Biorientation of chromosomes in cell division protein 1-like protein

Overview
NameBiorientation of chromosomes in cell division protein 1-like protein
Smed IDSMED30025479
Length (bp)2477
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Biorientation of chromosomes in cell division protein 1-like protein (SMED30025479) t-SNE clustered cells

Violin plots show distribution of expression levels for Biorientation of chromosomes in cell division protein 1-like protein (SMED30025479) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Biorientation of chromosomes in cell division protein 1-like protein (SMED30025479) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Biorientation of chromosomes in cell division protein 1-like protein (SMED30025479) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025479

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025479SMESG000026008.1 SmedASXL_015765SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025479SMESG000026008.1 SmedASXL_015765SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30025479SMESG000026008.1 dd_Smed_v4_7187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Human
Match: BOD1 (biorientation of chromosomes in cell division 1 [Source:HGNC Symbol;Acc:HGNC:25114])

HSP 1 Score: 75.485 bits (184), Expect = 5.941e-15
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD+ R+  L+++  K  YQNL  KV+N  +  L+   W P++ K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    E+L
Sbjct:   43 SLPPGDPQLIAL-IVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFL 157          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Human
Match: BOD1L1 (biorientation of chromosomes in cell division 1 like 1 [Source:HGNC Symbol;Acc:HGNC:31792])

HSP 1 Score: 73.9442 bits (180), Expect = 1.105e-12
Identity = 36/107 (33.64%), Postives = 57/107 (53.27%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            +V  ++  LK+QG FD  R+  L+++  K  YQNL  +V+N     L T  W P + K+QLR  +R  +  +    + I R+I Q V+ KI    +P +E    E+L
Sbjct:   53 LVAMIVNHLKSQGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVANHLATHTWSPHLNKNQLRNNIRQQVLKSGMLESGIDRIISQVVDPKINHTFRPQVEKAVHEFL 159          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Human
Match: BOD1 (biorientation of chromosomes in cell division 1 [Source:HGNC Symbol;Acc:HGNC:25114])

HSP 1 Score: 59.6918 bits (143), Expect = 5.026e-10
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLR 293
            SL   D  +I   ++E+LK++G FD+ R+  L+++  K  YQNL  KV+N  +  L+   W P++ K+QLR  LR
Sbjct:   43 SLPPGDPQLIAL-IVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLR 116          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Human
Match: BOD1L2 (biorientation of chromosomes in cell division 1 like 2 [Source:HGNC Symbol;Acc:HGNC:28505])

HSP 1 Score: 59.3066 bits (142), Expect = 1.532e-9
Identity = 33/116 (28.45%), Postives = 58/116 (50.00%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++ +LK++G FD+ R+   +++  K  YQNL  K +N  +  L+   W P    +QL + LR  +  + +    + R+  Q V+ K+    +P IE    E+L
Sbjct:   30 SLPPGDPQLIAI-IVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFL 144          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Fly
Match: BOD1 (gene:FBgn0039560 transcript:FBtr0301143)

HSP 1 Score: 75.485 bits (184), Expect = 1.688e-13
Identity = 38/109 (34.86%), Postives = 63/109 (57.80%), Query Frame = 3
Query:   99 VEELLEKLKAQGCFDAKR-KQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEV 422
            ++ L+ ++K+QG FD  R    L+++  K  YQN+ T+VE     FL   +W P   K QLRE+LR H+  +D  +  + ++++Q VN K+    +P IES   +YL +
Sbjct:    5 IKTLIAEVKSQGVFDEFRFNCCLADVDTKPAYQNVRTQVETAVNDFLAKQQWTPETNKVQLRERLRKHLMDSDVLDKGVDQIVDQVVNPKVATIFEPKIESIVYKYLGI 113          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Fly
Match: BOD1 (gene:FBgn0039560 transcript:FBtr0085252)

HSP 1 Score: 75.485 bits (184), Expect = 1.688e-13
Identity = 38/109 (34.86%), Postives = 63/109 (57.80%), Query Frame = 3
Query:   99 VEELLEKLKAQGCFDAKR-KQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEV 422
            ++ L+ ++K+QG FD  R    L+++  K  YQN+ T+VE     FL   +W P   K QLRE+LR H+  +D  +  + ++++Q VN K+    +P IES   +YL +
Sbjct:    5 IKTLIAEVKSQGVFDEFRFNCCLADVDTKPAYQNVRTQVETAVNDFLAKQQWTPETNKVQLRERLRKHLMDSDVLDKGVDQIVDQVVNPKVATIFEPKIESIVYKYLGI 113          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Fly
Match: BOD1 (gene:FBgn0039560 transcript:FBtr0335013)

HSP 1 Score: 75.485 bits (184), Expect = 1.786e-13
Identity = 38/109 (34.86%), Postives = 63/109 (57.80%), Query Frame = 3
Query:   99 VEELLEKLKAQGCFDAKR-KQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEV 422
            ++ L+ ++K+QG FD  R    L+++  K  YQN+ T+VE     FL   +W P   K QLRE+LR H+  +D  +  + ++++Q VN K+    +P IES   +YL +
Sbjct:    5 IKTLIAEVKSQGVFDEFRFNCCLADVDTKPAYQNVRTQVETAVNDFLAKQQWTPETNKVQLRERLRKHLMDSDVLDKGVDQIVDQVVNPKVATIFEPKIESIVYKYLGI 113          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Fly
Match: BOD1 (gene:FBgn0039560 transcript:FBtr0085253)

HSP 1 Score: 75.0998 bits (183), Expect = 1.895e-13
Identity = 38/109 (34.86%), Postives = 63/109 (57.80%), Query Frame = 3
Query:   99 VEELLEKLKAQGCFDAKR-KQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEV 422
            ++ L+ ++K+QG FD  R    L+++  K  YQN+ T+VE     FL   +W P   K QLRE+LR H+  +D  +  + ++++Q VN K+    +P IES   +YL +
Sbjct:    5 IKTLIAEVKSQGVFDEFRFNCCLADVDTKPAYQNVRTQVETAVNDFLAKQQWTPETNKVQLRERLRKHLMDSDVLDKGVDQIVDQVVNPKVATIFEPKIESIVYKYLGI 113          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Fly
Match: BOD1 (gene:FBgn0039560 transcript:FBtr0335012)

HSP 1 Score: 75.0998 bits (183), Expect = 1.895e-13
Identity = 38/109 (34.86%), Postives = 63/109 (57.80%), Query Frame = 3
Query:   99 VEELLEKLKAQGCFDAKR-KQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEV 422
            ++ L+ ++K+QG FD  R    L+++  K  YQN+ T+VE     FL   +W P   K QLRE+LR H+  +D  +  + ++++Q VN K+    +P IES   +YL +
Sbjct:    5 IKTLIAEVKSQGVFDEFRFNCCLADVDTKPAYQNVRTQVETAVNDFLAKQQWTPETNKVQLRERLRKHLMDSDVLDKGVDQIVDQVVNPKVATIFEPKIESIVYKYLGI 113          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Zebrafish
Match: bod1 (biorientation of chromosomes in cell division 1 [Source:ZFIN;Acc:ZDB-GENE-060810-163])

HSP 1 Score: 70.8626 bits (172), Expect = 8.251e-14
Identity = 34/109 (31.19%), Postives = 60/109 (55.05%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEV 422
            ++  ++E LK +G FD  R+  L+++  K  YQNL  +V    +  L T  W P++ K+Q+R  LR  +  +    + + R+I Q V  K+Q   +P+IE+   E+L+ 
Sbjct:   21 LIALIVEHLKNKGHFDEFRRDCLADVDTKPGYQNLQQRVGTYVSTHLSTQEWNPTINKNQVRNALRQSVIQSGMLESGVDRIISQVVEPKLQHIFRPIIENAIHEFLDA 129          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Zebrafish
Match: bod1 (biorientation of chromosomes in cell division 1 [Source:ZFIN;Acc:ZDB-GENE-060810-163])

HSP 1 Score: 70.8626 bits (172), Expect = 8.251e-14
Identity = 34/109 (31.19%), Postives = 60/109 (55.05%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEV 422
            ++  ++E LK +G FD  R+  L+++  K  YQNL  +V    +  L T  W P++ K+Q+R  LR  +  +    + + R+I Q V  K+Q   +P+IE+   E+L+ 
Sbjct:   21 LIALIVEHLKNKGHFDEFRRDCLADVDTKPGYQNLQQRVGTYVSTHLSTQEWNPTINKNQVRNALRQSVIQSGMLESGVDRIISQVVEPKLQHIFRPIIENAIHEFLDA 129          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Zebrafish
Match: bod1l1 (biorientation of chromosomes in cell division 1-like 1 [Source:ZFIN;Acc:ZDB-GENE-111028-1])

HSP 1 Score: 60.4622 bits (145), Expect = 8.629e-9
Identity = 28/100 (28.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIE 395
            +V  ++  LK +G FD  R+  L+++  K  Y +L  +V+N  +  L    W P + K+QLR  +R  +Q +      + R++ Q V+ K+    +P +E
Sbjct:   11 LVSVIVNHLKTEGLFDQFRRDCLADVDTKPAYLHLRQRVDNFVSNHLANHTWSPQLNKNQLRNSIRQLVQQSGMLEQGVDRIVAQVVDPKVHHTFRPQVE 110          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Xenopus
Match: rab12 (RAB12, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-492791])

HSP 1 Score: 70.8626 bits (172), Expect = 1.554e-13
Identity = 39/116 (33.62%), Postives = 61/116 (52.59%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD  R+  L+++  K  YQNL  KV+N  +  L+   W   + K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    EYL
Sbjct:   23 SLAPGDSQLIAL-IVEQLKSRGQFDGFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNADMNKNQLRNGLRQSVIQSGMLEAGVDRIISQVVDPKLNHIFRPQIEKAIQEYL 137          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Xenopus
Match: BOD1L1 (biorientation of chromosomes in cell division 1-like 1 [Source:NCBI gene;Acc:100127583])

HSP 1 Score: 76.2554 bits (186), Expect = 1.842e-13
Identity = 42/130 (32.31%), Postives = 70/130 (53.85%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMMTQIYEKLRSES 485
            +V +++  LK+QG FD  R+  L+++  K  YQNL  +V+N     L +  W P + K+QLR  +R  +  +    + I R+I Q V+ KI    +P +E    EYL +   +   N+ T+  E+ RSE+
Sbjct:   11 LVSQIVNHLKSQGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVASHLASHTWSPHLNKNQLRNNIRQQVLKSGMLESGIDRIISQVVDPKINHLFRPQVEKVVKEYLAMMNNKEDGNVNTEQNEE-RSEA 139          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Xenopus
Match: BOD1L1 (biorientation of chromosomes in cell division 1-like 1 [Source:NCBI gene;Acc:100127583])

HSP 1 Score: 76.2554 bits (186), Expect = 1.907e-13
Identity = 42/130 (32.31%), Postives = 70/130 (53.85%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMMTQIYEKLRSES 485
            +V +++  LK+QG FD  R+  L+++  K  YQNL  +V+N     L +  W P + K+QLR  +R  +  +    + I R+I Q V+ KI    +P +E    EYL +   +   N+ T+  E+ RSE+
Sbjct:   11 LVSQIVNHLKSQGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVASHLASHTWSPHLNKNQLRNNIRQQVLKSGMLESGIDRIISQVVDPKINHLFRPQVEKVVKEYLAMMNNKEDGNVNTEQNEE-RSEA 139          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Mouse
Match: Bod1 (biorientation of chromosomes in cell division 1 [Source:MGI Symbol;Acc:MGI:1916806])

HSP 1 Score: 75.0998 bits (183), Expect = 3.870e-15
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD+ R+  L+++  K  YQNL  KV+N  +  L+   W P++ K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    E+L
Sbjct:   31 SLPPGDPQLIAL-IVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPAMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFL 145          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Mouse
Match: Bod1 (biorientation of chromosomes in cell division 1 [Source:MGI Symbol;Acc:MGI:1916806])

HSP 1 Score: 75.0998 bits (183), Expect = 3.870e-15
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD+ R+  L+++  K  YQNL  KV+N  +  L+   W P++ K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    E+L
Sbjct:   31 SLPPGDPQLIAL-IVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPAMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFL 145          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Mouse
Match: Bod1l (biorientation of chromosomes in cell division 1-like [Source:MGI Symbol;Acc:MGI:2444804])

HSP 1 Score: 72.7886 bits (177), Expect = 1.960e-12
Identity = 36/107 (33.64%), Postives = 57/107 (53.27%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            +V  ++  LK+QG FD  R+  L+++  K  YQNL  +V+N     L T  W P + K+QLR  +R  +  +    + I R+I Q V+ KI    +P +E    E+L
Sbjct:   51 LVAMIVNHLKSQGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVANHLATHTWSPHLNKNQLRNNIRQQVLKSGMLESGIDRIISQVVDPKINHTFRPQVEKAVHEFL 157          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Mouse
Match: Bod1l (biorientation of chromosomes in cell division 1-like [Source:MGI Symbol;Acc:MGI:2444804])

HSP 1 Score: 72.7886 bits (177), Expect = 2.025e-12
Identity = 36/107 (33.64%), Postives = 57/107 (53.27%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            +V  ++  LK+QG FD  R+  L+++  K  YQNL  +V+N     L T  W P + K+QLR  +R  +  +    + I R+I Q V+ KI    +P +E    E+L
Sbjct:   51 LVAMIVNHLKSQGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVANHLATHTWSPHLNKNQLRNNIRQQVLKSGMLESGIDRIISQVVDPKINHTFRPQVEKAVHEFL 157          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. UniProt/SwissProt
Match: sp|Q6AYJ2|BOD1_RAT (Biorientation of chromosomes in cell division protein 1 OS=Rattus norvegicus OX=10116 GN=Bod1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.507e-14
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD+ R+  L+++  K  YQNL  KV+N  +  L+   W P++ K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    E+L
Sbjct:   31 SLPPGDPQLIAL-IVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPAMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFL 145          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. UniProt/SwissProt
Match: sp|Q5SQY2|BOD1_MOUSE (Biorientation of chromosomes in cell division protein 1 OS=Mus musculus OX=10090 GN=Bod1 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.707e-14
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD+ R+  L+++  K  YQNL  KV+N  +  L+   W P++ K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    E+L
Sbjct:   31 SLPPGDPQLIAL-IVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPAMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFL 145          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. UniProt/SwissProt
Match: sp|Q96IK1|BOD1_HUMAN (Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.853e-14
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD+ R+  L+++  K  YQNL  KV+N  +  L+   W P++ K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    E+L
Sbjct:   43 SLPPGDPQLIAL-IVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFL 157          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. UniProt/SwissProt
Match: sp|Q6DFL2|BOD1_XENLA (Biorientation of chromosomes in cell division protein 1 OS=Xenopus laevis OX=8355 GN=bod1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.660e-13
Identity = 39/116 (33.62%), Postives = 61/116 (52.59%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD  R+  L+++  K  YQNL  KV+N  +  L+   W   + K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    EYL
Sbjct:   23 SLAPGDSQLIAL-IVEQLKSRGQFDGFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNADMNKNQLRNGLRQSVIQSGMLEAGVDRIISQVVDPKLNHIFRPQIEKAIHEYL 137          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. UniProt/SwissProt
Match: sp|Q68FB1|BOD1_XENTR (Biorientation of chromosomes in cell division protein 1 OS=Xenopus tropicalis OX=8364 GN=bod1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.232e-13
Identity = 39/116 (33.62%), Postives = 61/116 (52.59%), Query Frame = 3
Query:   69 SLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            SL   D  +I   ++E+LK++G FD  R+  L+++  K  YQNL  KV+N  +  L+   W   + K+QLR  LR  +  +      + R+I Q V+ K+    +P IE    EYL
Sbjct:   23 SLAPGDSQLIAL-IVEQLKSRGQFDGFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNADMNKNQLRNGLRQSVIQSGMLEAGVDRIISQVVDPKLNHIFRPQIEKAIQEYL 137          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. TrEMBL
Match: T1FXM7 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20213575 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.342e-20
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 3
Query:   99 VEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERW 437
            V E++ KLK QG FD  RK+ L+++  K  YQNL T+V    +++L TV+W   + K+QLRE LR H+         I R+++Q V  KI   LKP I+   CE+L +NY+ W
Sbjct:    7 VIEVVNKLKKQGLFDQFRKECLADVDTKPAYQNLQTRVTGEVSRYLSTVKWKQDINKNQLREHLRRHLNELPMLTAGIERVVDQVVKPKIFQSLKPQIDKVVCEHLNINYDAW 119          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. TrEMBL
Match: A0A1S3HWA3 (biorientation of chromosomes in cell division protein 1-like 1 OS=Lingula unguis OX=7574 GN=LOC106158726 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.111e-18
Identity = 47/110 (42.73%), Postives = 70/110 (63.64%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVN 425
            I EE+++KLK+QG FD  RK+ L+++  K  YQNL  +V+N  T FL   +W P + K+QLREQLR  I  +    + + R+IEQ VN KI+   KP ++   CE+L ++
Sbjct:   15 ITEEIVKKLKSQGIFDQFRKECLADVDTKPAYQNLRQRVDNYVTNFLSKQKWSPDLNKNQLREQLRRQINQSGMLASGVERIIEQVVNPKIETVFKPEVDKVVCEFLGID 124          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. TrEMBL
Match: A0A2R2MRJ6 (biorientation of chromosomes in cell division protein 1-like 1 OS=Lingula unguis OX=7574 GN=LOC112042385 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.130e-18
Identity = 47/110 (42.73%), Postives = 70/110 (63.64%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVN 425
            I EE+++KLK+QG FD  RK+ L+++  K  YQNL  +V+N  T FL   +W P + K+QLREQLR  I  +    + + R+IEQ VN KI+   KP ++   CE+L ++
Sbjct:   15 ITEEIVKKLKSQGIFDQFRKECLADVDTKPAYQNLRQRVDNYVTNFLSKQKWSPDLNKNQLREQLRRQINQSGMLASGVERIIEQVVNPKIETVFKPEVDKVVCEFLGID 124          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. TrEMBL
Match: A0A0L8HJ56 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013392mg PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.537e-18
Identity = 46/119 (38.66%), Postives = 79/119 (66.39%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMM 452
            +V+E+++KLK+QG FD  RK+ + ++  K  YQNL  ++E   ++FLE   W P++ K+QLR+QLR HI  +    + + R+IEQ VN KI   +KP I+   CE+LE++++  ++ ++
Sbjct:   15 LVQEIIDKLKSQGLFDQFRKEGMGDVDTKPAYQNLRQRMEGHVSRFLEKQVWSPNLNKNQLRDQLRKHINQSGILASGVERIIEQVVNPKIFLVIKPRIDEVICEHLEIDFKERQEKLL 133          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. TrEMBL
Match: A0A0L8HJ60 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013392mg PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.721e-18
Identity = 46/119 (38.66%), Postives = 79/119 (66.39%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMM 452
            +V+E+++KLK+QG FD  RK+ + ++  K  YQNL  ++E   ++FLE   W P++ K+QLR+QLR HI  +    + + R+IEQ VN KI   +KP I+   CE+LE++++  ++ ++
Sbjct:   15 LVQEIIDKLKSQGLFDQFRKEGMGDVDTKPAYQNLRQRMEGHVSRFLEKQVWSPNLNKNQLRDQLRKHINQSGILASGVERIIEQVVNPKIFLVIKPRIDEVICEHLEIDFKERQEKLL 133          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Cavefish
Match: bod1 (biorientation of chromosomes in cell division 1 [Source:ZFIN;Acc:ZDB-GENE-060810-163])

HSP 1 Score: 75.8702 bits (185), Expect = 1.033e-15
Identity = 36/108 (33.33%), Postives = 60/108 (55.56%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLE 419
            ++  ++E LK +G FD  R+  L+++  K  YQNL  KV+N     L +  W PS+ K+Q+R  LR  +  +    + + R+I Q V+ K+    +P IE+   E+LE
Sbjct:   18 LIALIVEHLKNRGLFDEFRRDCLADVDTKPAYQNLRQKVDNFVATHLSSQEWSPSINKNQVRNGLRQSVVQSGMLESGVDRIITQVVDPKLNHIFRPHIETAIHEFLE 125          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000033971.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001246.1:99026:102977:1 gene:ENSAMXG00000043479.1 transcript:ENSAMXT00000033971.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 2.332e-11
Identity = 30/107 (28.04%), Postives = 54/107 (50.47%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            +V  ++  LK QG FD  R+  L+++  K  Y +L  +V+N  +  L    W P + K+QLR  +R  +  +      + R++ Q V+ KI    +P +E    ++L
Sbjct:   17 MVAMIVNHLKTQGLFDQFRRDCLADVDTKPAYLHLRQRVDNFVSNHLSNHTWSPQLNKNQLRNSIRQLVLQSGMLEQGVDRIVAQVVDPKIHHIFRPQVERVVRQFL 123          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Sea Lamprey
Match: bod1 (biorientation of chromosomes in cell division 1 [Source:ZFIN;Acc:ZDB-GENE-060810-163])

HSP 1 Score: 52.373 bits (124), Expect = 1.288e-8
Identity = 27/84 (32.14%), Postives = 45/84 (53.57%), Query Frame = 3
Query:  180 KSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYE 431
            +  YQNL  ++++  +  L    W P + K+Q+R  LR  I  +    + ++R++ Q VN KI    +P IE+   EYL V+ E
Sbjct:    1 QPAYQNLRERMDSFVSNHLGHQNWTPDINKNQMRNGLRQTILQSGMLESAVNRIVHQVVNPKISTFFRPQIENVVHEYLGVDEE 84          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Medaka
Match: bod1 (biorientation of chromosomes in cell division protein 1 [Source:NCBI gene;Acc:101155373])

HSP 1 Score: 73.1738 bits (178), Expect = 1.141e-14
Identity = 36/107 (33.64%), Postives = 59/107 (55.14%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            ++  ++E LK +G FD  R+  L+++  K  YQNL  KV+N  T  L T  W PS  K+Q+R  LR  +  +    + + R+I Q V+ K+    +P IE+   ++L
Sbjct:   20 LIGMIVEHLKNRGLFDEFRRDCLADVDTKPAYQNLRQKVDNFVTSHLSTQEWNPSNNKNQMRNGLRQSVVQSGMLESGVDRIITQVVDPKMNHIFRPQIETAIHDFL 126          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Medaka
Match: bod1 (biorientation of chromosomes in cell division protein 1 [Source:NCBI gene;Acc:101155373])

HSP 1 Score: 73.1738 bits (178), Expect = 1.295e-14
Identity = 36/107 (33.64%), Postives = 59/107 (55.14%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            ++  ++E LK +G FD  R+  L+++  K  YQNL  KV+N  T  L T  W PS  K+Q+R  LR  +  +    + + R+I Q V+ K+    +P IE+   ++L
Sbjct:   27 LIGMIVEHLKNRGLFDEFRRDCLADVDTKPAYQNLRQKVDNFVTSHLSTQEWNPSNNKNQMRNGLRQSVVQSGMLESGVDRIITQVVDPKMNHIFRPQIETAIHDFL 133          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000000722.2 (pep primary_assembly:ASM223467v1:10:6657496:6658174:1 gene:ENSORLG00000000588.2 transcript:ENSORLT00000000722.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.622e-12
Identity = 32/107 (29.91%), Postives = 55/107 (51.40%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            +V  ++  LK QG FD  R++ L+++  K  Y NL  +V+N  +  L    W P + K+QLR  +R  +  +      + R++ Q V+ KI    +P +E    E+L
Sbjct:   11 LVSMIVNHLKTQGLFDQFRRECLADVDTKPAYLNLKQRVDNFVSNHLSNHTWSPHLNKNQLRNNIRQLVLQSGMLEQGVDRIVAQVVDPKINHIFRPQVERVVREFL 117          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000040911.1 (pep primary_assembly:ASM223467v1:10:6657496:6660207:1 gene:ENSORLG00000000588.2 transcript:ENSORLT00000040911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.717e-12
Identity = 32/107 (29.91%), Postives = 55/107 (51.40%), Query Frame = 3
Query:   96 IVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYL 416
            +V  ++  LK QG FD  R++ L+++  K  Y NL  +V+N  +  L    W P + K+QLR  +R  +  +      + R++ Q V+ KI    +P +E    E+L
Sbjct:   11 LVSMIVNHLKTQGLFDQFRRECLADVDTKPAYLNLKQRVDNFVSNHLSNHTWSPHLNKNQLRNNIRQLVLQSGMLEQGVDRIVAQVVDPKINHIFRPQVERVVREFL 117          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Planmine SMEST
Match: SMESG000026008.1 (SMESG000026008.1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 474/479 (98.96%), Postives = 477/479 (99.58%), Query Frame = 3
Query:  954 TEDYVPKFYDGSVNLEKVKIGLLKTPDKPIEKSMEKIFSPKKMIWGQLVLAIQDIXXXXXXXXXXRHEHERKRYSRKSPLPPRNHSAIRDGSTKAYDEPPRHLEIRQSDYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXENPIRSHQKSNDYTDVSSESFNELELKDNQVAVNNANNTKKQTRXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXQKTPNLTRXXXXXXXXXXXXXXXXXXXXQRNQSQNNFGNYDKSYRVFGHSQSEDKDMDISVGTQSPSVDTKWDSPVAEINLDLVDSVQLRKDQIKARLEEIDAKRSLLQKQQMLKKPERVXXXXXXXXXXXXXXXXXXXXXXXXQGVTGTDKELIDLNPKPMVSPQNNQIPENETSVQNVPLETISTEDLEKTKHDXXXXXXXXXXXXRAGSIKRENNLCCEEIQTFTVNDEIEIKKDSSVKEEVQEMVDIDHSNTLSSPNNE 2390
            TEDYVPKFYDG+VNLEKVKIGLLKTPDKPIEKSMEKIFSPKKMIWGQLVLAIQDISDDSAASDSDRHEHERKRYSRKSPL PRNHSAIRDGSTKAYDEPPRH EIRQSDYNRQRRRSRPRETPRQRDPRRDADR+TSRPENPIRSHQKSNDYTDVSSESFNELELKDNQVAVNNANNTKKQTRSSSSEDSHSSNSNDQTLKIIRKINKNKTKLRKKQKTPNLTRSSSSFSSSESSSGSSSSDVSQRNQSQNNFGNYDKSYRVFGHSQSEDKDMDISVGTQSPSVDTKWDSPVAEINLDLVDSVQLRKDQIKARLEEIDAKRSLLQKQQMLKKPERVSASNSSSSSSSDSSSENSSSSHSSQGVTGTDKELIDLNPKPMVSPQNNQIPENETSVQNVPLETISTEDLEKTKHDSEPEEGELSSESRAGSIKRENNLCCEEIQTFTVNDEIEIKKDSSVKEEVQEMVDIDHSNT+SSPNNE
Sbjct:  305 TEDYVPKFYDGNVNLEKVKIGLLKTPDKPIEKSMEKIFSPKKMIWGQLVLAIQDISDDSAASDSDRHEHERKRYSRKSPLAPRNHSAIRDGSTKAYDEPPRHSEIRQSDYNRQRRRSRPRETPRQRDPRRDADRKTSRPENPIRSHQKSNDYTDVSSESFNELELKDNQVAVNNANNTKKQTRSSSSEDSHSSNSNDQTLKIIRKINKNKTKLRKKQKTPNLTRSSSSFSSSESSSGSSSSDVSQRNQSQNNFGNYDKSYRVFGHSQSEDKDMDISVGTQSPSVDTKWDSPVAEINLDLVDSVQLRKDQIKARLEEIDAKRSLLQKQQMLKKPERVSASNSSSSSSSDSSSENSSSSHSSQGVTGTDKELIDLNPKPMVSPQNNQIPENETSVQNVPLETISTEDLEKTKHDSEPEEGELSSESRAGSIKRENNLCCEEIQTFTVNDEIEIKKDSSVKEEVQEMVDIDHSNTVSSPNNE 783          

HSP 2 Score: 457.988 bits (1177), Expect = 2.520e-149
Identity = 239/239 (100.00%), Postives = 239/239 (100.00%), Query Frame = 3
Query:   42 MSHKDYPDYSLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMMTQIYEKLRSESPQEKYSQKEMPSTSIKSEIKQEMSYSQFKSDTESNDAEVTQSNESNIKLSSIKLEQHLXXXXXXXXXXXXXXXAPAMKFSQKSPHSNFVTS 758
            MSHKDYPDYSLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMMTQIYEKLRSESPQEKYSQKEMPSTSIKSEIKQEMSYSQFKSDTESNDAEVTQSNESNIKLSSIKLEQHLNQSNVVNSSNFSTTVAPAMKFSQKSPHSNFVTS
Sbjct:    1 MSHKDYPDYSLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTYQNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRLIEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMMTQIYEKLRSESPQEKYSQKEMPSTSIKSEIKQEMSYSQFKSDTESNDAEVTQSNESNIKLSSIKLEQHLNQSNVVNSSNFSTTVAPAMKFSQKSPHSNFVTS 239          
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Planmine SMEST
Match: SMESG000026008.1 (SMESG000026008.1)

HSP 1 Score: 330.487 bits (846), Expect = 3.293e-108
Identity = 206/207 (99.52%), Postives = 207/207 (100.00%), Query Frame = 3
Query: 1770 MDISVGTQSPSVDTKWDSPVAEINLDLVDSVQLRKDQIKARLEEIDAKRSLLQKQQMLKKPERVXXXXXXXXXXXXXXXXXXXXXXXXQGVTGTDKELIDLNPKPMVSPQNNQIPENETSVQNVPLETISTEDLEKTKHDXXXXXXXXXXXXRAGSIKRENNLCCEEIQTFTVNDEIEIKKDSSVKEEVQEMVDIDHSNTLSSPNNE 2390
            MDISVGTQSPSVDTKWDSPVAEINLDLVDSVQLRKDQIKARLEEIDAKRSLLQKQQMLKKPERVSASNSSSSSSSDSSSENSSSSHSSQGVTGTDKELIDLNPKPMVSPQNNQIPENETSVQNVPLETISTEDLEKTKHDSEPEEGELSSESRAGSIKRENNLCCEEIQTFTVNDEIEIKKDSSVKEEVQEMVDIDHSNT+SSPNNE
Sbjct:    1 MDISVGTQSPSVDTKWDSPVAEINLDLVDSVQLRKDQIKARLEEIDAKRSLLQKQQMLKKPERVSASNSSSSSSSDSSSENSSSSHSSQGVTGTDKELIDLNPKPMVSPQNNQIPENETSVQNVPLETISTEDLEKTKHDSEPEEGELSSESRAGSIKRENNLCCEEIQTFTVNDEIEIKKDSSVKEEVQEMVDIDHSNTVSSPNNE 207          
The following BLAST results are available for this feature:
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
BOD15.941e-1533.62biorientation of chromosomes in cell division 1 [S... [more]
BOD1L11.105e-1233.64biorientation of chromosomes in cell division 1 li... [more]
BOD15.026e-1038.67biorientation of chromosomes in cell division 1 [S... [more]
BOD1L21.532e-928.45biorientation of chromosomes in cell division 1 li... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BOD11.688e-1334.86gene:FBgn0039560 transcript:FBtr0301143[more]
BOD11.688e-1334.86gene:FBgn0039560 transcript:FBtr0085252[more]
BOD11.786e-1334.86gene:FBgn0039560 transcript:FBtr0335013[more]
BOD11.895e-1334.86gene:FBgn0039560 transcript:FBtr0085253[more]
BOD11.895e-1334.86gene:FBgn0039560 transcript:FBtr0335012[more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bod18.251e-1431.19biorientation of chromosomes in cell division 1 [S... [more]
bod18.251e-1431.19biorientation of chromosomes in cell division 1 [S... [more]
bod1l18.629e-928.00biorientation of chromosomes in cell division 1-li... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rab121.554e-1333.62RAB12, member RAS oncogene family [Source:Xenbase;... [more]
BOD1L11.842e-1332.31biorientation of chromosomes in cell division 1-li... [more]
BOD1L11.907e-1332.31biorientation of chromosomes in cell division 1-li... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Bod13.870e-1533.62biorientation of chromosomes in cell division 1 [S... [more]
Bod13.870e-1533.62biorientation of chromosomes in cell division 1 [S... [more]
Bod1l1.960e-1233.64biorientation of chromosomes in cell division 1-li... [more]
Bod1l2.025e-1233.64biorientation of chromosomes in cell division 1-li... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYJ2|BOD1_RAT2.507e-1433.62Biorientation of chromosomes in cell division prot... [more]
sp|Q5SQY2|BOD1_MOUSE2.707e-1433.62Biorientation of chromosomes in cell division prot... [more]
sp|Q96IK1|BOD1_HUMAN2.853e-1433.62Biorientation of chromosomes in cell division prot... [more]
sp|Q6DFL2|BOD1_XENLA5.660e-1333.62Biorientation of chromosomes in cell division prot... [more]
sp|Q68FB1|BOD1_XENTR8.232e-1333.62Biorientation of chromosomes in cell division prot... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FXM71.342e-2041.59Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A1S3HWA31.111e-1842.73biorientation of chromosomes in cell division prot... [more]
A0A2R2MRJ61.130e-1842.73biorientation of chromosomes in cell division prot... [more]
A0A0L8HJ561.537e-1838.66Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8HJ601.721e-1838.66Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bod11.033e-1533.33biorientation of chromosomes in cell division 1 [S... [more]
ENSAMXT00000033971.12.332e-1128.04pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bod11.288e-832.14biorientation of chromosomes in cell division 1 [S... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bod11.141e-1433.64biorientation of chromosomes in cell division prot... [more]
bod11.295e-1433.64biorientation of chromosomes in cell division prot... [more]
ENSORLT00000000722.21.622e-1229.91pep primary_assembly:ASM223467v1:10:6657496:665817... [more]
ENSORLT00000040911.12.717e-1229.91pep primary_assembly:ASM223467v1:10:6657496:666020... [more]
back to top
BLAST of Biorientation of chromosomes in cell division protein 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000026008.12.520e-14998.96SMESG000026008.1[more]
SMESG000026008.13.293e-10899.52SMESG000026008.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025479 ID=SMED30025479|Name=Biorientation of chromosomes in cell division protein 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2477bp
TTCAAATTTTAAATAATCTATTTCTAATCATTATTTAATTAATGTCTCAT
AAAGATTACCCAGATTATTCTTTAAAATCATATGACAAAAGTATTATAGT
TGAAGAACTGTTAGAAAAATTAAAGGCACAAGGTTGCTTTGATGCTAAAC
GTAAACAGTTTTTATCTGAAATTACAAATAAATCAACTTATCAAAATTTG
CATACAAAAGTTGAAAATTTAGCAACTAAGTTCTTAGAAACGGTAAGATG
GCCTCCATCAGTTCAAAAACATCAATTAAGAGAACAATTAAGACTACATA
TACAATCTACTGATCAATTCAATAATTGTATCAGCCGATTAATTGAACAA
GAAGTTAATTGTAAAATTCAAGGTGAATTAAAACCAATGATCGAAAGTAA
AGCTTGCGAATATTTAGAGGTTAATTATGAAAGATGGAAACAAAATATGA
TGACTCAAATATATGAGAAATTACGTTCAGAATCACCACAAGAGAAATAT
TCTCAAAAGGAAATGCCATCAACATCTATTAAATCAGAAATTAAACAAGA
AATGAGTTATAGTCAATTTAAATCGGATACCGAATCAAATGATGCCGAGG
TTACACAAAGTAATGAATCAAATATCAAACTGTCCAGTATAAAACTTGAA
CAACATTTGAATCAATCCAACGTTGTAAATTCCTCCAATTTCAGTACCAC
AGTAGCTCCAGCAATGAAATTCTCTCAAAAATCTCCACACAGTAATTTCG
TTACATCGTTACCACCAACCATGCCTCCTCCCATTGGTTTGTTGCCACCA
CCACATAGAATTCCTCCAAACAGTTTGTTCCAACCCCTTCCGCCGCCTCC
ACCACCGATATTTTTGCCCATCGAAAGATTCCCACCTCCTCCACCACCAG
AAAATAAATCATTACCTCCTCCACCACCACCGGAAAACGGACCAAATACT
CCAACAGAAGACTATGTTCCGAAATTCTATGACGGAAGCGTAAACTTGGA
AAAAGTTAAAATTGGACTTTTAAAGACACCCGATAAACCAATTGAAAAAA
GTATGGAAAAAATATTCTCACCGAAAAAAATGATCTGGGGTCAATTAGTT
TTGGCAATTCAAGATATATCTGATGATTCAGCGGCTTCAGATTCTGACCG
ACATGAGCACGAACGTAAACGTTACTCGCGTAAATCTCCTTTGCCTCCGC
GAAATCACAGTGCAATTCGAGATGGATCAACAAAAGCATACGACGAACCG
CCTCGCCATTTGGAAATTCGACAATCAGACTACAATCGCCAGAGAAGGCG
GTCACGACCACGAGAAACTCCTCGACAAAGAGATCCTCGAAGAGATGCTG
ATCGAAGAACTAGTCGACCGGAAAACCCGATTCGTTCACATCAGAAATCC
AATGACTATACCGATGTCTCATCGGAGAGCTTCAATGAATTGGAACTTAA
AGATAACCAGGTTGCTGTGAACAATGCCAATAATACCAAGAAACAAACGC
GATCAAGCAGCAGTGAAGATAGCCACAGTTCTAATAGCAATGATCAAACG
TTGAAAATTATTCGAAAAATCAATAAAAATAAGACGAAATTGCGCAAAAA
ACAAAAAACTCCGAACCTGACTCGTTCATCATCATCATTTTCATCCTCAG
AATCGAGTTCTGGATCTTCTTCATCAGATGTGTCTCAGAGAAATCAGTCA
CAGAATAACTTTGGAAATTACGATAAAAGTTATCGAGTATTCGGTCATTC
ACAGTCTGAAGATAAAGATATGGATATATCTGTTGGTACTCAATCACCAT
CGGTTGATACAAAATGGGACAGTCCAGTCGCTGAAATTAATTTAGATTTG
GTCGATTCAGTTCAATTAAGGAAAGATCAGATCAAAGCTCGTTTGGAAGA
AATCGATGCCAAAAGGAGCTTGTTACAAAAACAACAAATGCTGAAAAAAC
CCGAAAGAGTTTCAGCATCGAATTCATCGTCCTCGTCCAGTAGTGATAGC
TCAAGCGAGAACAGTTCTAGTAGTCATAGTAGTCAAGGTGTCACTGGTAC
AGATAAAGAGCTAATAGATTTGAATCCCAAACCTATGGTGAGTCCGCAAA
ATAATCAGATTCCAGAAAATGAGACATCAGTTCAGAATGTACCGCTCGAA
ACAATTTCGACAGAGGATCTAGAAAAGACAAAACATGATAGTGAACCAGA
GGAAGGTGAGTTATCATCCGAGAGCAGAGCTGGATCTATTAAGCGGGAAA
ACAATTTATGTTGTGAAGAAATTCAAACTTTTACGGTCAATGATGAAATA
GAAATAAAAAAAGATTCATCGGTAAAGGAAGAAGTTCAAGAAATGGTAGA
TATAGATCATAGTAATACCCTTTCTTCTCCAAATAATGAATAATTACAAG
CTGCTAATAATTCTCGAGATCCAAATTCTTGTTGTGTGTGTAATTCTATT
ATTATTATTGTTTTTATTTTTTGCAAC
back to top

protein sequence of SMED30025479-orf-1

>SMED30025479-orf-1 ID=SMED30025479-orf-1|Name=SMED30025479-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=784bp
MSHKDYPDYSLKSYDKSIIVEELLEKLKAQGCFDAKRKQFLSEITNKSTY
QNLHTKVENLATKFLETVRWPPSVQKHQLREQLRLHIQSTDQFNNCISRL
IEQEVNCKIQGELKPMIESKACEYLEVNYERWKQNMMTQIYEKLRSESPQ
EKYSQKEMPSTSIKSEIKQEMSYSQFKSDTESNDAEVTQSNESNIKLSSI
KLEQHLNQSNVVNSSNFSTTVAPAMKFSQKSPHSNFVTSLPPTMPPPIGL
LPPPHRIPPNSLFQPLPPPPPPIFLPIERFPPPPPPENKSLPPPPPPENG
PNTPTEDYVPKFYDGSVNLEKVKIGLLKTPDKPIEKSMEKIFSPKKMIWG
QLVLAIQDISDDSAASDSDRHEHERKRYSRKSPLPPRNHSAIRDGSTKAY
DEPPRHLEIRQSDYNRQRRRSRPRETPRQRDPRRDADRRTSRPENPIRSH
QKSNDYTDVSSESFNELELKDNQVAVNNANNTKKQTRSSSSEDSHSSNSN
DQTLKIIRKINKNKTKLRKKQKTPNLTRSSSSFSSSESSSGSSSSDVSQR
NQSQNNFGNYDKSYRVFGHSQSEDKDMDISVGTQSPSVDTKWDSPVAEIN
LDLVDSVQLRKDQIKARLEEIDAKRSLLQKQQMLKKPERVSASNSSSSSS
SDSSSENSSSSHSSQGVTGTDKELIDLNPKPMVSPQNNQIPENETSVQNV
PLETISTEDLEKTKHDSEPEEGELSSESRAGSIKRENNLCCEEIQTFTVN
DEIEIKKDSSVKEEVQEMVDIDHSNTLSSPNNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: biological process
TermDefinition
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 447..474
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..146
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 237..294
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 473..574
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..366
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..224
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 524..549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 367..404
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..33
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 479..514
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 550..573
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..155
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 295..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 204..431