LNAHLKETAEQDIRPSQNNAMGPETPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKAQSSSTYSLLKSVQSTTSPKSSDVEEEEDSLLCNLREVQCLICCLLHQMYIADPNIVKLVHFQGYPCELLALTVAGIPSMHICLDFIPELIAQP-ELEKQIFAIQLLSFLCIQYALPKSLSVARLAINVMGTLLTVLTQ-SKRYAFFMPTLPCLVSFCQAFPPLYEDIMSLLIQIGQVCASDVA 1125          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q9VX31|INT2_DROME (Integrator complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=IntS2 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 2.544e-26
Identity = 97/356 (27.25%), Postives = 178/356 (50.00%), Query Frame = 1
Query:  349 QKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAP-ILEILLRIVESTILSSRTYW-YNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGD-CKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
            ++L +   E+   Y  ++V H+  +   S      V   +   Y  IW++L  ++P  +  +++     +N S+T          +  F  E ++E P+E+L  +  + +F C+P +L ILLRI++ ++ +S+TY   +MQ+  +         + ++++           E LR +L  +QE+  + +LLE      ++  D      L EIQ II  ++H  FISEP L  +VH QTYP+S++P+ V  +PS+HI +++V + FLN  +  K +F +DL SH+ L Y+I  S  ++   L   Q+ + S+     +   +     A+VR  +TFP L       ++T   + +S
Sbjct:  733 KQLLQMPPETQAQYGQQLVKHLPMVFAKS------VPRYVKDLYNDIWLRLNAVLPTTLWIMSLRAI--TNGSDT--------MDRRTFANESLLE-PMEVL--SCPRFVF-CSPYLLMILLRILKGSLAASKTYLNVHMQMQQKQVLDKNGMMQTDAIW-----------EDLRTTLIASQESAAVHILLEVLDYIASKATDRVSHLELREIQGIIGTYVHQAFISEPSLAKLVHFQTYPKSVIPMMVASVPSMHICIDFVHE-FLNVTEMEKQIFTIDLTSHLVLNYSIPKSLGVSKFCLNVIQTTL-SMLTASTKCRFLRNVMPAMVRFVETFPILADDCVNILMTTGRILHS 1055          
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q55CB6|INT2_DICDI (Integrator complex subunit 2 homolog OS=Dictyostelium discoideum OX=44689 GN=ints2 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 4.207e-15
Identity = 77/269 (28.62%), Postives = 127/269 (47.21%), Query Frame = 1
Query:  610 NFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYN------MQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPN-----------ENEMGDCKKS----ALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHS-LANIEERPMLIWVSNEAIVRIGKTFP 1350
            N+T   II +P  +++      +F C P+ +ILL+I+   ++SS+    N         +    + T++ ++ E V                 +L L QE+TIIQ+LLE CL +            N+    K+S     + EI+  IC+FIH MFI +P +  +VH Q Y   LLPITV  IPS+HI   ++ ++ L      K +F + L+S++   + I  S  I  +        ++S   + ++R   +     +I RI KTFP
Sbjct:  971 NYTYTDIISDP--LVIFRSHPTVFTCPPLFKILLQILFFYMVSSKKNLQNQLHTSSGSGSGTTSNVTLNKQQQEDV----------------STLILTQESTIIQILLEICLIDGIDTKGLNKILRNKNKKFKESYDPVDIEEIRCQICSFIHQMFIDKPLIIKLVHFQGYLSQLLPITVTLIPSMHICFEFIPEL-LAQPSLEKQIFAIQLLSYLSEKFPIPKSLKICRQSQTRISFNLNSNTLSYDDRIKFLHSILPSITRITKTFP 1220          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: G7YQ16 (Ribose 5-phosphate isomerase A OS=Clonorchis sinensis OX=79923 GN=CLF_106564 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.097e-57
Identity = 142/461 (30.80%), Postives = 233/461 (50.54%), Query Frame = 1
Query:  346 SQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIV-HYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKIN-FTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVF---------------CFHDSKKRS-----------------------ELELLRKSLFLNQEATIIQMLLEKCLPNENEMG-DCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEKNFEY------LEIEEQYYLCYNKLIEAYETLTRQGLVQSTLYH 1587
            SQ + +   + L+P+   +     +LL+ ++   +   + R +   + +W +L ++MPRK+E LT+N       S+    S+L+  + +   T   I  +PVE L+  VD+ +FRC P+L + LRI+ES +L+SR+YW +  +         +S  F SV                   DS   S                       E E+L  ++ L Q AT++Q+LLE CLP + E     K S L E+Q IIC ++HSMFI+EP L  ++  QT+P SLLPI+ Q IPS+HI L+ V  ++  SGDY KMVF LDLVSH+ L YNI+++ + AA M++    ++ S+   ++RP L+     A +R+G  FP+L   +   +LTV  +  S +   D+   +    + D K  +   +      L + ++  LC   ++  ++ L  +   Q  LY+
Sbjct:  704 SQAVEQLSVDCLLPFGPVLGHQCPRLLLAANKHPLFTTNRRFVCRLEYLWCRLHLVMPRKLELLTVNALIDGVNSKKPSCSSLRCIRSVKKLTGADIRIDPVENLMNTVDRGVFRCPPVLRMFLRILESNLLASRSYWGHRLLERVVNPPASTSVPFGSVTNTVTLPSVQSGNTSESALDSSLPSLPTTTSVVNATASARTIAPVSDEECEVLCSNMLLTQNATVVQLLLEHCLPTKEESTLRSKISVLREVQNIICTYVHSMFIAEPALAEVIVWQTFPNSLLPISTQAIPSLHICLDSVIHVYRLSGDYAKMVFCLDLVSHLSLHYNIQSAFERAAFMIDSLFHLLSSVVCADDRPDLLQACLPAFLRLGGAFPSLAPVIVRLLLTVGTLISSVLP--DEARDSLRLRKSDEKRPEPATWTAATYDLPLLDRSMLCLEHVMWTFDKLIHRCSAQRYLYY 1162          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A4S2L4D3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009864 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.326e-56
Identity = 128/397 (32.24%), Postives = 209/397 (52.64%), Query Frame = 1
Query:  346 SQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIV-HYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKIN-FTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESV-------------------------------FCFHDSKKRS-------ELELLRKSLFLNQEATIIQMLLEKCLPNENEMG-DCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFI 1413
            SQ + +   + L+P+   +     +LL+ ++   +   + R +   + +W +L ++MPRK+E LT+N       S+    S+L+  + +   T   I  +PVE L+  VD+ +FRC P+L + LRI+ES +L+SR+YW +  +         +   F SV                               F    +  R+       E E+L  ++ L Q AT++Q+LLE CLP + E     + S L E+Q I+C ++HSMFI+EP L  ++  QT+P SLLPI+ Q IPS+HI L+ V  ++  SGDY KMVF LDLVSH+ L YNI+++ + AA M++    ++ S+   ++RP L+     A +R+G  FP+L   +   +LTV  +  S +
Sbjct:  908 SQAVEQLSVDCLLPFGPVLGHQCPRLLLAANKHPLFTTNRRFVCRLEYLWCRLHLVMPRKLELLTVNALLDGVNSKKPSCSSLRCIRSVKKLTGADIRIDPVESLMNTVDRGVFRCPPVLRMFLRILESNLLASRSYWGHRLLERVVNLPASTGAPFGSVTNTVTLPSVQSGNNSESALDSSLPNLPTTTSFVNAAASARTIAPVSDEECEVLCSNMLLTQNATVVQLLLEHCLPRKEESTLRSQISVLREVQNIVCTYVHSMFIAEPALAEVIVWQTFPHSLLPISTQAIPSLHICLDSVLHVYRLSGDYAKMVFCLDLVSHLSLHYNIQSAFERAAFMIDSLFHLLSSVVCADDRPDLLQACLPAFLRLGGAFPSLAPVIVRLLLTVGTLISSVL 1304          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A4S2L4X5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009864 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.442e-56
Identity = 128/397 (32.24%), Postives = 209/397 (52.64%), Query Frame = 1
Query:  346 SQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIV-HYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKIN-FTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESV-------------------------------FCFHDSKKRS-------ELELLRKSLFLNQEATIIQMLLEKCLPNENEMG-DCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFI 1413
            SQ + +   + L+P+   +     +LL+ ++   +   + R +   + +W +L ++MPRK+E LT+N       S+    S+L+  + +   T   I  +PVE L+  VD+ +FRC P+L + LRI+ES +L+SR+YW +  +         +   F SV                               F    +  R+       E E+L  ++ L Q AT++Q+LLE CLP + E     + S L E+Q I+C ++HSMFI+EP L  ++  QT+P SLLPI+ Q IPS+HI L+ V  ++  SGDY KMVF LDLVSH+ L YNI+++ + AA M++    ++ S+   ++RP L+     A +R+G  FP+L   +   +LTV  +  S +
Sbjct:  908 SQAVEQLSVDCLLPFGPVLGHQCPRLLLAANKHPLFTTNRRFVCRLEYLWCRLHLVMPRKLELLTVNALLDGVNSKKPSCSSLRCIRSVKKLTGADIRIDPVESLMNTVDRGVFRCPPVLRMFLRILESNLLASRSYWGHRLLERVVNLPASTGAPFGSVTNTVTLPSVQSGNNSESALDSSLPNLPTTTSFVNAAASARTIAPVSDEECEVLCSNMLLTQNATVVQLLLEHCLPRKEESTLRSQISVLREVQNIVCTYVHSMFIAEPALAEVIVWQTFPHSLLPISTQAIPSLHICLDSVLHVYRLSGDYAKMVFCLDLVSHLSLHYNIQSAFERAAFMIDSLFHLLSSVVCADDRPDLLQACLPAFLRLGGAFPSLAPVIVRLLLTVGTLISSVL 1304          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A074Z1B3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10692 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 6.931e-52
Identity = 140/498 (28.11%), Postives = 232/498 (46.59%), Query Frame = 1
Query:  346 SQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIV-HYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKIN-FTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESV-------------------------------FCFHDSKKRS-------ELELLRKSLFLNQEATIIQMLLEKCLPNENEMG--------------------------------------DCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEKNFEY------LEIEEQYYLCYNKLIEAYETLTRQGLVQSTLYH 1587
            SQ + +   + L+P+   +     +LL+ ++   +   + R +   + +W +L ++MPRK+E LT+N       S+    S+L+  + +   T   I  +PVE LL  VD+ +FRC P+L + LRI+ES +L+SR+YW +  +         +S  F SV                                    +  R+       E E+L  ++ L Q AT++Q+LLE CLP + E                                          + S L E+Q IIC ++HSMFI+EP L  ++  QT+P SLLPI+ Q IPS+HI L+ V  ++  SGDY KMVF LDLVSH+ L YNI+++ + AA M++    ++ S+   ++RP L+     A +R+G  FP+L   +   +LTV  +  S +   D+   +      D K  +   +      L + ++  LC   ++  ++ L  +   Q  LY+
Sbjct:  743 SQAVEQLSVDCLLPFGPVLGHQCPRLLLAANKHPLFTTNRRFVCRLEYLWCRLHLVMPRKLELLTVNALVDGVNSKKPSCSSLRCIRSVKKLTGADIRIDPVENLLNTVDRGVFRCPPVLRMFLRILESNLLASRSYWGHRLLERVVNPPASTSAPFGSVTNAVTLPSVQSGNTSESALDSSLPNLPTTTSVVSATASARTIAPVSDEECEVLCSNMLLTQNATVVQLLLEHCLPTKEESTLRSQISVLREVQNIICTYVHSMFIAEPALAEVIVWQTLRSQISVLREVQNIICTYVHSMFIAEPALAEVIVWQTFPHSLLPISTQAIPSLHICLDSVIHVYRLSGDYAKMVFCLDLVSHLSLHYNIQSAFERAAFMIDSLFHLLSSVVCADDRPDLLQACLPAFLRLGGAFPSLAPVIVRLLLTVGTLISSVLP--DEARDSLRLRTSDEKRPEPATWTAATYNLPLLDRSMLCLEHVMWTFDKLIHRCSAQRYLYY 1238          
BLAST of Integrator complex subunit 2 vs. TrEMBL
Match: A0A3R7CC49 (Integrator complex subunit 2 OS=Clonorchis sinensis OX=79923 GN=INTS2 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.730e-45
Identity = 113/347 (32.56%), Postives = 175/347 (50.43%), Query Frame = 1
Query:  682 RCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVF---------------CFHDSKKRS-----------------------ELELLRKSLFLNQEATIIQMLLEKCLPNENEMG-DCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEKNFEY------LEIEEQYYLCYNKLIEAYETLTRQGLVQSTLYH 1587
            RC P+L + LRI+ES +L+SR+YW +  +         +S  F SV                   DS   S                       E E+L  ++ L Q AT++Q+LLE CLP + E     K S L E+Q IIC ++HSMFI+EP L  ++  QT+P SLLPI+ Q IPS+HI L+ V  ++  SGDY KMVF LDLVSH+ L YNI+++ + AA M++    ++ S+   ++RP L+     A +R+G  FP+L   +   +LTV  +  S +   D+   +    + D K  +   +      L + ++  LC   ++  ++ L  +   Q  LY+
Sbjct:   24 RCPPVLRMFLRILESNLLASRSYWGHRLLERVVNPPASTSVPFGSVTNTVTLPSVQSGNTSESALDSSLPSLPTTTSVVNATASARTIAPVSDEECEVLCSNMLLTQNATVVQLLLEHCLPTKEESTLRSKISVLREVQNIICTYVHSMFIAEPALAEVIVWQTFPNSLLPISTQAIPSLHICLDSVIHVYRLSGDYAKMVFCLDLVSHLSLHYNIQSAFERAAFMIDSLFHLLSSVVCADDRPDLLQACLPAFLRLGGAFPSLAPVIVRLLLTVGTLISSVLP--DEARDSLRLRKSDEKRPEPATWTAATYDLPLLDRSMLCLEHVMWTFDKLIHRCSAQRYLYY 368          
BLAST of Integrator complex subunit 2 vs. Ensembl Nematostella
Match: EDO44556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVD7])

HSP 1 Score: 134.42 bits (337), Expect = 4.248e-33
Identity = 97/349 (27.79%), Postives = 165/349 (47.28%), Query Frame = 1
Query:  463 RLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCK------------------------------KSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSL-ANIEE---RPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYS 1407
            RLL     IW +L  I+PRK+   T+N                       +T E +  +P+ +L    D+++FRC P+ +I++R++ + + +SRT      + S++ HT  + +         +S    E E LR +L   QE+  +Q+LLE CLPNE +    +                                 L EI+  +C+ +H MFI++P L  +VH Q+YP  LLP+TV GIPS+HI L+++ ++ +N     K +F + L S++ L Y +  S ++A  +L    S++ +L A+  E   RP L      ++VR  + FP L      +++ +  V  S
Sbjct:  779 RLLTLCCDIWTRLSTIIPRKLWLATVNVLCHEGPQP--------------YTDEDLARDPLTVL--RCDRRVFRCPPMFDIVVRVLLAYLAASRT------MLSQHLHTQQAPRT--------NSAVEQEREELRVALVAAQESAAVQLLLEICLPNEQDKQSSRMNRLFEQDKQVSWTGLSRHSKEQEESCSMHSCVLREIKCRVCSSLHQMFIADPSLAKLVHFQSYPLELLPVTVAGIPSMHICLDFIPEL-VNQTQLDKQLFGIQLASYLVLQYPLPKSLNVAKYILSRMSSLLVALPASSREAFFRPAL-----PSLVRFCRAFPPLHVDATPFLIQLGKVAAS 1091          
BLAST of Integrator complex subunit 2 vs. Ensembl Medaka
Match: ints2 (integrator complex subunit 2 [Source:NCBI gene;Acc:101173965])

HSP 1 Score: 140.198 bits (352), Expect = 1.298e-34
Identity = 98/385 (25.45%), Postives = 177/385 (45.97%), Query Frame = 1
Query:  379 LIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENE----------------------------------MGDCKK-----SALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIG 1416
            LIPYA  +   +  LL      +  V  R+L     +W+ L  +MPR++  +T+N  Q S           K  ++  +TQ  ++ +P  ++++  D ++FRC P+++I+L ++   +L S+ +       +  +     +     V    D+ + +  E L+ +L   Q++  +Q+LLE CLP   E                                  +GD +      S L E+Q +IC  +H MFI++P++  +VH Q YPQ+LLP+TV GIPSIHI L+++ ++ L      K +F + L+S++   Y +  S  +A   +    +++  L    +R      +   +V   + FP L   VA  ++ V  VC S + 
Sbjct:  777 LIPYAEALTASMALLL------EPAVPRRILQTLNKLWMGLNTVMPRRLWVMTVNALQPSA----------KLLRQQRYTQNDLMVDP--LIVLRCDHRVFRCPPVMDIVLHMLNGYLLGSKAHLQGHLKETADFDRQSQTISNLGVPGQPDTPEVTR-EELKNALLAAQDSAAVQILLEVCLPTSEEQQLGVSSKSLLRTNRGPTQGKQKLESQQLICRGVLGDAEPEGGLLSDLREVQCLICCLLHQMFIADPNIAKLVHFQGYPQALLPLTVAGIPSIHICLDFIPEL-LAQPQLEKQIFAIQLLSYLCTQYALPKSLSVARLAISVMGTLLTVLTR-AKRFCFFMPTLPCLVAFCQAFPPLYDDVAALLVQVGQVCASDVA 1140          
BLAST of Integrator complex subunit 2 vs. Planmine SMEST
Match: SMESG000061179.1 (SMESG000061179.1)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 436/436 (100.00%), Postives = 436/436 (100.00%), Query Frame = 1
Query:  289 EFQKYILTNGCDCSNLVNYSQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEKNFEYLEIEEQYYLCYNKLIEAYETLTRQGLVQSTLYHSKM 1596
            EFQKYILTNGCDCSNLVNYSQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEKNFEYLEIEEQYYLCYNKLIEAYETLTRQGLVQSTLYHSKM
Sbjct:  714 EFQKYILTNGCDCSNLVNYSQKLAETDSESLIPYAHKIVDHIYQLLVLSDSQDVIVHYRLLHAYKTIWIKLRMIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEILLVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSKKFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDCKKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSIHISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYFQSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCYSFIGINDDCLPAFGNSQIDPKMEKNFEYLEIEEQYYLCYNKLIEAYETLTRQGLVQSTLYHSKM 1149          
The following BLAST results are available for this feature:
BLAST of Integrator complex subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
INTS27.439e-3324.74integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
INTS27.439e-3324.74integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
INTS28.118e-3324.74integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
INTS28.118e-3324.74integrator complex subunit 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZC376.69.751e-721.75pep chromosome:WBcel235:V:14185691:14192156:1 gene... [more]
ZC376.61.329e-621.75pep chromosome:WBcel235:V:14185691:14192156:1 gene... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IntS22.538e-2727.25gene:FBgn0030858 transcript:FBtr0074480[more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ints22.307e-3325.00integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-... [more]
ints22.502e-3325.00integrator complex subunit 2 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ints29.197e-3426.46integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints21.002e-3326.46integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints21.048e-3326.46integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints21.203e-3326.46integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
ints21.315e-3326.46integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ints21.166e-3224.07integrator complex subunit 2 [Source:MGI Symbol;Ac... [more]
Ints21.166e-3224.07integrator complex subunit 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Integrator complex subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H0H0|INT2_HUMAN3.572e-3224.74Integrator complex subunit 2 OS=Homo sapiens OX=96... [more]
sp|Q80UK8|INT2_MOUSE8.154e-3224.07Integrator complex subunit 2 OS=Mus musculus OX=10... [more]
sp|Q5ZKU4|INT2_CHICK3.143e-2824.13Integrator complex subunit 2 OS=Gallus gallus OX=9... [more]
sp|Q9VX31|INT2_DROME2.544e-2627.25Integrator complex subunit 2 OS=Drosophila melanog... [more]
sp|Q55CB6|INT2_DICDI4.207e-1528.62Integrator complex subunit 2 homolog OS=Dictyostel... [more]
back to top
BLAST of Integrator complex subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YQ168.097e-5730.80Ribose 5-phosphate isomerase A OS=Clonorchis sinen... [more]
A0A4S2L4D31.326e-5632.24Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2L4X51.442e-5632.24Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074Z1B36.931e-5228.11Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7CC492.730e-4532.56Integrator complex subunit 2 OS=Clonorchis sinensi... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445564.248e-3327.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ints21.298e-3425.45integrator complex subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Integrator complex subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061179.10.000e+0100.00SMESG000061179.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025506 ID=SMED30025506|Name=Integrator complex subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1632bp
TTTTTTTGTCATATTTTACTCAATATTAAAAATGTTAATAAAGGCATTGT
ATATCTTACCAACAATGCATTTTATAATATGCCTTTAGATTTAATTCATA
GAAAATAATTTTTTTTATTTTTTAATCGTTGGAAATTGATGGGTAAAAAC
GACACCAATTCCTCAATAAGCTACGTAATTTGTTCCTATACATCAACTTT
GGATCTCCAGATTCCACATGTATAAATACTCTTTATTGCCAGCTTAAATT
GTAATATTCAAATAAACAATTGATATTGAAACTTTTTAGAATTTCAAAAA
TACATTTTAACAAATGGATGCGATTGTTCAAATTTAGTAAATTATTCTCA
GAAATTAGCCGAAACAGATTCAGAATCTTTAATTCCCTATGCACATAAAA
TTGTCGATCATATTTACCAGCTCCTTGTTCTCTCTGATTCGCAAGATGTC
ATAGTTCACTATAGACTTCTTCATGCGTATAAGACAATATGGATTAAGTT
ACGGATGATTATGCCAAGGAAGATCGAAAGATTAACGATTAACAAATTCC
AACAGTCGAATATTTCGGAAACTGACTTTTTATCAGCTCTTAAAGCTACT
CAAAAAATCAATTTCACCCAAGAGCAAATTATAGAGAATCCAGTCGAAAT
TCTATTGGTGAATGTCGATCAAAAAATTTTCAGATGTGCTCCAATATTAG
AGATTTTATTGAGAATTGTTGAATCGACAATACTTTCATCTCGCACTTAT
TGGTATAATATGCAGATAAATAGCGAATATTATCATACTACAATTTCTTC
CAAAAAGTTTGAATCTGTATTCTGTTTTCATGATAGCAAGAAAAGATCAG
AACTTGAACTATTAAGAAAATCATTGTTTCTTAACCAAGAAGCGACTATA
ATTCAAATGCTCCTAGAAAAATGCTTACCCAATGAAAATGAGATGGGAGA
CTGTAAGAAATCAGCATTGACTGAAATTCAGAAAATTATCTGTAATTTCA
TTCATTCGATGTTTATTAGTGAACCCGACTTGTGTCACATTGTTCATTTG
CAGACTTATCCACAAAGTCTTCTTCCAATAACGGTGCAAGGAATTCCGTC
AATCCATATTTCTTTGAATTACGTCGAACAAATGTTTCTAAATAGCGGAG
ACTACTATAAAATGGTTTTCCTGCTAGATTTAGTTTCGCATATTGGATTA
TTTTATAATATTAAAAATTCACAAGATATCGCAGCAAAAATGTTGGAATA
TTTTCAATCTGTAGTGCACTCCCTAGCCAATATTGAAGAGCGGCCAATGT
TGATTTGGGTGTCGAATGAGGCAATTGTGCGTATCGGGAAAACGTTTCCT
AATCTATTGACGACAGTTGCAGTGTACATGTTAACGGTGTCCGCTGTGTG
TTATTCCTTCATTGGCATCAATGATGATTGCTTGCCAGCATTCGGAAACA
GTCAAATCGATCCAAAAATGGAAAAGAATTTCGAGTACTTGGAAATCGAA
GAGCAATATTATCTATGTTACAATAAATTAATTGAAGCATATGAAACGTT
AACTCGACAGGGATTGGTTCAATCAACTTTGTATCATTCGAAAATGTAAT
TGTAAATAAATATTGTAAATATTGAAAAAAAA
back to top

protein sequence of SMED30025506-orf-1

>SMED30025506-orf-1 ID=SMED30025506-orf-1|Name=SMED30025506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MIMPRKIERLTINKFQQSNISETDFLSALKATQKINFTQEQIIENPVEIL
LVNVDQKIFRCAPILEILLRIVESTILSSRTYWYNMQINSEYYHTTISSK
KFESVFCFHDSKKRSELELLRKSLFLNQEATIIQMLLEKCLPNENEMGDC
KKSALTEIQKIICNFIHSMFISEPDLCHIVHLQTYPQSLLPITVQGIPSI
HISLNYVEQMFLNSGDYYKMVFLLDLVSHIGLFYNIKNSQDIAAKMLEYF
QSVVHSLANIEERPMLIWVSNEAIVRIGKTFPNLLTTVAVYMLTVSAVCY
SFIGINDDCLPAFGNSQIDPKMEKNFEYLEIEEQYYLCYNKLIEAYETLT
RQGLVQSTLYHSKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029321INTS2
IPR012340NA-bd_OB-fold
Vocabulary: cellular component
TermDefinition
GO:0032039integrator complex
Vocabulary: biological process
TermDefinition
GO:0016180snRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029321Integrator complex subunit 2PFAMPF14750INTS2coord: 2..301
e-value: 2.4E-60
score: 204.3
IPR029321Integrator complex subunit 2PANTHERPTHR28608FAMILY NOT NAMEDcoord: 2..301