secreted frizzled related protein 2

Overview
Namesecreted frizzled related protein 2 (ADO51625.1)
Smed IDSMED30025497
Length (bp)1507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of secreted frizzled related protein 2 (SMED30025497) t-SNE clustered cells

Violin plots show distribution of expression levels for secreted frizzled related protein 2 (SMED30025497) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of secreted frizzled related protein 2 (SMED30025497) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for secreted frizzled related protein 2 (SMED30025497) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025497

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30025497SMESG000050379.1 HM751831.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30025497SMESG000050379.1 ADO51625.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30025497SMESG000050379.1 ADO51625.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30025497SMESG000050379.1 ADO51625.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30025497SMESG000050379.1 dd_Smed_v4_8832_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30025497SMESG000050379.1 SmedASXL_009354SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30025497SMESG000050379.1 dd_Smed_v4_8832_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025497SMESG000050379.1 dd_Smed_v4_8832_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025497SMESG000050379.1 dd_Smed_v4_8832_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025497SMESG000050379.1 dd_Smed_v6_8832_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025497SMESG000050379.1 OX_Smed_1.0.06957ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
anterior region of the whole animalSMED30025497SMESG000050379.1 HM751831.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30025497SMESG000050379.1 dd_Smed_v4_8832_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025497SMESG000050379.1 dd_Smed_v4_8832_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of secreted frizzled related protein 2 vs. Ensembl Human
Match: SFRP5 (secreted frizzled related protein 5 [Source:HGNC Symbol;Acc:HGNC:10779])

HSP 1 Score: 132.494 bits (332), Expect = 3.183e-34
Identity = 77/238 (32.35%), Postives = 122/238 (51.26%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLH------KKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC  +GY +M LPN L+HE++ E    +  W      +CH+DT+ FLCSL+APVC+     R I PC+ LC +V+  C+P M  +G+ WPE+LHC KFP     LCI    G +P+ +  V      C   +SA  + +  CSS  V++ +I  ++I N  + ++         K   + + +   L         C C  +D+     G +L+MG   DG+  L ++
Sbjct:   52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDS---LAGSFLVMGRKVDGQLLLMAV 281          
BLAST of secreted frizzled related protein 2 vs. Ensembl Human
Match: SFRP1 (secreted frizzled related protein 1 [Source:HGNC Symbol;Acc:HGNC:10776])

HSP 1 Score: 123.25 bits (308), Expect = 7.573e-31
Identity = 65/172 (37.79%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGC-NCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNS 1022
            +C +IP +  LC N+GY KM+LPN L+HET+ E    +  W    +  CH  T+ FLCSL+APVC+     R I PC+ LC +V+ +C P M  FG+ WPE+L CDKFP+    +CI  T       S       C  C +   +  I ++ C+S   +R KI  ++  N  
Sbjct:   57 QCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLD----RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPE--GDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGD 222          
BLAST of secreted frizzled related protein 2 vs. Ensembl Human
Match: SFRP2 (secreted frizzled related protein 2 [Source:HGNC Symbol;Acc:HGNC:10777])

HSP 1 Score: 122.479 bits (306), Expect = 8.280e-31
Identity = 77/246 (31.30%), Postives = 120/246 (48.78%), Query Frame = 3
Query:  492 YGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAA-FINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP-TDLPFITSI-----EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            + Y    C  IP    LC  I Y  M LPN L HET++E +  +  W      +CH DT++FLCSL+APVC+ ++    IQPC  LC+ VK  C+P M  FG+ WP++L CD+FPQ    LCI          ++   PK C  C++       I +  C +   ++ K+  +   N    ++   K   I K N  ++     S+      + C C+ +++ N     +L+MG    G+  +TS+
Sbjct:   33 FSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCL-DDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDIN---APYLVMGQKQGGELVITSV 273          
BLAST of secreted frizzled related protein 2 vs. Ensembl Human
Match: FZD5 (frizzled class receptor 5 [Source:HGNC Symbol;Acc:HGNC:4043])

HSP 1 Score: 89.7373 bits (221), Expect = 2.528e-18
Identity = 41/108 (37.96%), Postives = 60/108 (55.56%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            C EI     +C+ IGYN   +PN   H+T  EA      +    +I+C  D R FLCS+Y P+C+P+   + + PC+ +C   K  CSP M  +G+ WPE + CD+ P
Sbjct:   33 CQEI--TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDY-HKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLP 137          
BLAST of secreted frizzled related protein 2 vs. Ensembl Human
Match: FZD1 (frizzled class receptor 1 [Source:HGNC Symbol;Acc:HGNC:4038])

HSP 1 Score: 88.5817 bits (218), Expect = 5.475e-18
Identity = 42/113 (37.17%), Postives = 63/113 (55.75%), Query Frame = 3
Query:  525 PNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAG-LCI 860
            P    LC +I YN+ I+PN L H   ++A      +     ++C  + + FLCS+YAPVC   E  + + PC+ LC   ++ C   M  FG++WP+ L C+KFP   AG LC+
Sbjct:  118 PISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLE--QALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCV 228          
BLAST of secreted frizzled related protein 2 vs. Ensembl Celegans
Match: sfrp-1 (Secreted Frizzled-Related Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3ARM8])

HSP 1 Score: 135.961 bits (341), Expect = 6.026e-36
Identity = 84/234 (35.90%), Postives = 129/234 (55.13%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISR-----LRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDM-IDNDNIRKGRWLLMGVVN-DGKF 1190
            +C +IP+   +C  I Y +M LPN L+HETV EAI++S DW+    + CH DT+RFLCSL+APVC+  +  R I PCK LC++VK+ C   M  +G+ WPE+L C+KF      +CI+  + A P   SS     C+  + Y    + D +C S  V++AK+ R     +R+RN       L K  +    +  ++   +  + SC C++ + N N    + L+M     DGK+
Sbjct:   36 KCVDIPSNLSICNGIEYTQMRLPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCL-MQMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKFEDD--DMCIKPMQPAKPPAGSSTTCTACSQVATYEN--LVDQFCRSHLVLKAKVIRDSPTHIRVRNGRS----LKKGERRRGVSDVEIRLSSESDGSCPCNIPVKNQN---EKLLVMASRQPDGKY 257          
BLAST of secreted frizzled related protein 2 vs. Ensembl Celegans
Match: sfrp-1 (Secreted Frizzled-Related Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3ARM8])

HSP 1 Score: 120.939 bits (302), Expect = 6.505e-31
Identity = 78/215 (36.28%), Postives = 118/215 (54.88%), Query Frame = 3
Query:  567 MILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISR-----LRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDM-IDNDNIRKGRWLLMGVVN-DGKF 1190
            M LPN L+HETV EAI++S DW+    + CH DT+RFLCSL+APVC+  +  R I PCK LC++VK+ C   M  +G+ WPE+L C+KF      +CI+  + A P   SS     C+  + Y    + D +C S  V++AK+ R     +R+RN       L K  +    +  ++   +  + SC C++ + N N    + L+M     DGK+
Sbjct:    1 MRLPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCL-MQMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKFEDD--DMCIKPMQPAKPPAGSSTTCTACSQVATYEN--LVDQFCRSHLVLKAKVIRDSPTHIRVRNGRS----LKKGERRRGVSDVEIRLSSESDGSCPCNIPVKNQN---EKLLVMASRQPDGKY 203          
BLAST of secreted frizzled related protein 2 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9970037:1 gene:WBGene00003397.1 transcript:T23D8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 106.686 bits (265), Expect = 2.283e-24
Identity = 58/144 (40.28%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  408 LLILGICFSKASNNRLSVNEVPEWNNLIYGYSSHR-CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            +LIL +    +++ RLS   +   N    G+S+ R C  I     +CKN+ YN+ + PN L H T  EA  +   +     +KC  D R FLC++YAPVC   E  + IQPC+ELCLS K  C   M  FG++WP+ L C+KFP
Sbjct:    5 ILILFLFGCLSADQRLSSTSISSMN----GFSTTRKCEHI--TIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVCTVLE--KPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFP 140          
BLAST of secreted frizzled related protein 2 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9969413:1 gene:WBGene00003397.1 transcript:T23D8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 106.686 bits (265), Expect = 2.350e-24
Identity = 58/144 (40.28%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  408 LLILGICFSKASNNRLSVNEVPEWNNLIYGYSSHR-CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            +LIL +    +++ RLS   +   N    G+S+ R C  I     +CKN+ YN+ + PN L H T  EA  +   +     +KC  D R FLC++YAPVC   E  + IQPC+ELCLS K  C   M  FG++WP+ L C+KFP
Sbjct:    5 ILILFLFGCLSADQRLSSTSISSMN----GFSTTRKCEHI--TIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVCTVLE--KPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFP 140          
BLAST of secreted frizzled related protein 2 vs. Ensembl Celegans
Match: mig-1 (Transmembrane receptor [Source:UniProtKB/TrEMBL;Acc:G5EF44])

HSP 1 Score: 93.2041 bits (230), Expect = 5.387e-20
Identity = 42/118 (35.59%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  486 LIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPV-RKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
             + G    RC ++ +E  +C ++ YN    PN +  E+ ++A  S + ++    + C    + FLCS+Y P+C  NE +   I PC+ LCLSV++ C P + +FG+KWP+++ CDKFP
Sbjct:   17 FVIGVDGQRCQKVDHE--MCNDLPYNLTSFPNLVDEESWKDASESILTYKPLLSVVCSEQLKFFLCSVYFPMC--NEKLANPIGPCRPLCLSVQEKCLPVLESFGFKWPDVIRCDKFP 130          
BLAST of secreted frizzled related protein 2 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071017)

HSP 1 Score: 90.5077 bits (223), Expect = 6.746e-19
Identity = 39/111 (35.14%), Postives = 61/111 (54.95%), Query Frame = 3
Query:  540 LCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQK--FAGLCIRG 866
            +C+ IGYN+  +PN + +E   +   +   +    +  C +  + FLC+ Y P+C P  PV  I PC+ LC SV+  C P +  FG+ WP  L CDKFP++     +C+ G
Sbjct:   53 MCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEG 163          
BLAST of secreted frizzled related protein 2 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071018)

HSP 1 Score: 90.5077 bits (223), Expect = 6.746e-19
Identity = 39/111 (35.14%), Postives = 61/111 (54.95%), Query Frame = 3
Query:  540 LCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQK--FAGLCIRG 866
            +C+ IGYN+  +PN + +E   +   +   +    +  C +  + FLC+ Y P+C P  PV  I PC+ LC SV+  C P +  FG+ WP  L CDKFP++     +C+ G
Sbjct:   53 MCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEG 163          
BLAST of secreted frizzled related protein 2 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0075743)

HSP 1 Score: 83.9593 bits (206), Expect = 7.976e-17
Identity = 46/109 (42.20%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            RC   P    +CKNI YN  I+PN + H   +EA      +     I C +D + FLCSLY PVC   E  R I PC+ LC S  + C   M T+ + WPE L C KFP
Sbjct:   52 RCE--PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILE--RPIPPCRSLCES-ARVCEKLMKTYNFNWPENLECSKFP 155          
BLAST of secreted frizzled related protein 2 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0330102)

HSP 1 Score: 83.9593 bits (206), Expect = 8.005e-17
Identity = 46/109 (42.20%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            RC   P    +CKNI YN  I+PN + H   +EA      +     I C +D + FLCSLY PVC   E  R I PC+ LC S  + C   M T+ + WPE L C KFP
Sbjct:   52 RCE--PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILE--RPIPPCRSLCESA-RVCEKLMKTYNFNWPENLECSKFP 155          
BLAST of secreted frizzled related protein 2 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0330195)

HSP 1 Score: 80.1073 bits (196), Expect = 1.567e-15
Identity = 40/110 (36.36%), Postives = 58/110 (52.73%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQP-CKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            RC EI     +C+ IGYN    PN + HET  EA      +    +IKC  D + FLCS+Y P+C+  E   K  P C+ +C   +  C+P M  + ++WPE + C+  P
Sbjct:   63 RCEEI--TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICL--EDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP 168          
BLAST of secreted frizzled related protein 2 vs. Ensembl Zebrafish
Match: sfrp5 (secreted frizzled-related protein 5 [Source:ZFIN;Acc:ZDB-GENE-011108-2])

HSP 1 Score: 134.806 bits (338), Expect = 2.852e-35
Identity = 80/238 (33.61%), Postives = 119/238 (50.00%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKII------KSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC N+GY KM LPN L HET+ E    +  W      +CH DT+ FLCSL+APVC+     R I PC+ LC +V+ +C+P M T+G+ WPE+L C+KFP     LCI     A     + V      C +   A  I ++YC+S   ++ KI   +     + ++   KK K++      K +   L        +C C  +DN       +L+MG   D +  L S+
Sbjct:   51 QCVDIPADLRLCYNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCEKFPID-NDLCIPMQFSAGHVTQTPVSKVCPPCDNELKADTIMEHYCASDFALKMKIKEAKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYIKNGANCPCSQLDNLG---SNFLIMGRKVDQQLLLMSI 280          
BLAST of secreted frizzled related protein 2 vs. Ensembl Zebrafish
Match: sfrp2 (secreted frizzled-related protein 2 [Source:ZFIN;Acc:ZDB-GENE-061013-293])

HSP 1 Score: 130.183 bits (326), Expect = 1.059e-33
Identity = 81/242 (33.47%), Postives = 121/242 (50.00%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVP--NEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNC--RSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP--TDLPFITSI-----EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            C  IP    LC +I Y  M LPN L HET+ E +  +  W      +CH DT++FLCSL+APVC+   +EP   IQPC+ LC SVK  C+P M  FG+ WP++L C +FP     LCI           +  VP+ C+       +   I D+ C +   ++ K+  +   N    ++   K   I K+N   TD  F  ++      + C+CD +++ N     +L+MG   DG   +TS+
Sbjct:   38 CKPIPTNLLLCHDIEYTNMRLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCLDDLDEP---IQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFPLD-NDLCIPPAGADALVPVTKEVPRVCDACKEKPENDNEIVDSLCKNDFALKIKVKEISYMNGDTKIIPETKTKMIYKTNGGVTDHDFRKTVLWLKDGLQCVCDELNDIN---AAYLVMGQKMDGNLVITSV 272          
BLAST of secreted frizzled related protein 2 vs. Ensembl Zebrafish
Match: sfrp2 (secreted frizzled-related protein 2 [Source:ZFIN;Acc:ZDB-GENE-061013-293])

HSP 1 Score: 130.183 bits (326), Expect = 1.059e-33
Identity = 81/242 (33.47%), Postives = 121/242 (50.00%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVP--NEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNC--RSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP--TDLPFITSI-----EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            C  IP    LC +I Y  M LPN L HET+ E +  +  W      +CH DT++FLCSL+APVC+   +EP   IQPC+ LC SVK  C+P M  FG+ WP++L C +FP     LCI           +  VP+ C+       +   I D+ C +   ++ K+  +   N    ++   K   I K+N   TD  F  ++      + C+CD +++ N     +L+MG   DG   +TS+
Sbjct:   38 CKPIPTNLLLCHDIEYTNMRLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCLDDLDEP---IQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFPLD-NDLCIPPAGADALVPVTKEVPRVCDACKEKPENDNEIVDSLCKNDFALKIKVKEISYMNGDTKIIPETKTKMIYKTNGGVTDHDFRKTVLWLKDGLQCVCDELNDIN---AAYLVMGQKMDGNLVITSV 272          
BLAST of secreted frizzled related protein 2 vs. Ensembl Zebrafish
Match: sfrp1b (secreted frizzled-related protein 1b [Source:ZFIN;Acc:ZDB-GENE-061103-1])

HSP 1 Score: 129.798 bits (325), Expect = 1.624e-33
Identity = 73/237 (30.80%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKII------KSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            C +IP +  LC N+GY +M+LPN L HET+ E    ++ W       CH  T+  LCSL+APVC+     R + PC+  C +V+ +C+P M  FG+ WPE+L CDKFP     +    T+       +        C +      I D  C+S   I+ KI  ++I N  + V+ L K+ K++      K +   L         C C  ++N    +  +L+MG     ++ LT +
Sbjct:   42 CVDIPEDLRLCFNVGYGRMMLPNLLDHETIAEVKQQAVSWVPLVHKACHKGTQVLLCSLFAPVCLD----RPLYPCRWFCEAVRDSCAPIMQAFGFPWPEMLRCDKFPLGEVCISSNATKSNETDLIAGGSSVCPACENEMKTDLILDQMCASEFAIKTKIKEVKIDNLDRKVI-LQKRRKLVRAGSMKKQDLKKLVLYLKSGAHCPCQQLEN---LENHYLIMGRSVGKQYVLTGI 270          
BLAST of secreted frizzled related protein 2 vs. Ensembl Zebrafish
Match: sfrp1b (secreted frizzled-related protein 1b [Source:ZFIN;Acc:ZDB-GENE-061103-1])

HSP 1 Score: 129.798 bits (325), Expect = 1.624e-33
Identity = 73/237 (30.80%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKII------KSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            C +IP +  LC N+GY +M+LPN L HET+ E    ++ W       CH  T+  LCSL+APVC+     R + PC+  C +V+ +C+P M  FG+ WPE+L CDKFP     +    T+       +        C +      I D  C+S   I+ KI  ++I N  + V+ L K+ K++      K +   L         C C  ++N    +  +L+MG     ++ LT +
Sbjct:   42 CVDIPEDLRLCFNVGYGRMMLPNLLDHETIAEVKQQAVSWVPLVHKACHKGTQVLLCSLFAPVCLD----RPLYPCRWFCEAVRDSCAPIMQAFGFPWPEMLRCDKFPLGEVCISSNATKSNETDLIAGGSSVCPACENEMKTDLILDQMCASEFAIKTKIKEVKIDNLDRKVI-LQKRRKLVRAGSMKKQDLKKLVLYLKSGAHCPCQQLEN---LENHYLIMGRSVGKQYVLTGI 270          
BLAST of secreted frizzled related protein 2 vs. Ensembl Xenopus
Match: frzb2 (frizzled related protein 2 [Source:NCBI gene;Acc:549442])

HSP 1 Score: 140.969 bits (354), Expect = 2.019e-37
Identity = 89/273 (32.60%), Postives = 141/273 (51.65%), Query Frame = 3
Query:  411 LILGICFSKASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIR----GTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP---TD-LPFITS---IEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTL 1196
            LI+ +CF    +  + ++         +G SS RC  IP    LC +IGY++M +PN L+H+T+ E I  S  W      +CH D R FLCSL+AP+C+     R I PC+ LC +V+ +C+P M  +GY WPEIL CDKFP+   G+CI     GT G+          + C      +A  I D +C +  V + +I++  I + + Y   L  K +I+K      TD LP +     ++ +C+ +++     R G +++ G V + K  +
Sbjct:   18 LIVLLCFLTCGSQSMYLD--------FFG-SSSRCTRIPRSMALCYDIGYSEMRIPNLLEHDTMAEVIQQSSSWLPLLARECHPDARIFLCSLFAPICLD----RYIYPCRSLCEAVRGSCAPIMACYGYPWPEILRCDKFPEDH-GMCISPITNGT-GSTRRTVPRASCRDCELEEASTAKEILDTFCDNDFVAKVRITKKNITSANLYDFDLDSKLEILKHGSLPKTDVLPRLQQWLDLDATCVQNIM--RGTRTGIYVIGGEVQEDKVVV 273          
BLAST of secreted frizzled related protein 2 vs. Ensembl Xenopus
Match: sfrp5 (secreted frizzled-related protein 5 [Source:NCBI gene;Acc:448129])

HSP 1 Score: 133.265 bits (334), Expect = 1.669e-34
Identity = 86/272 (31.62%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  411 LILG-ICFSKASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLH------KKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            LILG + +S A        +   + N  +     +C +IP++  LC N+GY KM LPN L HET+ E    +  W      +CH DT+ FLCSL+AP+C+     R I PC+ LC  V+ +C+P M ++G+ WPE+L+C+KFP     LCI    G+       V      C     +  +    C+S  V+R +I  ++I N  + ++         K  K+ +     L        SC C  +DN     G +L+MG   D K  LT++
Sbjct:   14 LILGLVLWSSAEEYDYYSWQSDNFQNGRFYTKQSQCIDIPSDLHLCHNVGYKKMRLPNLLDHETMPEVKQQASSWVPLLAKRCHRDTQLFLCSLFAPICLE----RPIYPCRSLCEVVRDSCAPVMESYGFPWPEMLNCNKFPLD-NDLCITVQFGSKQVTQPPVTKICTQCEIEQKSETMRVQLCASDFVLRMRIKEVKIENGDRKLIAAQKKKKVLKAGKLKRKEFRKLVLYIKNAASCPCPQLDN---LSGSFLIMGRKVDNKLLLTAI 277          
BLAST of secreted frizzled related protein 2 vs. Ensembl Xenopus
Match: sfrp2 (secreted frizzled-related protein 2 [Source:NCBI gene;Acc:394659])

HSP 1 Score: 125.561 bits (314), Expect = 7.022e-32
Identity = 78/246 (31.71%), Postives = 122/246 (49.59%), Query Frame = 3
Query:  492 YGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CR-SLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP-TDLPFITSI-----EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            + Y    C  IP    LC +I Y  M LPN L HET++E +  +  W      +CH DT++FLCSL+APVC+ ++    I+PC+ LC  VK +C+P M  FG+ WP++L C +FPQ    LCI           +   PK C+ C+ S      I +N C +   ++ K+  +   N    ++   K   I K N  T+     ++      + C CD +++ N     +L+MG    G+  +TS+
Sbjct:   33 FSYKRSNCKPIPATLVLCHDIEYPNMRLPNLLGHETMKEVLQQASSWIPLVQKQCHQDTKKFLCSLFAPVCI-DDLDETIKPCRSLCEQVKDSCAPVMSAFGFPWPDMLECSRFPQD-NDLCIPPASTEHVVPVTREAPKVCDACKNSNEDDNDIVENLCKNDFALKIKVKEIAYINGDTKIIPETKGKTIYKLNGVTERDLKKTVLWLKDGLQCTCDEMNDIN---APYLVMGQKLGGELVITSV 273          
BLAST of secreted frizzled related protein 2 vs. Ensembl Xenopus
Match: sfrp1 (Xenopus tropicalis secreted frizzled-related protein 1 (sfrp1), mRNA. [Source:RefSeq mRNA;Acc:NM_001123406])

HSP 1 Score: 120.168 bits (300), Expect = 7.784e-30
Identity = 63/171 (36.84%), Postives = 91/171 (53.22%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGC-NCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNN 1019
            +C EIP +  LC  +GYNKM+LPN L HET+ E    +  W      KCH  T+ FLCSL+APVC+     R + PC+ LC SV+ AC P M  FG+ WPE+L C+++P +   +CI            S   + C  C S   A  + ++ C+S   ++  I  ++  N 
Sbjct:   53 QCVEIPQDMTLCHGVGYNKMVLPNLLDHETMAEVKYQASSWVPLLSKKCHPGTQVFLCSLFAPVCLD----RPVYPCRRLCESVRDACEPVMQYFGFHWPEMLRCEQYPTE-EDVCIAVHLPNATQAPRSRKTEVCPQCDSEIKADSLYEHMCASEFALKVSIREVKKDNG 218          
BLAST of secreted frizzled related protein 2 vs. Ensembl Xenopus
Match: sfrpx (secreted frizzled-related protein [Source:NCBI gene;Acc:100037908])

HSP 1 Score: 119.013 bits (297), Expect = 1.374e-29
Identity = 61/187 (32.62%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCI--RGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKS 1067
            C  IP+   LC  +GY++M LPN L H+T++E +  +  W      +CH DT++FLCSL+APVC+ +E    + PC+ LC +V+  C+P M  FG+ WP++ +C +FP     LC+   G+E              C  R      F+  NYCSS   ++  I  +        V+   +   + KS
Sbjct:   34 CKAIPSSMTLCHGVGYSEMRLPNLLGHDTMKEVLQQAGSWVPLLTKQCHADTKKFLCSLFAPVCL-SELEEAVYPCRSLCEAVRDGCTPVMAAFGFPWPDMFNCTQFPLG-NELCVPPAGSEDKQQEVKEEAPCSACRNRGDADKDFLQ-NYCSSDFALKINIRSVSTLEGDVMVVPEARSRTVYKS 217          
BLAST of secreted frizzled related protein 2 vs. Ensembl Mouse
Match: Sfrp5 (secreted frizzled-related sequence protein 5 [Source:MGI Symbol;Acc:MGI:1860298])

HSP 1 Score: 138.272 bits (347), Expect = 2.061e-36
Identity = 83/238 (34.87%), Postives = 128/238 (53.78%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP------TDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC  +GY +M LPN L+HE++ E    +  W      +CH+DT+ FLCSL+APVC+     R I PC+ LC +V+  C+P M  +G+ WPE+LHC KFP     LCI    G +P+ +  V      C   +SA  + +  CSS  V++ +I  ++I N  + ++   KK K++K+ P        L        SC C  +DN     G +L+MG   +G+  LT++
Sbjct:   49 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDN---LTGSFLVMGRKVEGQLLLTAV 278          
BLAST of secreted frizzled related protein 2 vs. Ensembl Mouse
Match: Sfrp1 (secreted frizzled-related protein 1 [Source:MGI Symbol;Acc:MGI:892014])

HSP 1 Score: 124.02 bits (310), Expect = 2.669e-31
Identity = 78/237 (32.91%), Postives = 114/237 (48.10%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGC-NCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNS----KYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC N+GY KM+LPN L+HET+ E    +  W    +  CH  T+ FLCSL+APVC+     R I PC+ LC +V+ +C P M  FG+ WPE+L CDKFP+    +CI  T       S       C  C +   +  I ++ C+S   +R KI  ++  N          +  K   I K     L         C C  +DN       +L+MG     ++ LT++
Sbjct:   57 QCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLD----RPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPE--GDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGADCPCHQLDN---LSHNFLIMGRKVKSQYLLTAI 284          
BLAST of secreted frizzled related protein 2 vs. Ensembl Mouse
Match: Sfrp2 (secreted frizzled-related protein 2 [Source:MGI Symbol;Acc:MGI:108078])

HSP 1 Score: 123.25 bits (308), Expect = 3.738e-31
Identity = 77/246 (31.30%), Postives = 120/246 (48.78%), Query Frame = 3
Query:  492 YGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSL-YSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP-TDLPFITSI-----EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            + Y    C  IP    LC  I Y  M LPN L HET++E +  +  W      +CH DT++FLCSL+APVC+ ++    IQPC  LC+ VK  C+P M  FG+ WP++L CD+FPQ    LCI          ++   PK C  C++       I +  C +   ++ K+  +   N    ++   K   I K N  ++     S+      + C C+ +++ N     +L+MG    G+  +TS+
Sbjct:   33 FSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCL-DDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQD-NDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDIN---APYLVMGQKQGGELVITSV 273          
BLAST of secreted frizzled related protein 2 vs. Ensembl Mouse
Match: Frzb (frizzled-related protein [Source:MGI Symbol;Acc:MGI:892032])

HSP 1 Score: 87.4261 bits (215), Expect = 2.049e-18
Identity = 62/240 (25.83%), Postives = 112/240 (46.67%), Query Frame = 3
Query:  525 PNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIR-----GTEGAXXXXXXX------XXXKGCNCRSLYSA--AFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITS---IEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTL 1196
            P    LCK++ +N   +PN L H T   AI +   ++      C  D   FLC++YAP+C  +     I+PCK +C   ++ C P ++ + + WPE L CD+ P    G+CI        +GA     SS         + C C+ + +    +  +NY     VIRAK+  ++++ +   V  + +  +I+K++  ++P  T        CLC  +  +      +++MG  ++ +  L
Sbjct:   37 PVRIPLCKSLPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPMDSSTGHCRGASSERCKCKPVRATQKTYFRNNY---NYVIRAKVKEVKMKCHD--VTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNE----EYVIMGYEDEERSRL 267          
BLAST of secreted frizzled related protein 2 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 88.9669 bits (219), Expect = 2.710e-18
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            C EI     +C+ IGYN   +PN   H+T  EA      +    +I C  D R FLCS+Y P+C+P+   + + PC+ +C   K  CSP M  +G+ WPE + CD+ P
Sbjct:   33 CQEI--TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDY-HKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLP 137          
BLAST of secreted frizzled related protein 2 vs. UniProt/SwissProt
Match: sp|Q9XSC1|SFRP5_BOVIN (Secreted frizzled-related protein 5 OS=Bos taurus OX=9913 GN=SFRP5 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.161e-39
Identity = 82/238 (34.45%), Postives = 126/238 (52.94%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTD------LPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC  +GY +M LPN L+HE++ E    +  W      +CH+DT+ FLCSL+APVC+     R I PC+ LC +V+  C+P M  +G+ WPE+LHC KFP     LCI    G +P+ +  V      C   +SA  + +  CSS  V++ +I  ++I N  + ++   KK K++KS P        L         C C  +D+     G +L+MG   DG+  L ++
Sbjct:   50 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKSGPLKRKDTKRLVLHMKNSAGCPCPQLDS---LAGSFLVMGRKVDGQLLLMAV 279          
BLAST of secreted frizzled related protein 2 vs. UniProt/SwissProt
Match: sp|Q9WU66|SFRP5_MOUSE (Secreted frizzled-related protein 5 OS=Mus musculus OX=10090 GN=Sfrp5 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.669e-35
Identity = 82/238 (34.45%), Postives = 127/238 (53.36%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP------TDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC  +GY +M LPN L+HE++ E    +  W      +CH+DT+ FLCSL+APVC+     R I PC+ LC + +  C+P M  +G+ WPE+LHC KFP     LCI    G +P+ +  V      C   +SA  + +  CSS  V++ +I  ++I N  + ++   KK K++K+ P        L        SC C  +DN     G +L+MG   +G+  LT++
Sbjct:   49 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDN---LTGSFLVMGRKVEGQLLLTAV 278          
BLAST of secreted frizzled related protein 2 vs. UniProt/SwissProt
Match: sp|Q5T4F7|SFRP5_HUMAN (Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 1.528e-33
Identity = 77/238 (32.35%), Postives = 122/238 (51.26%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLH------KKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC  +GY +M LPN L+HE++ E    +  W      +CH+DT+ FLCSL+APVC+     R I PC+ LC +V+  C+P M  +G+ WPE+LHC KFP     LCI    G +P+ +  V      C   +SA  + +  CSS  V++ +I  ++I N  + ++         K   + + +   L         C C  +D+     G +L+MG   DG+  L ++
Sbjct:   52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLD-NDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLDS---LAGSFLVMGRKVDGQLLLMAV 281          
BLAST of secreted frizzled related protein 2 vs. UniProt/SwissProt
Match: sp|Q9IA96|SFRP2_CHICK (Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.811e-33
Identity = 82/246 (33.33%), Postives = 120/246 (48.78%), Query Frame = 3
Query:  492 YGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSL-YSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSI------EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            + Y    C  IP    LC+ I Y  M LPN L HETVQE +  +  W      +CH DTR+FLCSL+APVC+ ++    IQPC  LC  VK++C+P M  FG+ WP++L C +FP K   LCI           +   PK C+ C++       I +N C +   ++ K+  +   N    +    K   I K N      +  I       + C CD +++ N+    +L+MG    G+  +TSL
Sbjct:   30 FSYKRSNCKPIPAPMLLCRGIEYQSMRLPNLLGHETVQEVLEQATTWIPLVQKQCHPDTRKFLCSLFAPVCI-DDLDEIIQPCHSLCEEVKESCAPVMSAFGFPWPDMLDCSRFP-KDNDLCIPLASSDHILPVTREAPKVCDACKNKNEDDNDIMENLCKNDFALKIKVKEIAYINGDTKITPETKSKTIYKLNGLTERDLRKIVLWLKGGLQCTCDEMNDINV---PYLVMGQKQAGELVITSL 270          
BLAST of secreted frizzled related protein 2 vs. UniProt/SwissProt
Match: sp|Q9DEQ4|SFRP1_CHICK (Secreted frizzled-related protein 1 OS=Gallus gallus OX=9031 GN=SFRP1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 6.553e-31
Identity = 76/240 (31.67%), Postives = 120/240 (50.00%), Query Frame = 3
Query:  507 HRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGC-NCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIE------VSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            H+C  IP +  LC ++GY+KM+LPN L HET+ E  + +  W    +  CH  T+ FLCSL+APVC+     R + PC+ LC +V+ +C P M  FG+ WPE+L CD+FPQ +  +CI  T       S       C  C +   +  I ++ C+S   ++  I  ++  N  K +  + +K K +K  P     +  +         C C  +DN       +L+MG     +  LT++
Sbjct:   56 HQCVAIPADLRLCHSVGYDKMVLPNLLDHETMAEVKHQASSWVPLLNKNCHMGTQVFLCSLFAPVCLD----RPVYPCRWLCEAVRDSCEPVMQFFGFFWPEMLKCDQFPQDY--VCIAMTTPNATEVSRPKGTTVCPPCDNEMKSEAIVEHLCASEFALKMTIKEVKKENGDKVI--IPRKRKALKLGPIRKKNLKKLVLLLKNGADCPCHQLDNLG---HHFLIMGRQVKTQHLLTAI 284          
BLAST of secreted frizzled related protein 2 vs. TrEMBL
Match: E3UZJ4 (Secreted frizzled related protein 2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 315/316 (99.68%), Postives = 316/316 (100.00%), Query Frame = 3
Query:  435 KASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRFRASDRKMSGLNINGGKMSQNKNRRIIKGNV 1382
            KASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLC+NIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKICGSRFRASDRKMSGLNINGGKMSQNKNRRIIKGNV
Sbjct:    1 KASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCRNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKICGSRFRASDRKMSGLNINGGKMSQNKNRRIIKGNV 316          
BLAST of secreted frizzled related protein 2 vs. TrEMBL
Match: F8WQS9 (Secreted frizzled-related protein B OS=Dugesia japonica OX=6161 GN=DjsFRP-B PE=2 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 7.215e-165
Identity = 247/326 (75.77%), Postives = 286/326 (87.73%), Query Frame = 3
Query:  408 LLILGICFSKASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXX-XXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRFRASDRKMSGLNINGGKMSQNKNRRIIKGNV 1382
            L+I GI F+  + N + VNE+PEWNNL+YGYSSHRCHEIPN+F LCKNIGY KMILPNFLQHE++ EAI+SSIDWQKFA+IKCHNDT+RFLCSLYAPVCVPNEP+RKIQPC+ELCLSVKKACSPNMLTFGYKWP+IL CDKFPQK AGLCIRGTEG VPS  + +V  KGCNC+S+Y++ FIN NYC++TTVIRAKIS+LR R NS+YVMRLHKKSKIIK+N +DLPFI+SIEV CLC+MID++NIRKGRWLLMGVV+   FTL SL KWKKK+KDFKKVIRKLK+ E  ICGS +R SD+ M GLNING KM + KN+R+IK NV
Sbjct:    6 LIIFGIYFTITTGNPILVNEIPEWNNLVYGYSSHRCHEIPNDFNLCKNIGYTKMILPNFLQHESIAEAISSSIDWQKFAEIKCHNDTKRFLCSLYAPVCVPNEPIRKIQPCRELCLSVKKACSPNMLTFGYKWPDILQCDKFPQKSAGLCIRGTEGTVPSGVTPTVASKGCNCKSMYTSVFINSNYCAATTVIRAKISKLRDRGNSRYVMRLHKKSKIIKANSSDLPFISSIEVPCLCNMIDSENIRKGRWLLMGVVHGRTFTLISLIKWKKKSKDFKKVIRKLKRSEAVICGSEYRPSDKNMVGLNINGEKMKE-KNKRLIKDNV 330          
BLAST of secreted frizzled related protein 2 vs. TrEMBL
Match: D3J1K3 (Secreted frizzled-related protein (Fragment) OS=Schmidtea polychroa OX=50054 GN=sFRP PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 9.465e-51
Identity = 91/239 (38.08%), Postives = 139/239 (58.16%), Query Frame = 3
Query:  474 EWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVNDG 1184
            +W     GY+  +C++IP+ F LC N+GY +M+LPN++QHE+++EA   S  W    + +CH D ++F+CSLYAPVC+ N+ ++K+ PC+ELC++VK++C P+M  +G+ WP I+ C KFPQ    LCI  T          V  K C+ C  + S   I + +C S  VIRAKI R+   N +   + L KKSK +K           +E+ C C  +       KGRW++M  ++ G
Sbjct:    2 DWQAFQSGYTIDQCYQIPDNFTLCSNVGYMRMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHADIKKFICSLYAPVCISNQRIQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKT---------VVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTNGNAIQIILQKKSKFLKFQANFSQNALELELKCNCTNLKFKQRALKGRWIIMAQIDRG 231          
BLAST of secreted frizzled related protein 2 vs. TrEMBL
Match: T1E103 (SFRP-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.342e-49
Identity = 105/273 (38.46%), Postives = 154/273 (56.41%), Query Frame = 3
Query:  474 EWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAA---FINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVNDGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKIC 1280
            +W     GYS+ +C+ IP    LC N+GY +MILPN++QHE + E +  S  W    + +CH D R+FLCSLYAPVC+ N  ++K+ PC ELC+ VK+AC P+M  FG++WP I+ C  FP     LCI  T           + KG  CR+    A    + + +C ST VIRAKI +++    + + ++L  KSK IK           I + C C  +   +   KG+WL+M  V + + T+  LTKWKK+N +F+  I  L+KF  ++C
Sbjct:   22 DWQQFQNGYSTEQCYRIPENLTLCNNVGYKRMILPNYIQHEYLDETVQHSKVWIGLVNSQCHEDIRKFLCSLYAPVCINNMRIQKVPPCNELCIRVKEACLPSMKLFGFEWPNIMKCSLFPSVKNSLCIPST-----------ISKGKKCRTCVKGASYEIMANKFCLSTIVIRAKIKKIKSLEGNGFKIQLSPKSKFIKFQSNLTQNSIKIFLHCNCSKLKFEEKAYKGKWLIMANVINNQTTVNFLTKWKKRNVNFRNSINVLRKFGNELC 283          
BLAST of secreted frizzled related protein 2 vs. TrEMBL
Match: D0VYP5 (Secreted frizzled-related protein A (Fragment) OS=Dugesia japonica OX=6161 GN=DjsFRP-A PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.396e-49
Identity = 100/277 (36.10%), Postives = 162/277 (58.48%), Query Frame = 3
Query:  468 VPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVNDGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRF 1292
            + +W +   GY+ ++C+ IPN F LC+++GYN+M+LPN++QHE+++EA   S  W    + +CH D R+F+C LYAPVC+ N+ ++K+ PC+ELC++VK++C P+M  +G+ WP I+ C KFPQ    LCI  T          V  K C+ C    S   I + +C S  VIRAKI R+    + +  + L KKSK +K +        ++ + C C  +       KGRW++M  +N  +  +  +TKWK+K  +FK  ++ ++ F   +C S+ 
Sbjct:    7 IGDWQSFQSGYTINQCYRIPNNFSLCRDVGYNRMVLPNYIQHESIEEAAQHSRVWIGLVNTQCHIDIRKFICCLYAPVCISNQRIQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRT---------IVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKEMQIILQKKSKFLKFSANFSQNDLNLRLKCNCTNLKFKQRALKGRWIIMAKLNKNEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKL 274          
BLAST of secreted frizzled related protein 2 vs. Ensembl Cavefish
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:103037681])

HSP 1 Score: 135.576 bits (340), Expect = 1.381e-35
Identity = 81/239 (33.89%), Postives = 128/239 (53.56%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGC-NCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSN---PTDLPFITSI---EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC  +GY KM LPN L HET+ E +  +  W      +CH DT+ FLCSL+APVC+     R I PC+ LC +V+ +C+P M T+G+ WPE+L CDKFP     LCI   + ++   + + V K C  C +   +  + +++C+S  V++ KI  ++     + ++   KK K++K       DL  +T       +C C  +DN       +L+MG   D +  L S+
Sbjct:   54 QCVDIPVDLRLCYTVGYKKMRLPNLLDHETMPEVLQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCDKFPYD-NDLCI-TMQFSMNHATQTPVSKACPPCDNELKSETVMEHFCASDFVLKMKIKEVKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYLKNGANCPCSQLDNLG---SNFLIMGRKVDQQLLLMSI 283          
BLAST of secreted frizzled related protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000011888.2 (secreted frizzled-related protein 2-like [Source:NCBI gene;Acc:103024223])

HSP 1 Score: 134.806 bits (338), Expect = 2.172e-35
Identity = 88/289 (30.45%), Postives = 143/289 (49.48%), Query Frame = 3
Query:  396 MFGILLILGICFSKASNN----RLSVNEVPEW-NNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKG---CNCRSLYSAA--FINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVS---------CLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +F ++L   +  S A ++     ++ + V ++  +  +G +   C  +P+  GLC  IGY  M LPN L H+TV+EA   +  W      +CH+DTR+FLCSL+AP C+    V  + PC+ LC++V+  C P M  FG+ WPE  +C +FP K   LCI G E A     +S   KG   C+  SL S A   I  N+CSS    + +I    +  +   V+    +S++++   ++     ++E S         C C  ++   +  G  L +G +  G+  L  L
Sbjct:    8 LFTLVLTFRVLVSNAEDDVRIDDVAADVVSDFVTSAEFGTTRTVCKPLPSTMGLCHGIGYESMRLPNLLGHDTVKEAQQQAGAWVPLLTKRCHSDTRKFLCSLFAPACLVELTV-AVPPCRSLCVAVRDGCLPVMSAFGFPWPEAFNCSRFPHK-EELCIPGAEDA-GHVDTSETDKGTVLCDACSLASEAESEIQKNFCSSQFAFKLQIGSSSLEGSDLRVVP-QGRSRVLRWEGSEQEQQAAMEQSALWLPEAANCSCQALEGKPV--GSMLALGNMYKGRMVLARL 290          
BLAST of secreted frizzled related protein 2 vs. Ensembl Cavefish
Match: sfrp2 (secreted frizzled related protein 2 [Source:NCBI gene;Acc:103033411])

HSP 1 Score: 133.265 bits (334), Expect = 5.942e-35
Identity = 81/243 (33.33%), Postives = 123/243 (50.62%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVP--NEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCI-RGTEGAXXXXXXXXXXKGCNC--RSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPT---DL---PFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C  IP    LC  I Y +M LPN L HE + E +  +  W      +CH DTR+FLCSL+APVC+P  +EP+R   PC+ LC +V+  C+P M  FG+ WPE+L C +FP     LCI  G  G   + ++  VPK C+     +   + + D+ C +   ++ K+  +   N    ++   K   I K N     DL     +    + C C+ +++ N     +L+MG   DG   +TSL
Sbjct:   37 QCKPIPPALHLCHEIEYAEMRLPNLLGHEAMSEVLQQAASWVPLVQKRCHPDTRKFLCSLFAPVCLPDVDEPIR---PCRSLCEAVRHGCAPVMAAFGFPWPEMLRCSRFPPD-DDLCIPAGDNGERATAANETVPKVCDACKEKIEDDSEMVDSLCKNDFALKIKVKEITYMNGDTKIIPETKSKTIYKLNGVTERDLRKTALLLKDGLQCSCEEMNDIN---SAYLVMGQKQDGNLVITSL 272          
BLAST of secreted frizzled related protein 2 vs. Ensembl Cavefish
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:103037681])

HSP 1 Score: 133.265 bits (334), Expect = 7.719e-35
Identity = 79/239 (33.05%), Postives = 123/239 (51.46%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGC-NCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSN---PTDLPFITSI---EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP +  LC  +GY KM LPN L HET+ E +  +  W      +CH DT+ FLCSL+APVC+     R I PC+ LC +V+ +C+P M T+G+ WPE+L CDKFP     LCI        +  +      C  C +   +  + +++C+S  V++ KI  ++     + ++   KK K++K       DL  +T       +C C  +DN       +L+MG   D +  L S+
Sbjct:   50 QCVDIPVDLRLCYTVGYKKMRLPNLLDHETMPEVLQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCDKFPYD-NDLCITMQFSMNHATQTPGRTFTCPPCDNELKSETVMEHFCASDFVLKMKIKEVKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYLKNGANCPCSQLDNLG---SNFLIMGRKVDQQLLLMSI 280          
BLAST of secreted frizzled related protein 2 vs. Ensembl Cavefish
Match: sfrp1a (secreted frizzled related protein 1 [Source:NCBI gene;Acc:103030300])

HSP 1 Score: 125.946 bits (315), Expect = 3.246e-32
Identity = 78/237 (32.91%), Postives = 119/237 (50.21%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVM-----RLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C EIP++  LC  +GYN+M LPN L+HET+ E    +  W       CH  T+ FLCSL+ PVC+ ++P   I PC+ LC  V+ AC+P M  FG+ WPE+L C+KFP+    L       +      S +   C+    +    I D+ C+S  VI+ KI  ++  NN + V+     +  K+  + K +   L         C C  +DN N     +L+MG   D +  +T +
Sbjct:   51 QCLEIPDDLRLCHGVGYNQMRLPNLLEHETMAEVKQQAGSWVPLVHKNCHPSTQVFLCSLFTPVCL-DQP---IYPCRWLCEDVRDACTPIMQAFGFPWPEMLTCNKFPEGDVCLSAPNASESALPNGVSPICPPCD----HEVDAILDHICASEFVIKTKIKEVKRENNDRKVILQKKKKTLKQGTLKKKDMKKLILYLKNGADCPCSQLDNLN---NNYLIMGRKVDKQHIITGI 276          
BLAST of secreted frizzled related protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011338.1 (pep scaffold:Pmarinus_7.0:GL496444:1147:1527:1 gene:ENSPMAG00000010311.1 transcript:ENSPMAT00000011338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 4.788e-20
Identity = 36/85 (42.35%), Postives = 52/85 (61.18%), Query Frame = 3
Query:  498 YSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELC 752
            Y    C  IP    LC ++GY +M LPN L HE+++EA+  +  W      +CH DT++FLCS++APVC+ +E    I PC+ LC
Sbjct:   44 YRRPNCKAIPPAMALCHDVGYPEMRLPNLLGHESMREALQQASSWVPLLAKRCHPDTKKFLCSVFAPVCI-DELEDPIWPCRSLC 127          
BLAST of secreted frizzled related protein 2 vs. Ensembl Sea Lamprey
Match: frzb (frizzled related protein [Source:ZFIN;Acc:ZDB-GENE-990715-1])

HSP 1 Score: 87.8113 bits (216), Expect = 1.111e-19
Identity = 39/112 (34.82%), Postives = 60/112 (53.57%), Query Frame = 3
Query:  525 PNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCI 860
            P    +C+++ +N   +PN L H T + AI S   +Q   D +C    R FLC++YAP+C        I+PCK +C + + AC P M  + + WPE + CD+ P     +CI
Sbjct:   28 PVRIPMCQSMLWNMTRMPNHLHHSTQENAILSIEQFQDLLDTQCSAVLRFFLCAMYAPICTIEFQTDPIKPCKAVCEAARDACRPVMRQYNHDWPESMACDELPVYERAVCI 139          
BLAST of secreted frizzled related protein 2 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 85.5001 bits (210), Expect = 5.309e-18
Identity = 40/104 (38.46%), Postives = 56/104 (53.85%), Query Frame = 3
Query:  525 PNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            P    LC +I YN+ I+PN L H   ++A      +     ++C  D + FLCS+YAPVC   E    I PC+ LC   ++ C   M  FG++WPE L C+ FP
Sbjct:   59 PISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLE--EAIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFP 160          
BLAST of secreted frizzled related protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007205.1 (pep scaffold:Pmarinus_7.0:GL478722:26071:28329:-1 gene:ENSPMAG00000006510.1 transcript:ENSPMAT00000007205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 8.232e-18
Identity = 38/114 (33.33%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  495 GYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            G  + RC   P    LC+ +GYN   +PN L HE+  +A      +       C    + FLC+++ P+C    P   I PC  +C +V++ C P ++ F Y WP  L CD+FP
Sbjct:   31 GVGARRCE--PIRAALCQGLGYNATRVPNPLGHESQADAELQLQTFTPLVQYGCSAQLQFFLCAVHFPLCAEAVP-EPIGPCAGMCRAVRRRCEPVLVDFQYAWPPALACDRFP 141          
BLAST of secreted frizzled related protein 2 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 84.7297 bits (208), Expect = 8.770e-18
Identity = 40/104 (38.46%), Postives = 57/104 (54.81%), Query Frame = 3
Query:  525 PNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFP 836
            P    LC +I YN+ I+PN L H   ++A      +     ++C  D + FLCS+YAPVC   E  + I PC+ LC   ++ C   M  FG++WPE L C+ FP
Sbjct:   15 PISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLE--KAIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFP 116          
BLAST of secreted frizzled related protein 2 vs. Ensembl Nematostella
Match: EDO32500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUU2])

HSP 1 Score: 88.5817 bits (218), Expect = 2.681e-21
Identity = 42/117 (35.90%), Postives = 65/117 (55.56%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCI 860
            RC E+     +CKN+GYN+ + PN L H+T +EA      +     + C     RFLC  YAP C     ++ + PC+ +C +V++ C   M  FG+ WPE L+C KFP++   +C+
Sbjct:    2 RCQEV--TIPMCKNLGYNQTLFPNSLGHKTQREAGLIVHQFVPLVKVNCSEMLSRFLCFTYAPFC--TVLMKPVLPCRSMCRAVRRGCETLMKRFGFDWPETLNCKKFPRESRSICV 114          
BLAST of secreted frizzled related protein 2 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 88.1965 bits (217), Expect = 1.397e-18
Identity = 39/110 (35.45%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQ 839
            +C EI     +C+ IGYN   +PN   H+T  EA      +    +I+C  D R FLCS+YAP+C  +   + + PC+ +C   +  C+P M  +G+ WPE + C+ FP+
Sbjct:   28 KCEEI--TIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHYD-KDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPE 134          
BLAST of secreted frizzled related protein 2 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 88.1965 bits (217), Expect = 1.439e-18
Identity = 44/117 (37.61%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCI 860
            RC   P    LC  + YN  I PN L+H T +EA      +     + C  D   FLCS+YAPVC   E    + PC+ LCL+V+  C   M  FG+ WP+ L C++FP+    +C+
Sbjct:   28 RCE--PVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVCTVLE--TPLPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDEICV 140          
BLAST of secreted frizzled related protein 2 vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 86.2705 bits (212), Expect = 6.450e-18
Identity = 45/125 (36.00%), Postives = 64/125 (51.20%), Query Frame = 3
Query:  486 LIYGYSSHRCHEIPNE------FGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQK 842
            ++YG  S    E+PN         LC  IGYN    PNFL  E+ +EA     +++    + C    R FLCS++ P+C     V  I  C+ +C S +  CSP M  FG+ WP+ L CD+ P+K
Sbjct:   19 MVYGQRS----EVPNSKCTPITIPLCMGIGYNATRFPNFLAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNV-PIYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLPKK 138          
BLAST of secreted frizzled related protein 2 vs. Ensembl Nematostella
Match: EDO46557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPS6])

HSP 1 Score: 82.8037 bits (203), Expect = 9.998e-18
Identity = 46/123 (37.40%), Postives = 63/123 (51.22%), Query Frame = 3
Query:  483 NLIYGYSSHR---CHEIPNEFGL-CKNI--GYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKF 833
            +L   YSS+R   C EI  E  L C N+  GYNK++LPN L H+ + E     + W       C    + FLCS++ PVCV  +    + PC  LC SV+ +C P M    Y WP +  C K+
Sbjct:   15 HLCESYSSYRAVKCFEISREKDLMCANLTRGYNKIMLPNALGHDNLAEVRTQLVPWAPLVGSGCSPHLKVFLCSVFMPVCV-QQISYPVPPCHSLCTSVRDSCEPVMKIHNYSWPAMFDCSKY 136          
BLAST of secreted frizzled related protein 2 vs. Ensembl Medaka
Match: sfrp1 (secreted frizzled related protein 1 [Source:NCBI gene;Acc:100049476])

HSP 1 Score: 142.124 bits (357), Expect = 4.530e-38
Identity = 84/245 (34.29%), Postives = 130/245 (53.06%), Query Frame = 3
Query:  495 GYS-SHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTE-GAXXXXXXXXXXKGC-NCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVM-----RLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            GY  + +C +IP++  LC  +GY +M+LPN L+HET+ E    +  W       CH DT+ FLC+L+APVC+     R I PC+ LC +V+  CSP M  FG+ WPE+L CDKFPQ   G+CI  T+  A  +   S     C  C +      + +N C+S   ++AKI  ++  N  + V+     R+ K+  + K +   L        +C C  ++N    + ++L+MG   D +F LT +
Sbjct:   41 GYGKAPQCVDIPDDLRLCHTVGYTQMLLPNLLEHETMAEVKQQASSWVPLVHKNCHKDTQVFLCALFAPVCME----RPIYPCRWLCETVRDGCSPIMEAFGFPWPEMLTCDKFPQD--GVCIAVTQPNATEATWPSGHSPACPPCDNEIKNDAMLENICASEFALKAKIKEVKQENMDRKVILQRRKRMVKQGNLKKRDLKKLTLYLKNGANCPCQQLEN---LENQYLIMGRKVDKQFLLTGI 276          
BLAST of secreted frizzled related protein 2 vs. Ensembl Medaka
Match: sfrp2 (secreted frizzled related protein 2 [Source:NCBI gene;Acc:101159245])

HSP 1 Score: 130.954 bits (328), Expect = 3.634e-34
Identity = 78/247 (31.58%), Postives = 127/247 (51.42%), Query Frame = 3
Query:  498 YSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVP--NEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAA-FINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKII-------KSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +  + C +IP    LC ++ Y +M LPN L HET+ E +  +  W      +CH DTR+FLCSL+APVC+   +EP   IQPC+ LC SVK+ C+P M  FG+ WP++L C++FP     LCI   +       +   P+ C+ C+        I D+ C +   ++ K+  +   N    ++    KSKII       + +   +P +    + C+C+ +++ N     +L+MG   +    +TSL
Sbjct:   30 FKRNSCKQIPASLPLCHDMEYTEMRLPNLLGHETMTEVLQQAASWIPLVQKQCHPDTRKFLCSLFAPVCLDDLDEP---IQPCRSLCESVKRGCAPVMSAFGFPWPKMLDCERFPPD-DDLCIPPVDSENLVPVTEEAPRVCDACKETDEKDNEIVDSLCKNDFAMKIKVKDISYINRDTKIVP-ETKSKIIYMVNGVTERDLRKMPLLLRDGMQCICEEMNDIN---TAYLVMGQKTESHLVITSL 268          
BLAST of secreted frizzled related protein 2 vs. Ensembl Medaka
Match: ENSORLT00000011365.2 (pep primary_assembly:ASM223467v1:7:14585088:14586426:-1 gene:ENSORLG00000009063.2 transcript:ENSORLT00000011365.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 5.684e-34
Identity = 75/242 (30.99%), Postives = 120/242 (49.59%), Query Frame = 3
Query:  501 SSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFIND---NYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNP-------TDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTL 1196
            +S RC  IP++  LC+NIGY+ M +PN L HE++ EA+  S  W      +CH D R FLCSL+AP+C+       I PC+ LC SV+ +C+P M  +GY WPEIL CD++P +   +CI     A  +         C    L   +   D   ++C S   ++ +++RL+    S     L  K  ++K  P       + +      + +C+ +M    + R G +L+ G V   +  +
Sbjct:    7 TSSRCVPIPSDMALCQNIGYDTMRMPNLLGHESLAEAVQQSTSWLPLLARECHPDARSFLCSLFAPICLDF-----ISPCRSLCESVRDSCAPIMSCYGYPWPEILRCDQYPAEHL-VCISSITNATVNTDGQRPQASCRDCELEKPSSPKDTLESFCKS-DFVKLRLTRLKYSPASLSQFSLTTKLDVLKQGPLVGGQIRSRIELWLERDATCVRNMT-RQHPRGGTFLVTGTVQGERLVV 240          
BLAST of secreted frizzled related protein 2 vs. Ensembl Medaka
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:101162946])

HSP 1 Score: 130.183 bits (326), Expect = 1.499e-33
Identity = 80/238 (33.61%), Postives = 122/238 (51.26%), Query Frame = 3
Query:  510 RCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSN---PTDLPFITSI---EVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSL 1205
            +C +IP++  LC N+GY KM LPN L HET+ E    +  W      +CH DT+ FLCSL+APVC+     R I PC+ LC +V+ +C+P M T+G+ WP++L CDKFP     LCI        +    V      C +      I ++YC+S  V++ KI  ++     + ++   KK K++K       DL  +T       +C C  +D+       +L+MG   D +  L S+
Sbjct:   60 QCVDIPSDLRLCHNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLD----RPIYPCRSLCEAVRNSCAPVMETYGFPWPDMLTCDKFPID-NDLCIPMQFAGNHATLPPVPKVCPPCDNELKTDNIMEHYCASDFVLKMKIKEVKKEKADRKLIAAQKKKKVLKQGVLRKKDLKKLTLYIKNGANCPCSQLDS---LGSHFLVMGRKVDQQLLLMSI 289          
BLAST of secreted frizzled related protein 2 vs. Ensembl Medaka
Match: ENSORLT00000013981.2 (secreted frizzled-related protein 2 [Source:NCBI gene;Acc:101171428])

HSP 1 Score: 120.939 bits (302), Expect = 4.142e-30
Identity = 66/193 (34.20%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  513 CHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGT---EG-AXXXXXXXXXXKG---CNCRSLY--SAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIK 1064
            C  IPN   LC  IGY +M +PN L H++++E    S  W       CH DT++FLCSL+APVC+P E    + PC+ LC +V+  C P M  FG+ WPE+ +C +FP     LCI  T   EG            KG   C+  SL     + I +N+C S   ++ ++  +      + ++  H +S+I++
Sbjct:   37 CKPIPNTLSLCHGIGYRRMWIPNLLGHDSLREVQQQSAAWLPLVSKLCHGDTKKFLCSLFAPVCLP-ELSGPVSPCRGLCEAVRDGCVPVMSAFGFPWPEMFNCSRFPHGTE-LCIPATGAREGRTEEEVRHEEALKGSIICDVCSLAVEGESEIQENFCHSPYALKMRLDSVSTVGRDRQLVP-HARSRILR 226          
BLAST of secreted frizzled related protein 2 vs. Planmine SMEST
Match: SMESG000050379.1 (SMESG000050379.1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 329/329 (100.00%), Postives = 329/329 (100.00%), Query Frame = 3
Query:  396 MFGILLILGICFSKASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRFRASDRKMSGLNINGGKMSQNKNRRIIKGNV 1382
            MFGILLILGICFSKASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKICGSRFRASDRKMSGLNINGGKMSQNKNRRIIKGNV
Sbjct:    1 MFGILLILGICFSKASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVPKGCNCRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIRKGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKICGSRFRASDRKMSGLNINGGKMSQNKNRRIIKGNV 329          
BLAST of secreted frizzled related protein 2 vs. Planmine SMEST
Match: SMESG000029446.1 (SMESG000029446.1)

HSP 1 Score: 177.948 bits (450), Expect = 2.996e-51
Identity = 99/278 (35.61%), Postives = 159/278 (57.19%), Query Frame = 3
Query:  468 VPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVN-DGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRF 1292
            + +W     GY+  +C++IP+ F LC N+GY  M+LPN++QHE+++EA   S  W    + +CH D ++F+CSLYAPVC+ N+  +K+ PC+ELC++VK++C P+M  +G+ WP I+ C KFPQ    LCI  T          V  K C+ C  + S   I + +C S  VIRAKI R+   +++   + L KKSK +K           + + C C  +       KGRW++M  ++ D K  +  ++KWK+K  +FK  ++ ++ F   +C S+ 
Sbjct:   20 IGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKT---------VVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKL 288          
BLAST of secreted frizzled related protein 2 vs. Planmine SMEST
Match: SMESG000075831.1 (SMESG000075831.1)

HSP 1 Score: 177.948 bits (450), Expect = 3.187e-51
Identity = 99/278 (35.61%), Postives = 159/278 (57.19%), Query Frame = 3
Query:  468 VPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVN-DGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRF 1292
            + +W     GY+  +C++IP+ F LC N+GY  M+LPN++QHE+++EA   S  W    + +CH D ++F+CSLYAPVC+ N+  +K+ PC+ELC++VK++C P+M  +G+ WP I+ C KFPQ    LCI  T          V  K C+ C  + S   I + +C S  VIRAKI R+   +++   + L KKSK +K           + + C C  +       KGRW++M  ++ D K  +  ++KWK+K  +FK  ++ ++ F   +C S+ 
Sbjct:   22 IGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKT---------VVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKL 290          
BLAST of secreted frizzled related protein 2 vs. Planmine SMEST
Match: SMESG000029446.1 (SMESG000029446.1)

HSP 1 Score: 177.948 bits (450), Expect = 3.187e-51
Identity = 99/278 (35.61%), Postives = 159/278 (57.19%), Query Frame = 3
Query:  468 VPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVN-DGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRF 1292
            + +W     GY+  +C++IP+ F LC N+GY  M+LPN++QHE+++EA   S  W    + +CH D ++F+CSLYAPVC+ N+  +K+ PC+ELC++VK++C P+M  +G+ WP I+ C KFPQ    LCI  T          V  K C+ C  + S   I + +C S  VIRAKI R+   +++   + L KKSK +K           + + C C  +       KGRW++M  ++ D K  +  ++KWK+K  +FK  ++ ++ F   +C S+ 
Sbjct:   22 IGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKT---------VVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKL 290          
BLAST of secreted frizzled related protein 2 vs. Planmine SMEST
Match: SMESG000075831.1 (SMESG000075831.1)

HSP 1 Score: 146.747 bits (369), Expect = 4.571e-40
Identity = 87/245 (35.51%), Postives = 139/245 (56.73%), Query Frame = 3
Query:  567 MILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAXXXXXXXXXXKGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVN-DGKFTLTSLTXXXXXXXXXXXXXXXLKKFEEKICGSRF 1292
            M+LPN++QHE+++EA   S  W    + +CH D ++F+CSLYAPVC+ N+  +K+ PC+ELC++VK++C P+M  +G+ WP I+ C KFPQ    LCI  T          V  K C+ C  + S   I + +C S  VIRAKI R+   +++   + L KKSK +K           + + C C  +       KGRW++M  ++ D K  +  ++KWK+K  +FK  ++ ++ F   +C S+ 
Sbjct:    1 MVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKT---------VVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKL 236          
The following BLAST results are available for this feature:
BLAST of secreted frizzled related protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SFRP53.183e-3432.35secreted frizzled related protein 5 [Source:HGNC S... [more]
SFRP17.573e-3137.79secreted frizzled related protein 1 [Source:HGNC S... [more]
SFRP28.280e-3131.30secreted frizzled related protein 2 [Source:HGNC S... [more]
FZD52.528e-1837.96frizzled class receptor 5 [Source:HGNC Symbol;Acc:... [more]
FZD15.475e-1837.17frizzled class receptor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp-16.026e-3635.90Secreted Frizzled-Related Protein [Source:UniProt... [more]
sfrp-16.505e-3136.28Secreted Frizzled-Related Protein [Source:UniProt... [more]
mom-52.283e-2440.28pep chromosome:WBcel235:I:9965580:9970037:1 gene:W... [more]
mom-52.350e-2440.28pep chromosome:WBcel235:I:9965580:9969413:1 gene:W... [more]
mig-15.387e-2035.59Transmembrane receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz46.746e-1935.14gene:FBgn0027342 transcript:FBtr0071017[more]
fz46.746e-1935.14gene:FBgn0027342 transcript:FBtr0071018[more]
fz7.976e-1742.20gene:FBgn0001085 transcript:FBtr0075743[more]
fz8.005e-1742.20gene:FBgn0001085 transcript:FBtr0330102[more]
fz21.567e-1536.36gene:FBgn0016797 transcript:FBtr0330195[more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp52.852e-3533.61secreted frizzled-related protein 5 [Source:ZFIN;A... [more]
sfrp21.059e-3333.47secreted frizzled-related protein 2 [Source:ZFIN;A... [more]
sfrp21.059e-3333.47secreted frizzled-related protein 2 [Source:ZFIN;A... [more]
sfrp1b1.624e-3330.80secreted frizzled-related protein 1b [Source:ZFIN;... [more]
sfrp1b1.624e-3330.80secreted frizzled-related protein 1b [Source:ZFIN;... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frzb22.019e-3732.60frizzled related protein 2 [Source:NCBI gene;Acc:5... [more]
sfrp51.669e-3431.62secreted frizzled-related protein 5 [Source:NCBI g... [more]
sfrp27.022e-3231.71secreted frizzled-related protein 2 [Source:NCBI g... [more]
sfrp17.784e-3036.84Xenopus tropicalis secreted frizzled-related prote... [more]
sfrpx1.374e-2932.62secreted frizzled-related protein [Source:NCBI gen... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sfrp52.061e-3634.87secreted frizzled-related sequence protein 5 [Sour... [more]
Sfrp12.669e-3132.91secreted frizzled-related protein 1 [Source:MGI Sy... [more]
Sfrp23.738e-3131.30secreted frizzled-related protein 2 [Source:MGI Sy... [more]
Frzb2.049e-1825.83frizzled-related protein [Source:MGI Symbol;Acc:MG... [more]
Fzd52.710e-1837.96frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XSC1|SFRP5_BOVIN6.161e-3934.45Secreted frizzled-related protein 5 OS=Bos taurus ... [more]
sp|Q9WU66|SFRP5_MOUSE4.669e-3534.45Secreted frizzled-related protein 5 OS=Mus musculu... [more]
sp|Q5T4F7|SFRP5_HUMAN1.528e-3332.35Secreted frizzled-related protein 5 OS=Homo sapien... [more]
sp|Q9IA96|SFRP2_CHICK3.811e-3333.33Secreted frizzled-related protein 2 OS=Gallus gall... [more]
sp|Q9DEQ4|SFRP1_CHICK6.553e-3131.67Secreted frizzled-related protein 1 OS=Gallus gall... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3UZJ40.000e+099.68Secreted frizzled related protein 2 (Fragment) OS=... [more]
F8WQS97.215e-16575.77Secreted frizzled-related protein B OS=Dugesia jap... [more]
D3J1K39.465e-5138.08Secreted frizzled-related protein (Fragment) OS=Sc... [more]
T1E1031.342e-4938.46SFRP-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
D0VYP54.396e-4936.10Secreted frizzled-related protein A (Fragment) OS=... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp51.381e-3533.89secreted frizzled related protein 5 [Source:NCBI g... [more]
ENSAMXT00000011888.22.172e-3530.45secreted frizzled-related protein 2-like [Source:N... [more]
sfrp25.942e-3533.33secreted frizzled related protein 2 [Source:NCBI g... [more]
sfrp57.719e-3533.05secreted frizzled related protein 5 [Source:NCBI g... [more]
sfrp1a3.246e-3232.91secreted frizzled related protein 1 [Source:NCBI g... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011338.14.788e-2042.35pep scaffold:Pmarinus_7.0:GL496444:1147:1527:1 gen... [more]
frzb1.111e-1934.82frizzled related protein [Source:ZFIN;Acc:ZDB-GENE... [more]
fzd7a5.309e-1838.46frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000007205.18.232e-1833.33pep scaffold:Pmarinus_7.0:GL478722:26071:28329:-1 ... [more]
fzd28.770e-1838.46frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO325002.681e-2135.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429321.397e-1835.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357511.439e-1837.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385676.450e-1836.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465579.998e-1837.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp14.530e-3834.29secreted frizzled related protein 1 [Source:NCBI g... [more]
sfrp23.634e-3431.58secreted frizzled related protein 2 [Source:NCBI g... [more]
ENSORLT00000011365.25.684e-3430.99pep primary_assembly:ASM223467v1:7:14585088:145864... [more]
sfrp51.499e-3333.61secreted frizzled related protein 5 [Source:NCBI g... [more]
ENSORLT00000013981.24.142e-3034.20secreted frizzled-related protein 2 [Source:NCBI g... [more]
back to top
BLAST of secreted frizzled related protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050379.10.000e+0100.00SMESG000050379.1[more]
SMESG000029446.12.996e-5135.61SMESG000029446.1[more]
SMESG000075831.13.187e-5135.61SMESG000075831.1[more]
SMESG000029446.13.187e-5135.61SMESG000029446.1[more]
SMESG000075831.14.571e-4035.51SMESG000075831.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025497
GenBankADO51625.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025497 ID=SMED30025497|Name=secreted frizzled related protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1507bp
ATTTATGAATTAAGTAATTTTTTGAAAACAGATACACTTCGACAGTAATT
ATCTTTAACATTTTATCGGTGTTTGTTGATCGGAATATAATTTTTTGACA
CTGGTAGGTATGATGAAAAGTAGCCCGGAGTTCCTTGACATTTATTCATA
AAACATGATTTTTCCCGCCTTATATTTTCAATACTTAACAGTCTCTCTGT
GATTAGATAATTTTTGTAGGTTCAGACATACCAGCAACTGTCTGTATTGT
GTGTGTGTGTGTCTATGAGGTTGTAACACGCTAATGAAATGGAGGTTAAG
TGCAATCAGCTTAAATTTGTGATTTCTTTTTATTTGTATCATATTTTTCT
TTGAAATAAAAAAAAATTACTCAAAAGTTGAAAATCAAAGAAAAAATGTT
TGGAATTTTATTAATTCTTGGTATATGTTTTTCCAAAGCATCAAACAATC
GGTTATCAGTTAATGAGGTACCGGAATGGAACAACCTTATCTATGGATAC
AGTTCTCATCGTTGCCATGAAATTCCGAATGAATTTGGTCTTTGTAAAAA
TATCGGCTACAACAAAATGATTTTGCCGAATTTCCTCCAACATGAAACCG
TACAGGAAGCGATCAATTCGTCAATTGATTGGCAGAAGTTTGCCGACATT
AAATGCCACAACGATACAAGAAGATTCCTATGTTCTCTCTATGCTCCGGT
TTGTGTTCCTAATGAACCTGTGCGAAAAATCCAACCGTGCAAAGAGCTTT
GTCTCAGTGTAAAAAAGGCCTGCTCACCGAATATGTTAACATTCGGTTAT
AAATGGCCTGAAATTTTACATTGTGATAAATTCCCCCAGAAATTCGCCGG
TCTTTGCATTAGAGGGACAGAAGGAGCAGTCCCATCTGGCAGTTCGAGCG
TTGTGCCAAAAGGGTGCAATTGTAGATCTCTCTATAGTGCAGCTTTCATC
AATGACAATTATTGTTCCTCGACAACCGTAATTCGCGCAAAAATATCTAG
ATTACGAATCCGTAATAATTCCAAATACGTGATGCGTCTTCATAAAAAGA
GTAAAATCATAAAATCCAATCCAACAGATTTACCATTCATAACTTCTATT
GAAGTTTCTTGTCTCTGTGACATGATAGACAATGACAACATTCGCAAAGG
CCGTTGGCTACTGATGGGTGTCGTTAATGATGGGAAATTTACACTGACTT
CCTTGACTAAATGGAAAAAGAAAAATAAAGATTTCAAAAAAGTCATTCGC
AAATTGAAAAAGTTTGAAGAAAAAATCTGCGGCAGCAGATTTAGGGCTTC
TGACAGAAAGATGTCTGGATTGAACATCAATGGAGGGAAAATGAGCCAGA
ATAAAAACAGGCGAATAATTAAAGGAAATGTTTAAATAAATAAAAGCCAT
GAATTTATTCATAACTATCTGTTTCATGCTCAAATATTATTCTTTGTGGT
AGTTTGATTATTTTTTATATTTCTCTAACTGTTATGTGTGTAATAATACA
AGATTCG
back to top

protein sequence of SMED30025497-orf-1

>SMED30025497-orf-1 ID=SMED30025497-orf-1|Name=SMED30025497-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=330bp
MFGILLILGICFSKASNNRLSVNEVPEWNNLIYGYSSHRCHEIPNEFGLC
KNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYA
PVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKF
AGLCIRGTEGAVPSGSSSVVPKGCNCRSLYSAAFINDNYCSSTTVIRAKI
SRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMIDNDNIR
KGRWLLMGVVNDGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKICGSRFR
ASDRKMSGLNINGGKMSQNKNRRIIKGNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000140anterior region of the whole animal
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR026559SFRP1
IPR015526Frizzled/SFRP
IPR020067Frizzled_dom
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 39..159
e-value: 4.7E-41
score: 152.4
IPR020067Frizzled domainPFAMPF01392Fzcoord: 40..149
e-value: 1.2E-27
score: 96.7
IPR020067Frizzled domainPROSITEPS50038FZcoord: 35..157
score: 22.173
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldGENE3DG3DSA:2.40.50.120coord: 174..296
e-value: 5.0E-5
score: 25.3
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 174..289
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 36..160
e-value: 9.9E-36
score: 124.7
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 39..155
IPR026559Secreted frizzled-related protein 1PANTHERPTHR11309:SF87SECRETED FRIZZLED-RELATED PROTEIN 1coord: 36..291
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 36..291
IPR001134Netrin domainPROSITEPS50189NTRcoord: 174..295
score: 13.542
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.651