Casein kinase I

Overview
NameCasein kinase I
Smed IDSMED30025502
Length (bp)962
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Casein kinase I (SMED30025502) t-SNE clustered cells

Violin plots show distribution of expression levels for Casein kinase I (SMED30025502) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Casein kinase I (SMED30025502) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Casein kinase I (SMED30025502) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025502

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynx musculatureSMED30025502h1SMcG0009853 dd_Smed_v4_12103_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Casein kinase I vs. Ensembl Human
Match: CSNK1A1 (casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2451])

HSP 1 Score: 318.931 bits (816), Expect = 6.242e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Human
Match: CSNK1E (casein kinase 1 epsilon [Source:HGNC Symbol;Acc:HGNC:2453])

HSP 1 Score: 318.931 bits (816), Expect = 7.378e-108
Identity = 155/294 (52.72%), Postives = 210/294 (71.43%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKSTN 934
            Y+L RKIGSGSFG+++L     +G++VA+K E   T  P L  ES   K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++  K  +ST+
Sbjct:    9 YRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML--KFARSTS 300          
BLAST of Casein kinase I vs. Ensembl Human
Match: CSNK1A1 (casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2451])

HSP 1 Score: 318.546 bits (815), Expect = 1.116e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Human
Match: CSNK1E (casein kinase 1 epsilon [Source:HGNC Symbol;Acc:HGNC:2453])

HSP 1 Score: 317.39 bits (812), Expect = 1.634e-107
Identity = 152/285 (53.33%), Postives = 205/285 (71.93%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L     +G++VA+K E   T  P L  ES   K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Human
Match: CSNK1D (casein kinase 1 delta [Source:HGNC Symbol;Acc:HGNC:2452])

HSP 1 Score: 320.472 bits (820), Expect = 2.147e-107
Identity = 151/285 (52.98%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +   G++VA+K E   T  P L  ES + K +QG  G P  +W G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Celegans
Match: kin-19 (Casein kinase I isoform alpha [Source:UniProtKB/Swiss-Prot;Acc:P42168])

HSP 1 Score: 315.079 bits (806), Expect = 1.362e-106
Identity = 151/294 (51.36%), Postives = 208/294 (70.75%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKSTN 934
            YKLIRKIGSGSFG+++++    NG++VA+K ES     P L +ES V + LQG  G P  +WYG    +NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ ++RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF RG+LPWQ LK ATK +KY  I EKKM    E LC+G P EF ++L   + L F+E P Y    ++F+ LF  LN + D  FDWT++  K ++S +
Sbjct:   16 YKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQGGVGIPHIRWYGTEREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLSYTRGLRFDESPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAQQSQS 309          
BLAST of Casein kinase I vs. Ensembl Celegans
Match: kin-19 (Casein kinase I isoform alpha [Source:UniProtKB/Swiss-Prot;Acc:P42168])

HSP 1 Score: 315.079 bits (806), Expect = 1.362e-106
Identity = 151/294 (51.36%), Postives = 208/294 (70.75%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKSTN 934
            YKLIRKIGSGSFG+++++    NG++VA+K ES     P L +ES V + LQG  G P  +WYG    +NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ ++RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF RG+LPWQ LK ATK +KY  I EKKM    E LC+G P EF ++L   + L F+E P Y    ++F+ LF  LN + D  FDWT++  K ++S +
Sbjct:   16 YKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQGGVGIPHIRWYGTEREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLSYTRGLRFDESPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAQQSQS 309          
BLAST of Casein kinase I vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 283.878 bits (725), Expect = 5.023e-95
Identity = 138/283 (48.76%), Postives = 196/283 (69.26%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWT 901
            ++L RKIGSGSFG+++L +     ++VAVK E   +  P L  ES + + + G  G P  +W G  G++NV++MELLGPS+E L+++C RKF++KTVL++A Q++  ++ +H R  IHRDIKPDN L GLGK  +++++IDFGL+K++ +++ + HI ++  K+L GTARY SINTH   E SRRDD+ES+ YV +YF RG+LPWQ LKA TK +KY LI EKK+    ++LC G PE F  +L   +SLGFEE+P Y     +F+ LF R  F  D VFDW 
Sbjct:    9 FRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLGGIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGKRGNLVYIIDFGLAKRYRDSK-HQHIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDWN 290          
BLAST of Casein kinase I vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 283.878 bits (725), Expect = 5.023e-95
Identity = 138/283 (48.76%), Postives = 196/283 (69.26%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWT 901
            ++L RKIGSGSFG+++L +     ++VAVK E   +  P L  ES + + + G  G P  +W G  G++NV++MELLGPS+E L+++C RKF++KTVL++A Q++  ++ +H R  IHRDIKPDN L GLGK  +++++IDFGL+K++ +++ + HI ++  K+L GTARY SINTH   E SRRDD+ES+ YV +YF RG+LPWQ LKA TK +KY LI EKK+    ++LC G PE F  +L   +SLGFEE+P Y     +F+ LF R  F  D VFDW 
Sbjct:    9 FRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLGGIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGKRGNLVYIIDFGLAKRYRDSK-HQHIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDWN 290          
BLAST of Casein kinase I vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 283.493 bits (724), Expect = 6.452e-95
Identity = 138/283 (48.76%), Postives = 196/283 (69.26%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWT 901
            ++L RKIGSGSFG+++L +     ++VAVK E   +  P L  ES + + + G  G P  +W G  G++NV++MELLGPS+E L+++C RKF++KTVL++A Q++  ++ +H R  IHRDIKPDN L GLGK  +++++IDFGL+K++ +++ + HI ++  K+L GTARY SINTH   E SRRDD+ES+ YV +YF RG+LPWQ LKA TK +KY LI EKK+    ++LC G PE F  +L   +SLGFEE+P Y     +F+ LF R  F  D VFDW 
Sbjct:    9 FRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLGGIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGKRGNLVYIIDFGLAKRYRDSK-HQHIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDWN 290          
BLAST of Casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0073680)

HSP 1 Score: 296.59 bits (758), Expect = 2.409e-99
Identity = 144/288 (50.00%), Postives = 201/288 (69.79%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            Y++IRKIGSGSFG+++L     +G++VA+K ES +   P L +E+ + + L G  GFP  + +G   NFN L+M+LLGPS+E L+++C+R FTIKTVLM+  Q+I  L+ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KKF +  T  HI ++  K+L GTARY SIN HL  E SRRDD+ES+ YV++YF RG LPWQ +KA TK +KY  I EKKM  P E LC+G P EF ++L   +SL FEE+P Y    ++F+ LF  LN + D ++DWT++  K
Sbjct:   20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQK 307          
BLAST of Casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0073682)

HSP 1 Score: 296.59 bits (758), Expect = 2.409e-99
Identity = 144/288 (50.00%), Postives = 201/288 (69.79%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            Y++IRKIGSGSFG+++L     +G++VA+K ES +   P L +E+ + + L G  GFP  + +G   NFN L+M+LLGPS+E L+++C+R FTIKTVLM+  Q+I  L+ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KKF +  T  HI ++  K+L GTARY SIN HL  E SRRDD+ES+ YV++YF RG LPWQ +KA TK +KY  I EKKM  P E LC+G P EF ++L   +SL FEE+P Y    ++F+ LF  LN + D ++DWT++  K
Sbjct:   20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQK 307          
BLAST of Casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0345163)

HSP 1 Score: 296.59 bits (758), Expect = 2.409e-99
Identity = 144/288 (50.00%), Postives = 201/288 (69.79%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            Y++IRKIGSGSFG+++L     +G++VA+K ES +   P L +E+ + + L G  GFP  + +G   NFN L+M+LLGPS+E L+++C+R FTIKTVLM+  Q+I  L+ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KKF +  T  HI ++  K+L GTARY SIN HL  E SRRDD+ES+ YV++YF RG LPWQ +KA TK +KY  I EKKM  P E LC+G P EF ++L   +SL FEE+P Y    ++F+ LF  LN + D ++DWT++  K
Sbjct:   20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQK 307          
BLAST of Casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0300380)

HSP 1 Score: 296.59 bits (758), Expect = 2.409e-99
Identity = 144/288 (50.00%), Postives = 201/288 (69.79%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            Y++IRKIGSGSFG+++L     +G++VA+K ES +   P L +E+ + + L G  GFP  + +G   NFN L+M+LLGPS+E L+++C+R FTIKTVLM+  Q+I  L+ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KKF +  T  HI ++  K+L GTARY SIN HL  E SRRDD+ES+ YV++YF RG LPWQ +KA TK +KY  I EKKM  P E LC+G P EF ++L   +SL FEE+P Y    ++F+ LF  LN + D ++DWT++  K
Sbjct:   20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQK 307          
BLAST of Casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0345162)

HSP 1 Score: 296.59 bits (758), Expect = 2.409e-99
Identity = 144/288 (50.00%), Postives = 201/288 (69.79%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            Y++IRKIGSGSFG+++L     +G++VA+K ES +   P L +E+ + + L G  GFP  + +G   NFN L+M+LLGPS+E L+++C+R FTIKTVLM+  Q+I  L+ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KKF +  T  HI ++  K+L GTARY SIN HL  E SRRDD+ES+ YV++YF RG LPWQ +KA TK +KY  I EKKM  P E LC+G P EF ++L   +SL FEE+P Y    ++F+ LF  LN + D ++DWT++  K
Sbjct:   20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQK 307          
BLAST of Casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 318.931 bits (816), Expect = 3.928e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 318.546 bits (815), Expect = 7.749e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Zebrafish
Match: csnk1da (casein kinase 1, delta a [Source:NCBI gene;Acc:322106])

HSP 1 Score: 320.857 bits (821), Expect = 7.827e-108
Identity = 152/285 (53.33%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +   G++VA+K E   T  P L  ES + K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDITTGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 318.546 bits (815), Expect = 8.005e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Zebrafish
Match: csnk1da (casein kinase 1, delta a [Source:NCBI gene;Acc:322106])

HSP 1 Score: 320.857 bits (821), Expect = 8.873e-108
Identity = 152/285 (53.33%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +   G++VA+K E   T  P L  ES + K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDITTGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 318.931 bits (816), Expect = 5.658e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 318.161 bits (814), Expect = 1.043e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   10 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 302          
BLAST of Casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 318.161 bits (814), Expect = 1.481e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   15 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 307          
BLAST of Casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 318.161 bits (814), Expect = 1.583e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 317.775 bits (813), Expect = 1.763e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   15 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 307          
BLAST of Casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 318.931 bits (816), Expect = 4.285e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 318.546 bits (815), Expect = 6.651e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 318.546 bits (815), Expect = 7.665e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 318.546 bits (815), Expect = 8.449e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Mouse
Match: Csnk1d (casein kinase 1, delta [Source:MGI Symbol;Acc:MGI:1355272])

HSP 1 Score: 320.472 bits (820), Expect = 1.490e-107
Identity = 151/285 (52.98%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +   G++VA+K E   T  P L  ES + K +QG  G P  +W G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. UniProt/SwissProt
Match: sp|P67829|KC1A_SHEEP (Casein kinase I isoform alpha OS=Ovis aries OX=9940 GN=CSNK1A1 PE=3 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 2.998e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. UniProt/SwissProt
Match: sp|P67828|KC1A_RABIT (Casein kinase I isoform alpha OS=Oryctolagus cuniculus OX=9986 GN=CSNK1A1 PE=1 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 2.998e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. UniProt/SwissProt
Match: sp|P67827|KC1A_BOVIN (Casein kinase I isoform alpha OS=Bos taurus OX=9913 GN=CSNK1A1 PE=1 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 2.998e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. UniProt/SwissProt
Match: sp|P97633|KC1A_RAT (Casein kinase I isoform alpha OS=Rattus norvegicus OX=10116 GN=Csnk1a1 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 5.170e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQGKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. UniProt/SwissProt
Match: sp|Q8BK63|KC1A_MOUSE (Casein kinase I isoform alpha OS=Mus musculus OX=10090 GN=Csnk1a1 PE=1 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 5.362e-107
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. TrEMBL
Match: A0A0N5ANE2 (Protein kinase domain-containing protein OS=Syphacia muris OX=451379 PE=3 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 3.484e-110
Identity = 164/294 (55.78%), Postives = 212/294 (72.11%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKSTN 934
            YKLIRKIGSGSFGE+FLA    NG++VAVK ES     P L +ES V K LQG  G P  +WYG    +NVL+M+LLGPS+E L++YCSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN + G+G++ + + LIDFGL+KK+ ++RT AHIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF RGSLPWQ LK ATK +KY  I EKKM  P E LC+G+P EF +FL   +SL F+E P Y    ++F+ LF  LN + D  FDWT++  K+K S N
Sbjct:   17 YKLIRKIGSGSFGEIFLAINITNGEEVAVKMESSKARHPQLLYESKVYKILQGGVGIPRIRWYGGENGYNVLVMDLLGPSLEDLFNYCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFMMGIGRHCNKLFLIDFGLAKKYRDSRTRAHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGSLPWQGLKAATKKQKYEKISEKKMSTPAEVLCKGLPAEFAMFLNYCRSLRFDEAPDYMYLRQLFRILFRTLNHQYDYTFDWTML--KLKASPN 308          
BLAST of Casein kinase I vs. TrEMBL
Match: D7FMN1 (Casein kinase (Serine/threonine/tyrosine protein kinase) OS=Ectocarpus siliculosus OX=2880 GN=CK PE=3 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 8.955e-109
Identity = 152/288 (52.78%), Postives = 214/288 (74.31%), Query Frame = 2
Query:   50 QNYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLIN 910
            + Y+L RKIGSGSFG+++L      G++VA+K ES  T  P L +ES + + L G  G P  +WYG  G++NV++++LLGPS+E L++YCSR+F +KTVLM+A QL+  L+ +H ++ IHRD+KPDN L GLGK +++IH+IDFGL+KK+ + RT+ HIP++  K+L GTARY SINTH+  E SRRDDLES+ YVL+YF+RGSLPWQ LKA TK +KY  I ++KM    E+LC+G P EF  + +  +SL FE++P Y+   R+FK+LF R  F+ DN+FDWT++N
Sbjct:  111 KKYRLGRKIGSGSFGDIYLGTNMTTGEEVAIKLESTKTKHPQLLYESKIYRILHGGLGIPTVRWYGVEGDYNVMVLDLLGPSLEDLFNYCSRRFNLKTVLMLADQLLSRLEYVHTKSFIHRDVKPDNFLIGLGKRQNIIHIIDFGLAKKYRDPRTHQHIPYRDNKNLTGTARYASINTHIGIEQSRRDDLESLGYVLMYFIRGSLPWQGLKANTKKQKYERIMDRKMSTSTEQLCKGYPSEFRSYFEYCRSLRFEDRPDYAYLKRLFKELFYRKGFQYDNMFDWTVLN 398          
BLAST of Casein kinase I vs. TrEMBL
Match: E1ZQ40 (Protein kinase domain-containing protein OS=Chlorella variabilis OX=554065 GN=CHLNCDRAFT_32696 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.172e-108
Identity = 149/293 (50.85%), Postives = 216/293 (73.72%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            Y+L RKIGSGSFG++++      G++V +K ES  T  P L +ES + K LQG  G P  +WYG  G++NV++++LLGPS+E L+++C+RKF++KTVLM+A Q++  ++ +H ++ IHRDIKPDN L GLG+  + +++IDFGL+KK+ + +++ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YFLRGSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF +F + ++SL F++KP Y+   ++F+DLF+R  F  D VFDWT++    ++++
Sbjct:    9 YRLGRKIGSGSFGDIYIGTHLLTGEEVGIKLESTKTKHPQLLYESKIYKILQGGTGIPNIRWYGVEGDYNVMVIDLLGPSLEDLFNFCNRKFSLKTVLMLADQMLSRIEYLHSKSFIHRDIKPDNYLMGLGRRANQVYMIDFGLAKKYRDPKSHIHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAATKKQKYEKISEKKMATPTESLCKGFPTEFVVFFQYVRSLRFDDKPDYAYLRKLFRDLFVREGFTWDYVFDWTILKYAQQQNS 301          
BLAST of Casein kinase I vs. TrEMBL
Match: V3ZXK1 (Protein kinase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_205749 PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.667e-108
Identity = 154/285 (54.04%), Postives = 209/285 (73.33%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +  NG++VA+K E   T  P L  ES + + +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A QLI  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDD+ES+ YV +YFLRGSLPWQ LK ATK +KY  I EKKM  P EELC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDISNGEEVAIKLECVKTKHPQLHIESKIYRMMQGGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQLISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDMESLGYVFMYFLRGSLPWQGLKAATKRQKYERISEKKMSTPIEELCKGFPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFTYDYVFDWNML 293          
BLAST of Casein kinase I vs. TrEMBL
Match: A0A158N8F5 (Protein kinase domain-containing protein OS=Onchocerca volvulus OX=6282 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.708e-108
Identity = 157/302 (51.99%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   14 VSVYNFKMIEEIQ---NYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            ++ +NF ++ E++    ++L RKIGSGSFG+++L +     ++VA+K E   T  P L  E+ + K + G  G P  KW GY G +NV++MELLGPS+E L+++CSRKFT+KTVL++A Q++  ++ +H R  IHRDIKPDN L GLGK  +++++IDFGL+KK+  +RT+AHIP++  K+L GTARY S+NTHL  E SRRDD+ES+ YVL+YF RG+LPWQ LK ATK +KY  I EKKM  P EELC G PE F  +LK  K LGFEE+P YS   ++F++LF R  F  D VFDW L+
Sbjct:   34 INSFNFAVLMELRVGGRFRLGRKIGSGSFGDIYLGQNILTQEEVAIKLECVKTKHPQLHIEARLYKLMSGGIGIPQVKWCGYEGEYNVMVMELLGPSLEDLFNFCSRKFTLKTVLLLADQMLSRIEYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRCSRTHAHIPYRENKNLTGTARYASVNTHLGIEQSRRDDIESLGYVLMYFNRGTLPWQGLKAATKRQKYDKISEKKMSTPVEELCAGYPEAFAAYLKYCKCLGFEEQPDYSHLRQLFRNLFHRQGFTYDYVFDWNLL 335          
BLAST of Casein kinase I vs. Ensembl Cavefish
Match: csnk1db (casein kinase I [Source:NCBI gene;Acc:103030301])

HSP 1 Score: 318.161 bits (814), Expect = 4.399e-108
Identity = 152/285 (53.33%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +   G++VA+K E   T  P L  ES + K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Cavefish
Match: csnk1e (casein kinase I-like [Source:NCBI gene;Acc:103024972])

HSP 1 Score: 319.701 bits (818), Expect = 4.740e-108
Identity = 154/285 (54.04%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L     +G++VA+K ES  T  P L  ES   K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKFT+KTVL++A Q+I  ++ +H +  IHRDIKPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  ++   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGANITSGEEVAIKLESVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFTLKTVLLLADQMISRIEYIHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYMNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Cavefish
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:103035793])

HSP 1 Score: 318.546 bits (815), Expect = 6.784e-108
Identity = 154/293 (52.56%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +  
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQA 309          
BLAST of Casein kinase I vs. Ensembl Cavefish
Match: csnk1e (casein kinase I-like [Source:NCBI gene;Acc:103024972])

HSP 1 Score: 320.857 bits (821), Expect = 1.180e-107
Identity = 154/285 (54.04%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L     +G++VA+K ES  T  P L  ES   K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKFT+KTVL++A Q+I  ++ +H +  IHRDIKPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  ++   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGANITSGEEVAIKLESVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFTLKTVLLLADQMISRIEYIHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYMNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Cavefish
Match: csnk1da (casein kinase I [Source:NCBI gene;Acc:103024472])

HSP 1 Score: 320.087 bits (819), Expect = 1.335e-107
Identity = 152/285 (53.33%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +   G++VA+K E   T  P L  ES + K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008477.1 (pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gene:ENSPMAG00000007664.1 transcript:ENSPMAT00000008477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 310.842 bits (795), Expect = 2.120e-105
Identity = 151/286 (52.80%), Postives = 203/286 (70.98%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKF-NGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L       G++VA+K E   T  P L  ES + K LQG  G P+ KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRDIKPDN L GLGK  +++++ID GL+KK+ ++RT+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+  P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW  +
Sbjct:    9 YRLGRKIGSGSFGDIYLVGTNIATGEEVAIKLECVKTKHPQLHIESKIYKLLQGGVGIPVIKWCGAEGDYNVMVMELLGPSMEDLFNFCSRKFSLKTVLLLADQMISRIEYLHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDLGLAKKYRDSRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEMLCKTYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNTL 294          
BLAST of Casein kinase I vs. Ensembl Sea Lamprey
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 266.159 bits (679), Expect = 5.203e-87
Identity = 135/287 (47.04%), Postives = 190/287 (66.20%), Query Frame = 2
Query:   53 NYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKN--KDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIR-MFKDLFIRLNFENDNVFDWT 901
            N+++ +KIG G+FGE+ L +  +  + VA+K E   +  P L  E    K L    G P   ++G  G +N +++ELLGPS+E L+D C+R FT+KTVLMIAIQL+  ++ +H R +I+RD+KP+N L G      + +IH+IDFGL+K++++  T  HIP++  KSL GTARY SINTHL  E SRRDDLE++ ++ +YFLRGSLPWQ LKA T  E+Y+ IG+ K   P E LC   PEE   +L+ ++ L F E+P Y EY+R +F DLF R  +  D  FDWT
Sbjct:   37 NFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCNRTFTLKTVLMIAIQLLTRMEYVHSRNLIYRDVKPENFLIGRQSTNKQHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFERPDY-EYMRNLFMDLFERKGYSFDYEFDWT 322          
BLAST of Casein kinase I vs. Ensembl Sea Lamprey
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 210.69 bits (535), Expect = 1.065e-67
Identity = 103/212 (48.58%), Postives = 147/212 (69.34%), Query Frame = 2
Query:   53 NYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFG-LGKNK-DVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK 682
            N+++ +KIG G+FGE+ L +  +  + VA+K E   +  P L  E    K L    G P   ++G  G +N +++ELLGPS+E L+D C R F++KTVLMIA+QLI  ++ +H R++I+RD+KP+N L G  G +K   IH+IDFGL+K++++  T  HIP++  KSL GTARY SINTHL  E SRRDDLE++ ++ +YFLRGSLPWQ LK
Sbjct:   31 NFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAMQLISRMEYVHSRSLIYRDVKPENFLVGRQGTSKHHNIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 242          
BLAST of Casein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001691.1 (pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1 gene:ENSPMAG00000001522.1 transcript:ENSPMAT00000001691.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.223 bits (526), Expect = 5.708e-67
Identity = 97/181 (53.59%), Postives = 135/181 (74.59%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYE 598
            Y+L+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E
Sbjct:   17 YRLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIE 197          
BLAST of Casein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004926.1 (pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gene:ENSPMAG00000004461.1 transcript:ENSPMAT00000004926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 4.636e-28
Identity = 63/222 (28.38%), Postives = 109/222 (49.10%), Query Frame = 2
Query:  245 GYHGNFNVLIMELLGPSIEQLYDYCSR-KFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIH---LIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDW 898
            G +  FN ++M+L G ++  L     R  F++ T L +  Q+++ ++ +H    +HRDIKP N  F +G+     H   ++D+GL++++  +      P +      GT RY SIN H   E+ R DDL S+ Y+L+ F  G LPW+ +K  +      +G  K +     L R MP +F +FL  + +L +  +P Y         +    +   +  +DW
Sbjct:   11 GRNDKFNYVVMQLQGRNLADLRRSQPRGTFSLSTTLRLGRQMLEAIESIHAVGFLHRDIKPSN--FAMGRLPSTTHKCFMLDYGLARQYTNSSGEVRPP-RAVAGFRGTVRYASINAHRNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQ-----VGLIKERYDHRLLLRHMPTDFHIFLDHVSTLDYCTRPNYQSIHSCALHIMRERSITENEPYDW 224          
BLAST of Casein kinase I vs. Ensembl Yeast
Match: HRR25 (Conserved casein kinase; regulates diverse events including: vesicular traffic, DNA repair, the CVT pathway, monopolar attachment of sister kinetochores at meiosis I, and ribosomal subunit biogenesis; monopolin subunit; binds the RNAPII CTD; phosphorylates COPII coat subunits; interacts with Sit4p phosphatase; antagonizes calcineurin signaling, reducing nuclear accumulation of Crz1p; phosphorylates Dsn1p, the kinetochore receptor for monopolin; homolog of mammalian CK1delta [Source:SGD;Acc:S000006125])

HSP 1 Score: 312.768 bits (800), Expect = 1.723e-104
Identity = 146/285 (51.23%), Postives = 205/285 (71.93%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            +++ RKIGSGSFG+++      +G++VA+K ES  +  P L +ES V +YL G  G P  +W+G  G +N ++++LLGPS+E L++YC R+F+ KTV+M+A+Q+   ++ +H R+ IHRDIKPDN L G+G+    +H+IDFGLSKK+ +  T+ HIP++  KSL GTARY S+NTHL  E SRRDDLES+ YVLIYF +GSLPWQ LKA TK +KY  I EKK+ V  E LC G+P EF  ++   K+L F+EKP Y    R+FKDL I+L + ND++FDWT++
Sbjct:    9 FRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTML 293          
BLAST of Casein kinase I vs. Ensembl Yeast
Match: YCK1 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck2p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK1 has a paralog, YCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001177])

HSP 1 Score: 265.003 bits (676), Expect = 2.073e-85
Identity = 131/290 (45.17%), Postives = 183/290 (63.10%), Query Frame = 2
Query:   53 NYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDV--IHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKT-EKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLIND 913
            +YK+ +KIG GSFG +F      NG  VA+K E + T  P LR E    K L G    P   ++G  G  N+L+++LLGPS+E L+D+C RKF++KTV+ +A+Q+I  ++ +H   +I+RDIKPDN L G     D   IHLIDFG++K++ + +T  HIP++  KSL GTARY SINTHL  E SRRDD+E++ +V  YFLRG LPWQ LKA    +KY  IGEKK      +L +G+P +F  +L+ ++SL FEE P Y  Y ++   +   L    D  +DW  +ND
Sbjct:   68 HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLND 357          
BLAST of Casein kinase I vs. Ensembl Yeast
Match: YCK2 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck1p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK2 has a paralog, YCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005098])

HSP 1 Score: 258.84 bits (660), Expect = 7.638e-83
Identity = 127/288 (44.10%), Postives = 181/288 (62.85%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDV--IHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKT-EKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLIN 910
            YK+ +KIG GSFG +F      NG  VA+K E + T  P L+ E    K L G  G P   ++G  G  N+L+++LLGPS+E L+D+C R+F++KTV+ +A+Q+I  ++ +H   +I+RDIKPDN L G     D   +HLIDFG++K++ + +T  HIP++  KSL GTARY SINTHL  E SRRDD+E++ +V  YFLRG LPWQ LKA    +KY  IGEKK      +L +G+P +F  +L+ +++L FEE P Y  Y  +   +   L    D  +DW  +N
Sbjct:   76 YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLN 363          
BLAST of Casein kinase I vs. Ensembl Yeast
Match: YCK3 (Palmitoylated vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of Vps41p; shares essential functions with Hrr25p; regulates vesicle fusion in AP-3 pathway [Source:SGD;Acc:S000000925])

HSP 1 Score: 233.032 bits (593), Expect = 3.971e-73
Identity = 125/323 (38.70%), Postives = 182/323 (56.35%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQ-----------------VAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGL------------------GKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKTE-KYRLIGEKKMKVPEEELC--RGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLIN 910
            Y +  KIG GSFG +F  E   +  Q                 VA+K E +++  P LR E    + L G  G P   ++G  G  N+LI++LLGPS+E L+++C RKF++KT  M+A Q+ID ++ +H+  +I+RDIKPDN L                       + ++I+++DFG++K++ + RT  HIP++  KSL GTARY SINTH   E SRRDDLES+ +V  YFLRGSLPWQ LKA   + KY  IG  K K+  ++L     +P +F  +LK  +SL F+E P Y   I +  D     + ++D  +DW  +N
Sbjct:   14 YAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYLISLMDDALRLNDLKDDGHYDWMDLN 336          
BLAST of Casein kinase I vs. Ensembl Yeast
Match: PKH1 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh2p; PKH1 has a paralog, PKH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002898])

HSP 1 Score: 73.559 bits (179), Expect = 6.774e-15
Identity = 89/312 (28.53%), Postives = 129/312 (41.35%), Query Frame = 2
Query:   47 IQNYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLR--------FESFVLKYLQGIRG-----FPLHKW--------YGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIP------FKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKD--LFIRLNFENDNVFD 895
            I+++K   ++G GS+  V LA  + +GK+ AVK  SK     L+R         E   L+ L G +G     F             Y  HG+F  LI +        L + C+R +        A Q+ID +  +H   IIHRDIKP+NIL  L KN  V  L DFG +K   E  +N          +   KS +GTA Y S           R D+ +   +L   L G  P+      K     L  +K MK+ +     G P+     +K +        P     I+  K    F  +NFE+ +V+D
Sbjct:  122 IKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEY---LIRQKKVKYVTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKY-----GSLNETCARYY--------ASQIIDAVDSLHNIGIIHRDIKPENIL--LDKNMKV-KLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF------KAANEYLTFQKVMKI-QYAFTAGFPQIVKDLVKKL----LVRDPNDRLTIKQIKAHLFFHEVNFEDGSVWD 403          
BLAST of Casein kinase I vs. Ensembl Nematostella
Match: EDO46523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ6])

HSP 1 Score: 323.939 bits (829), Expect = 2.218e-110
Identity = 155/293 (52.90%), Postives = 211/293 (72.01%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            Y+L+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  ++YG   ++NVL+MELLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+GK+ + + LIDFGL+KK+ ++RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN++ D +FDWT++  K  ++T
Sbjct:   19 YRLVRKIGSGSFGDIYLAINTTNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPSVRYYGQERDYNVLVMELLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGVGKHCNKLFLIDFGLAKKYRDSRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNYQYDYIFDWTMLKQKAAQAT 311          
BLAST of Casein kinase I vs. Ensembl Nematostella
Match: EDO34742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG2])

HSP 1 Score: 315.079 bits (806), Expect = 3.960e-106
Identity = 152/285 (53.33%), Postives = 202/285 (70.88%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L      G++VA+K E   T  P L  E+   K +QG  G P  KW G  G++NVL+MELLGPS+E L+++C+RKF+IKTVL++A Q I  ++ +H +  IHRDIKPDN L GLGK  +++++IDFGL+KK+ + RT+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  +  D VFDW L+
Sbjct:    9 YRLGRKIGSGSFGDIYLGTSISTGEEVAIKLECVKTKHPQLHIEAKFYKMMQGGVGIPTIKWCGTEGDYNVLVMELLGPSLEDLFNFCNRKFSIKTVLLLADQTISRIEYVHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDPRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFATYLNNCRSLRFDDKPDYSYLRQLFRNLFHRQGYTYDYVFDWNLL 293          
BLAST of Casein kinase I vs. Ensembl Nematostella
Match: EDO48738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM1])

HSP 1 Score: 299.671 bits (766), Expect = 6.380e-101
Identity = 145/288 (50.35%), Postives = 200/288 (69.44%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            Y+L+RKIGSGSFG+++L     NG++ AVK ES+    P L +ES + K L G  G P  + +    ++NVL+M+LLGPS+E L+++C+RKF +KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + ++LIDFGL+KK+ ++RT  HI ++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R +LPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   K L FEE P Y    ++F+ LF  LN + D +FDWT +  K
Sbjct:   14 YRLVRKIGSGSFGDIYLCVHTENGEEKAVKLESQKARHPQLLYESKLYKILAGGSGIPAIRHFSQENDYNVLVMDLLGPSLEDLFNFCNRKFNMKTVLMLADQMIARIEYVHNKNFIHRDIKPDNFLMGIGRHCNKLYLIDFGLAKKYRDSRTKQHISYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRSNLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFSMYLNYCKGLRFEEAPDYMYLRQLFRILFRTLNHQYDYIFDWTTLKQK 301          
BLAST of Casein kinase I vs. Ensembl Nematostella
Match: EDO34289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP6])

HSP 1 Score: 266.929 bits (681), Expect = 1.401e-86
Identity = 137/288 (47.57%), Postives = 192/288 (66.67%), Query Frame = 2
Query:   53 NYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFG---LGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIR-MFKDLFIRLNFENDNVFDWT 901
            N+++ +KIG G+FGE+ L +  +N + VA+K E   +  P L  E    K L    G P   ++G  G +N L+MELLGPS+E L+D C+R+F++KTVLM+A+QLI  ++ +H + +I+RDIKP+N L G    GK K  I++IDFGL+K++++  T  HIP++  KSL GTARY SINTHL  E SRRDDLE++ ++ +YFLRGSLPWQ LKA T  E+Y+ IG+ K   P E LC   PEE   +L+ ++ L F E P Y EY+R +F+DL  R  +  D  FDWT
Sbjct:   45 NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSRAPQLHLEYRFYKALGNAEGIPQVHYFGPCGKYNALVMELLGPSLEDLFDLCNRQFSLKTVLMVALQLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEK-TINIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENHPEEMATYLRYVRRLDFFETPDY-EYLRKLFRDLMERKGYVEDFEFDWT 330          
BLAST of Casein kinase I vs. Ensembl Nematostella
Match: EDO46789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP40])

HSP 1 Score: 150.214 bits (378), Expect = 3.124e-43
Identity = 91/276 (32.97%), Postives = 144/276 (52.17%), Query Frame = 2
Query:   83 GSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRK-FTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIH---LIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDW 898
            G FGE++   ++     VA+K ES + +K +L+ E  VLK LQG+         G + +FN L+M L G ++ +L     +  F+  T+L +  Q++ ++K +HE   +HRDIKP N  F +G   D +H   ++DFGLS++F +A      P  T     GT RY SIN H   E+ R DDL S  Y+++ F  G LPW+ +K  +      +G+ K       L + MP EF  F+  I  L +E+KP Y   + + + +  R   +  + +DW
Sbjct:   24 GGFGEIYRGLDQVTKDYVAIKLESVHQSKQVLKMEVAVLKKLQGVDHICKFISCGRNESFNYLVMSLQGSNLAELRRSQPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSN--FAMGNTPDTVHICYMLDFGLSRQFTKANGEVRPPRNTA-GFRGTVRYASINAHENKEMGRHDDLWSFFYLMVEFTVGQLPWRKMKDKEQ-----VGKMKKTYDIANLLKSMPGEFKQFVDHISKLKYEDKPDYKMLLGLLEQIIKRKGIKESDPYDW 291          
BLAST of Casein kinase I vs. Ensembl Medaka
Match: csnk1db (casein kinase 1 delta [Source:NCBI gene;Acc:101156740])

HSP 1 Score: 321.627 bits (823), Expect = 2.927e-108
Identity = 152/285 (53.33%), Postives = 207/285 (72.63%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +   G++VA+K E   T  P L  ES + K +QG  G P+ KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPIIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Medaka
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:101155263])

HSP 1 Score: 318.161 bits (814), Expect = 5.831e-108
Identity = 154/291 (52.92%), Postives = 206/291 (70.79%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKK 925
            YKL+RKIGSGSFG+++LA    NG++VAVK ES+    P L +ES + K LQG  G P  +WYG   ++NVL+M+LLGPS+E L+++CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + LIDFGL+KK+ + RT  HIP++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF R SLPWQ LK ATK +KY  I EKKM  P E LC+G P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  K  +
Sbjct:   17 YKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQ 307          
BLAST of Casein kinase I vs. Ensembl Medaka
Match: ENSORLT00000018110.2 (casein kinase 1 epsilon [Source:NCBI gene;Acc:101175322])

HSP 1 Score: 319.316 bits (817), Expect = 3.310e-107
Identity = 153/293 (52.22%), Postives = 207/293 (70.65%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKST 931
            Y+L RKIGSGSFG+++L      G++VA+K E   T  P L  ES   K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P E LC+G P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++     ++T
Sbjct:    9 YRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRTT 301          
BLAST of Casein kinase I vs. Ensembl Medaka
Match: csnk1e (casein kinase I [Source:NCBI gene;Acc:105356509])

HSP 1 Score: 318.546 bits (815), Expect = 7.366e-107
Identity = 152/285 (53.33%), Postives = 203/285 (71.23%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L      G++VA+K E   T  P L  ES   K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P   LCRG P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGSNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPFIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKGQKYERISEKKMSTPIGVLCRGYPSEFSTYLNYCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Ensembl Medaka
Match: csnk1e (casein kinase I [Source:NCBI gene;Acc:105356509])

HSP 1 Score: 317.005 bits (811), Expect = 1.829e-106
Identity = 152/285 (53.33%), Postives = 203/285 (71.23%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L      G++VA+K E   T  P L  ES   K +QG  G P  KW G  G++NV++MELLGPS+E L+++CSRKF++KTVL++A Q+I  ++ +H +  IHRD+KPDN L GLGK  +++++IDFGL+KK+ +ART+ HIP++  K+L GTARY SINTHL  E SRRDDLES+ YVL+YF  GSLPWQ LK ATK +KY  I EKKM  P   LCRG P EF  +L   +SL F++KP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGSNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPFIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKGQKYERISEKKMSTPIGVLCRGYPSEFSTYLNYCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML 293          
BLAST of Casein kinase I vs. Planmine SMEST
Match: SMESG000051070.1 (SMESG000051070.1)

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 299/300 (99.67%), Postives = 299/300 (99.67%), Query Frame = 2
Query:   35 MIEEIQNYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKSTN 934
            MIEEIQNYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKK TN
Sbjct:    1 MIEEIQNYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKLTN 300          
BLAST of Casein kinase I vs. Planmine SMEST
Match: SMESG000013694.1 (SMESG000013694.1)

HSP 1 Score: 315.079 bits (806), Expect = 1.023e-104
Identity = 149/285 (52.28%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +  +G++VA+K E   T  P L  ES + K LQ   G P  KW G  G++NV++MELLGPS+E L+++C RKF +KTVL++A QLI+ ++ +H +  IHRDIKPDN L GLGK  +++++IDFGL+K++ + R++ HIP++  K+L GTARY SINTHL  E +RRDD+ES+ YV++YFLRGSLPWQ LK ATK +KY  I EKKM+   E LC+G P EF  +L   +SL F+EKP YS   ++F++LF R  F  D VFDW ++
Sbjct:    9 YRLGRKIGSGSFGDIYLGTDVTSGEEVAIKLECLKTKHPQLHIESKIYKMLQSGVGIPHMKWCGTEGDYNVMVMELLGPSLEDLFNFCGRKFKLKTVLLLADQLINRIEFIHSKCFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKRYRDNRSHEHIPYRENKNLTGTARYASINTHLGIEQARRDDMESLGYVIMYFLRGSLPWQGLKAATKRQKYERISEKKMETSVEVLCQGYPSEFATYLNICRSLRFDEKPDYSYLRQLFRNLFHREGFAYDYVFDWNIL 293          
BLAST of Casein kinase I vs. Planmine SMEST
Match: SMESG000013694.1 (SMESG000013694.1)

HSP 1 Score: 315.464 bits (807), Expect = 4.603e-104
Identity = 149/285 (52.28%), Postives = 206/285 (72.28%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLI 907
            Y+L RKIGSGSFG+++L  +  +G++VA+K E   T  P L  ES + K LQ   G P  KW G  G++NV++MELLGPS+E L+++C RKF +KTVL++A QLI+ ++ +H +  IHRDIKPDN L GLGK  +++++IDFGL+K++ + R++ HIP++  K+L GTARY SINTHL  E +RRDD+ES+ YV++YFLRGSLPWQ LK ATK +KY  I EKKM+   E LC+G P EF  +L   +SL F+EKP YS   ++F++LF R  F  D VFDW ++
Sbjct:   78 YRLGRKIGSGSFGDIYLGTDVTSGEEVAIKLECLKTKHPQLHIESKIYKMLQSGVGIPHMKWCGTEGDYNVMVMELLGPSLEDLFNFCGRKFKLKTVLLLADQLINRIEFIHSKCFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKRYRDNRSHEHIPYRENKNLTGTARYASINTHLGIEQARRDDMESLGYVIMYFLRGSLPWQGLKAATKRQKYERISEKKMETSVEVLCQGYPSEFATYLNICRSLRFDEKPDYSYLRQLFRNLFHREGFAYDYVFDWNIL 362          
BLAST of Casein kinase I vs. Planmine SMEST
Match: SMESG000013473.1 (SMESG000013473.1)

HSP 1 Score: 300.827 bits (769), Expect = 7.713e-101
Identity = 145/291 (49.83%), Postives = 200/291 (68.73%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHG---NFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLKA-TKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            ++L+RKIGSGSFG+++L     NG++VAVK ES N   P L +ES V K+LQ   G P  +WYG+ G    +N L+M+LLGPS+E L+++C R+FT+KTVLM+A Q++  ++ +H +  IHRDIKPDN L G+G++ + + ++DFGLSKK+ + +T AHIP++  K+L GTARY SIN H   E SRRDD+ES+ YV +YFLR +LPWQ LKA  K +KY  I EKK   P + LC+  P EF  +L+  ++L F+E P Y      F +LF  LNF  D VFDWTL+  K
Sbjct:   21 WRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQK 311          
BLAST of Casein kinase I vs. Planmine SMEST
Match: SMESG000081615.1 (SMESG000081615.1)

HSP 1 Score: 295.049 bits (754), Expect = 4.288e-98
Identity = 144/288 (50.00%), Postives = 198/288 (68.75%), Query Frame = 2
Query:   56 YKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRFESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFTIKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFGLSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAYVLIYFLRGSLPWQNLK-ATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFLKTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDK 916
            Y+LIRKIGSGSFGE++L   + NG++VAVK E +N   P L +ES + K L G  G P  +W+G   + N+L+M+LLGPS+E L+ +CSR+FT+KTVLM+A Q+I  ++ +H +  IHRDIKPDN L G+G++ + + +IDFGL+KK+ + RT  HI ++  K+L GTARY SIN HL  E SRRDD+ES+ YVL+YF  G LPWQ LK ATK +KY  I EKK+    E LC+  P EF ++L   + L FEE P Y    ++F+ LF  LN + D  FDWT++  +
Sbjct:   17 YRLIRKIGSGSFGEIYLGVNQANGEEVAVKLEHQNARHPQLLYESKLYKILAGGVGIPHIRWFGKDKDHNMLVMDLLGPSLEDLFSFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGIGRHCNKVFIIDFGLAKKYRDNRTGKHITYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNLGVLPWQGLKAATKRQKYEKISEKKISTSIEMLCQRFPAEFTMYLNYCRGLRFEETPDYMYLRQLFRILFRTLNHQFDYTFDWTMLKQR 304          
The following BLAST results are available for this feature:
BLAST of Casein kinase I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSNK1A16.242e-10852.56casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1E7.378e-10852.72casein kinase 1 epsilon [Source:HGNC Symbol;Acc:HG... [more]
CSNK1A11.116e-10752.56casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1E1.634e-10753.33casein kinase 1 epsilon [Source:HGNC Symbol;Acc:HG... [more]
CSNK1D2.147e-10752.98casein kinase 1 delta [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-191.362e-10651.36Casein kinase I isoform alpha [Source:UniProtKB/S... [more]
kin-191.362e-10651.36Casein kinase I isoform alpha [Source:UniProtKB/S... [more]
kin-205.023e-9548.76Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-205.023e-9548.76Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-206.452e-9548.76Casein kinase I isoform delta [Source:UniProtKB/S... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CkIalpha2.409e-9950.00gene:FBgn0015024 transcript:FBtr0073680[more]
CkIalpha2.409e-9950.00gene:FBgn0015024 transcript:FBtr0073682[more]
CkIalpha2.409e-9950.00gene:FBgn0015024 transcript:FBtr0345163[more]
CkIalpha2.409e-9950.00gene:FBgn0015024 transcript:FBtr0300380[more]
CkIalpha2.409e-9950.00gene:FBgn0015024 transcript:FBtr0345162[more]
back to top
BLAST of Casein kinase I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1a13.928e-10852.56casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
csnk1a17.749e-10852.56casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
csnk1da7.827e-10853.33casein kinase 1, delta a [Source:NCBI gene;Acc:322... [more]
csnk1a18.005e-10852.56casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
csnk1da8.873e-10853.33casein kinase 1, delta a [Source:NCBI gene;Acc:322... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1a15.658e-10852.56casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a11.043e-10752.56casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a11.481e-10752.56casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a11.583e-10752.56casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a11.763e-10752.56casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csnk1a14.285e-10852.56casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1a16.651e-10852.56casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1a17.665e-10852.56casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1a18.449e-10852.56casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1d1.490e-10752.98casein kinase 1, delta [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Casein kinase I vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P67829|KC1A_SHEEP2.998e-10752.56Casein kinase I isoform alpha OS=Ovis aries OX=994... [more]
sp|P67828|KC1A_RABIT2.998e-10752.56Casein kinase I isoform alpha OS=Oryctolagus cunic... [more]
sp|P67827|KC1A_BOVIN2.998e-10752.56Casein kinase I isoform alpha OS=Bos taurus OX=991... [more]
sp|P97633|KC1A_RAT5.170e-10752.56Casein kinase I isoform alpha OS=Rattus norvegicus... [more]
sp|Q8BK63|KC1A_MOUSE5.362e-10752.56Casein kinase I isoform alpha OS=Mus musculus OX=1... [more]
back to top
BLAST of Casein kinase I vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N5ANE23.484e-11055.78Protein kinase domain-containing protein OS=Syphac... [more]
D7FMN18.955e-10952.78Casein kinase (Serine/threonine/tyrosine protein k... [more]
E1ZQ401.172e-10850.85Protein kinase domain-containing protein OS=Chlore... [more]
V3ZXK11.667e-10854.04Protein kinase domain-containing protein OS=Lottia... [more]
A0A158N8F51.708e-10851.99Protein kinase domain-containing protein OS=Onchoc... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1db4.399e-10853.33casein kinase I [Source:NCBI gene;Acc:103030301][more]
csnk1e4.740e-10854.04casein kinase I-like [Source:NCBI gene;Acc:1030249... [more]
csnk1a16.784e-10852.56casein kinase 1 alpha 1 [Source:NCBI gene;Acc:1030... [more]
csnk1e1.180e-10754.04casein kinase I-like [Source:NCBI gene;Acc:1030249... [more]
csnk1da1.335e-10753.33casein kinase I [Source:NCBI gene;Acc:103024472][more]
back to top
BLAST of Casein kinase I vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008477.12.120e-10552.80pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gen... [more]
csnk1g2a5.203e-8747.04casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g11.065e-6748.58casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
ENSPMAT00000001691.15.708e-6753.59pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1... [more]
ENSPMAT00000004926.14.636e-2828.38pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gen... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRR251.723e-10451.23Conserved casein kinase; regulates diverse events ... [more]
YCK12.073e-8545.17Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK27.638e-8344.10Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK33.971e-7338.70Palmitoylated vacuolar membrane-localized casein k... [more]
PKH16.774e-1528.53Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465232.218e-11052.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347423.960e-10653.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487386.380e-10150.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342891.401e-8647.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467893.124e-4332.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Casein kinase I vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1db2.927e-10853.33casein kinase 1 delta [Source:NCBI gene;Acc:101156... [more]
csnk1a15.831e-10852.92casein kinase 1 alpha 1 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000018110.23.310e-10752.22casein kinase 1 epsilon [Source:NCBI gene;Acc:1011... [more]
csnk1e7.366e-10753.33casein kinase I [Source:NCBI gene;Acc:105356509][more]
csnk1e1.829e-10653.33casein kinase I [Source:NCBI gene;Acc:105356509][more]
back to top
BLAST of Casein kinase I vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051070.10.000e+099.67SMESG000051070.1[more]
SMESG000013694.11.023e-10452.28SMESG000013694.1[more]
SMESG000013694.14.603e-10452.28SMESG000013694.1[more]
SMESG000013473.17.713e-10149.83SMESG000013473.1[more]
SMESG000081615.14.288e-9850.00SMESG000081615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025502 ID=SMED30025502|Name=Casein kinase I|organism=Schmidtea mediterranea sexual|type=transcript|length=962bp
CAATATTATATAAGTATCTGTATATAACTTTAAAATGATAGAAGAAATTC
AAAATTACAAACTTATTAGAAAAATCGGTTCAGGCTCATTTGGTGAGGTG
TTTCTTGCTGAAGAAAAATTTAATGGAAAGCAAGTAGCAGTGAAGAAAGA
ATCTAAAAATACAACTAAGCCTCTTCTTCGTTTCGAATCATTTGTTTTAA
AATATTTACAAGGTATTCGTGGTTTTCCTCTTCACAAGTGGTATGGATAT
CATGGTAATTTTAACGTTCTTATTATGGAGCTTTTAGGCCCAAGTATTGA
GCAATTATATGATTACTGTAGTAGAAAATTTACAATAAAAACGGTATTGA
TGATTGCCATTCAGTTGATAGATACTTTAAAACGGATGCATGAAAGGACT
ATTATTCATCGAGATATTAAGCCTGATAACATATTATTTGGACTAGGCAA
AAATAAAGACGTTATCCATCTTATTGATTTCGGGTTATCAAAAAAATTTC
TGGAAGCTAGAACAAATGCTCATATTCCATTCAAAACCGGAAAATCATTG
CTTGGTACAGCTAGATATTGTAGCATAAATACACATTTAACTTACGAGGT
ATCTCGGAGAGATGACTTAGAATCCGTTGCCTATGTGTTGATATATTTTC
TGAGAGGCTCACTTCCTTGGCAAAACCTCAAAGCTACCAAAACAGAAAAA
TATCGCTTAATCGGCGAGAAAAAGATGAAAGTGCCAGAAGAAGAACTTTG
TCGTGGAATGCCAGAGGAATTCTGTCTGTTTTTGAAGACTATAAAATCTC
TGGGATTTGAAGAAAAGCCGAAATATTCTGAATACATACGAATGTTTAAA
GATTTATTTATCAGACTTAATTTCGAAAATGATAACGTATTTGATTGGAC
GCTTATCAACGATAAAATGAAGAAATCGACGAATTAATATATTTATACTT
TTTCAAAAAAAA
back to top

protein sequence of SMED30025502-orf-1

>SMED30025502-orf-1 ID=SMED30025502-orf-1|Name=SMED30025502-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=301bp
MIEEIQNYKLIRKIGSGSFGEVFLAEEKFNGKQVAVKKESKNTTKPLLRF
ESFVLKYLQGIRGFPLHKWYGYHGNFNVLIMELLGPSIEQLYDYCSRKFT
IKTVLMIAIQLIDTLKRMHERTIIHRDIKPDNILFGLGKNKDVIHLIDFG
LSKKFLEARTNAHIPFKTGKSLLGTARYCSINTHLTYEVSRRDDLESVAY
VLIYFLRGSLPWQNLKATKTEKYRLIGEKKMKVPEEELCRGMPEEFCLFL
KTIKSLGFEEKPKYSEYIRMFKDLFIRLNFENDNVFDWTLINDKMKKSTN
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 8..289
e-value: 3.6E-15
score: 66.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 8..239
e-value: 8.8E-27
score: 94.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 8..276
score: 28.584
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 3..300
e-value: 2.1E-94
score: 318.8
NoneNo IPR availablePANTHERPTHR11909:SF352coord: 9..293
NoneNo IPR availablePANTHERPTHR11909CASEIN KINASE-RELATEDcoord: 9..293
NoneNo IPR availableCDDcd14016STKc_CK1coord: 7..271
e-value: 1.8117E-150
score: 420.325
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 14..38
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 123..135
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 6..288