Ncstrn_small domain-containing protein

Overview
NameNcstrn_small domain-containing protein
Smed IDSMED30025476
Length (bp)2066
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ncstrn_small domain-containing protein (SMED30025476) t-SNE clustered cells

Violin plots show distribution of expression levels for Ncstrn_small domain-containing protein (SMED30025476) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ncstrn_small domain-containing protein (SMED30025476) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ncstrn_small domain-containing protein (SMED30025476) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025476

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30025476SMESG000035369.1 Contig34538newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025476SMESG000035369.1 Contig34538uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Human
Match: NCSTN (nicastrin [Source:HGNC Symbol;Acc:HGNC:17091])

HSP 1 Score: 68.1662 bits (165), Expect = 3.130e-11
Identity = 70/344 (20.35%), Postives = 145/344 (42.15%), Query Frame = 2
Query:  119 IPNTAISYCSGRMNYTNRFGCKSTMR--EGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVV--LRPSIGEIFKVKYFKENSIFA-------------KNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSK----CSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDV----KMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEI 1075
            IP    + C   +N T++ GC+S++    GV+ ++    +LQ ++        ++++ +  FT   + K+   +S I G+ V   +PS    F       N  F              + I ++++ N      G  Y  ++ PI LL   N    + I  CY+  N   +  +     C++++ +H    ++   C+  R +++  F  +  ++ C  ++  N++     +     +     V+V  T +DS S F   A GA     +    +  A  L+K+   +   +N  V+  F   ++FD +G+ R  YD++      G   +  EN+   V++ ++
Sbjct:   42 IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGN------GLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCM-RRSSIQSTFSIN-PEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRN--VMFVFFQGETFDYIGSSRMVYDME-----KGKFPVQLENVDSFVELGQV 368          
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0301865)

HSP 1 Score: 77.0258 bits (188), Expect = 3.118e-14
Identity = 81/342 (23.68%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  143 CSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIY-----------FSNVSNDENRFK-GFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKG----SKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVK---------MYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYD---LKFNRVSPGGVNISNENIALVVKISEID 1078
            C  R+N T++ GC ST     GV+ LI    +L+ ++ +        +IP  +FT   LM++       I +V+L   I    ++K F  + +   N Y            SN + + N +  G  +  +  PI  ++  +      +  C++ FN  N +     S C++ + +    ++  + C+  R+T  +F        +C  + G+N+Y T    K         ++  +  I++   +D+T++FD   +GAM      +V  H+A +LK+ L     + + +VL    + +S+D +G+ RF YD   L+F   S G   I+ +NI  ++ I  +D
Sbjct:   40 CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMRLKEAGPKNISVVLL---INRTNQMKQFS-HELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIA--DLDQVTKLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCM--RRT--NFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGLGAMDSLMGFAVFTHVAYLLKQLLPPQSKDLH-NVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLD 370          
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0084705)

HSP 1 Score: 77.0258 bits (188), Expect = 3.118e-14
Identity = 81/342 (23.68%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  143 CSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIY-----------FSNVSNDENRFK-GFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKG----SKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVK---------MYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYD---LKFNRVSPGGVNISNENIALVVKISEID 1078
            C  R+N T++ GC ST     GV+ LI    +L+ ++ +        +IP  +FT   LM++       I +V+L   I    ++K F  + +   N Y            SN + + N +  G  +  +  PI  ++  +      +  C++ FN  N +     S C++ + +    ++  + C+  R+T  +F        +C  + G+N+Y T    K         ++  +  I++   +D+T++FD   +GAM      +V  H+A +LK+ L     + + +VL    + +S+D +G+ RF YD   L+F   S G   I+ +NI  ++ I  +D
Sbjct:   40 CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMRLKEAGPKNISVVLL---INRTNQMKQFS-HELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIA--DLDQVTKLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCM--RRT--NFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGLGAMDSLMGFAVFTHVAYLLKQLLPPQSKDLH-NVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLD 370          
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0334570)

HSP 1 Score: 77.0258 bits (188), Expect = 3.243e-14
Identity = 81/342 (23.68%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  143 CSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIY-----------FSNVSNDENRFK-GFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKG----SKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVK---------MYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYD---LKFNRVSPGGVNISNENIALVVKISEID 1078
            C  R+N T++ GC ST     GV+ LI    +L+ ++ +        +IP  +FT   LM++       I +V+L   I    ++K F  + +   N Y            SN + + N +  G  +  +  PI  ++  +      +  C++ FN  N +     S C++ + +    ++  + C+  R+T  +F        +C  + G+N+Y T    K         ++  +  I++   +D+T++FD   +GAM      +V  H+A +LK+ L     + + +VL    + +S+D +G+ RF YD   L+F   S G   I+ +NI  ++ I  +D
Sbjct:   40 CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMRLKEAGPKNISVVLL---INRTNQMKQFS-HELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIA--DLDQVTKLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCM--RRT--NFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGLGAMDSLMGFAVFTHVAYLLKQLLPPQSKDLH-NVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLD 370          
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0306087)

HSP 1 Score: 77.0258 bits (188), Expect = 3.245e-14
Identity = 81/342 (23.68%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  143 CSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIY-----------FSNVSNDENRFK-GFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKG----SKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVK---------MYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYD---LKFNRVSPGGVNISNENIALVVKISEID 1078
            C  R+N T++ GC ST     GV+ LI    +L+ ++ +        +IP  +FT   LM++       I +V+L   I    ++K F  + +   N Y            SN + + N +  G  +  +  PI  ++  +      +  C++ FN  N +     S C++ + +    ++  + C+  R+T  +F        +C  + G+N+Y T    K         ++  +  I++   +D+T++FD   +GAM      +V  H+A +LK+ L     + + +VL    + +S+D +G+ RF YD   L+F   S G   I+ +NI  ++ I  +D
Sbjct:   40 CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMRLKEAGPKNISVVLL---INRTNQMKQFS-HELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIA--DLDQVTKLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCM--RRT--NFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGLGAMDSLMGFAVFTHVAYLLKQLLPPQSKDLH-NVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLD 370          
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Mouse
Match: Ncstn (nicastrin [Source:MGI Symbol;Acc:MGI:1891700])

HSP 1 Score: 62.003 bits (149), Expect = 1.902e-9
Identity = 72/339 (21.24%), Postives = 142/339 (41.89%), Query Frame = 2
Query:  119 IPNTAISYCSGRMNYTNRFGCKSTMR--EGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVV--LRPSIGEIFKVKYFKENSIFA--KNIYFSNVSNDENRF-----KGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSK-----CSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITF----NDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEI 1075
            IP    + C   +N T++ GC+S++    GV+ ++    +L+ ++        ++++   +FT   + K+   +S I G+ V   +P+    F       N  F    N Y    ++ +         G  Y  ++ PI LL   N    + I  CY+  N +   GS      C++++ +H    ++   C+  R  ++  F  +  ++ C  ++  N++         V +     V+V  T +DS S F   A GA     +    +  A  L K+   +   +N  V+  F   ++FD +G+ R  YD++      G   +  ENI   V++ ++
Sbjct:   41 IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTRDVMEKLKGTTSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHN-LGQNGSAPSFPLCAMQLFSHMHAVISTATCM-RRSFIQSTFSIN-PEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLSRN--VMFVFFQGETFDYIGSSRMVYDMEN-----GKFPVRLENIDSFVELGQV 367          
BLAST of Ncstrn_small domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VC27|NICA_DROME (Nicastrin OS=Drosophila melanogaster OX=7227 GN=Nct PE=1 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 3.126e-13
Identity = 81/342 (23.68%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  143 CSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIY-----------FSNVSNDENRFK-GFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKG----SKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVK---------MYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYD---LKFNRVSPGGVNISNENIALVVKISEID 1078
            C  R+N T++ GC ST     GV+ LI    +L+ ++ +        +IP  +FT   LM++       I +V+L   I    ++K F  + +   N Y            SN + + N +  G  +  +  PI  ++  +      +  C++ FN  N +     S C++ + +    ++  + C+  R+T  +F        +C  + G+N+Y T    K         ++  +  I++   +D+T++FD   +GAM      +V  H+A +LK+ L     + + +VL    + +S+D +G+ RF YD   L+F   S G   I+ +NI  ++ I  +D
Sbjct:   40 CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMRLKEAGPKNISVVLL---INRTNQMKQFS-HELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIA--DLDQVTKLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCM--RRT--NFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGLGAMDSLMGFAVFTHVAYLLKQLLPPQSKDLH-NVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLD 370          
BLAST of Ncstrn_small domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92542|NICA_HUMAN (Nicastrin OS=Homo sapiens OX=9606 GN=NCSTN PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.503e-10
Identity = 70/344 (20.35%), Postives = 145/344 (42.15%), Query Frame = 2
Query:  119 IPNTAISYCSGRMNYTNRFGCKSTMR--EGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVV--LRPSIGEIFKVKYFKENSIFA-------------KNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSK----CSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDV----KMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEI 1075
            IP    + C   +N T++ GC+S++    GV+ ++    +LQ ++        ++++ +  FT   + K+   +S I G+ V   +PS    F       N  F              + I ++++ N      G  Y  ++ PI LL   N    + I  CY+  N   +  +     C++++ +H    ++   C+  R +++  F  +  ++ C  ++  N++     +     +     V+V  T +DS S F   A GA     +    +  A  L+K+   +   +N  V+  F   ++FD +G+ R  YD++      G   +  EN+   V++ ++
Sbjct:   42 IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGN------GLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCM-RRSSIQSTFSIN-PEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRN--VMFVFFQGETFDYIGSSRMVYDME-----KGKFPVQLENVDSFVELGQV 368          
BLAST of Ncstrn_small domain-containing protein vs. UniProt/SwissProt
Match: sp|P57716|NICA_MOUSE (Nicastrin OS=Mus musculus OX=10090 GN=Ncstn PE=1 SV=3)

HSP 1 Score: 62.003 bits (149), Expect = 1.331e-8
Identity = 72/339 (21.24%), Postives = 142/339 (41.89%), Query Frame = 2
Query:  119 IPNTAISYCSGRMNYTNRFGCKSTMR--EGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVV--LRPSIGEIFKVKYFKENSIFA--KNIYFSNVSNDENRF-----KGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSK-----CSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITF----NDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEI 1075
            IP    + C   +N T++ GC+S++    GV+ ++    +L+ ++        ++++   +FT   + K+   +S I G+ V   +P+    F       N  F    N Y    ++ +         G  Y  ++ PI LL   N    + I  CY+  N +   GS      C++++ +H    ++   C+  R  ++  F  +  ++ C  ++  N++         V +     V+V  T +DS S F   A GA     +    +  A  L K+   +   +N  V+  F   ++FD +G+ R  YD++      G   +  ENI   V++ ++
Sbjct:   41 IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTRDVMEKLKGTTSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHN-LGQNGSAPSFPLCAMQLFSHMHAVISTATCM-RRSFIQSTFSIN-PEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLSRN--VMFVFFQGETFDYIGSSRMVYDMEN-----GKFPVRLENIDSFVELGQV 367          
BLAST of Ncstrn_small domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CGU6|NICA_RAT (Nicastrin OS=Rattus norvegicus OX=10116 GN=Ncstn PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.475e-8
Identity = 71/339 (20.94%), Postives = 143/339 (42.18%), Query Frame = 2
Query:  119 IPNTAISYCSGRMNYTNRFGCKSTMR--EGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVV--LRPSIGEIFKVKYFKENSIFA--KNIYFSNVSNDENRF-----KGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSK-----CSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDV----KMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEI 1075
            IP    + C   +N T++ GC+S++    GV+ ++    +L+ ++        ++++   +FT   + K+  ++S I G+ V   +P+    F       N  F    N Y    ++ +         G  Y  ++ PI LL   N    + I  CY+  N +   GS      C++++ +H    ++   C+  R  ++  F  +  ++ C  ++  N++     +     +     V+V  T +DS S F   A GA     +    +  A  L K+   +   +N  V+  F   ++FD +G+ R  YD++      G   +  ENI   V++ ++
Sbjct:   41 IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEDDLKWVLTDGPNPPYMVLLEGKLFTRDIMEKLKGETSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYDDFSFPIFLLEDEN--ETKVIKQCYQDHN-LGQNGSAPSFPLCAMQLFSHMHAVISTATCM-RRSFIQSTFSIN-PEIVCDPLSDYNVWSMLKPINTSGGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLPRN--VMFVFFQGETFDYIGSSRMVYDMEN-----GKFPVRLENIDSFVELGQV 367          
BLAST of Ncstrn_small domain-containing protein vs. TrEMBL
Match: A0A4Z2D016 (Nicastrin isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005923 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.882e-32
Identity = 151/683 (22.11%), Postives = 303/683 (44.36%), Query Frame = 2
Query:  119 IPNTAISYCSGRMNYTNRFGCKS--TMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKY-FKENSIFAKNIYFS-NVSNDEN-------RFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFND--------------VKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATIL--KKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSP-GGVNISNENIALVVKISEI--DTQYNTL--LVIDESNETYSISQQFKTNMV-------KFGEKNNLNIRTYNLYD------HDNKNIWQNFSIPFLHIKSSIISTNLFSN----SFLD--FQVSNNS---IYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLV-NTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRN---IKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLI 1993
            IP +  S+C+ R+N T + GC S  T   GV   +  + ++   +H++T    +I++    FT+  LM+  M + ++ G++V   S  ++    + F E+S     +Y + NV+   +           + Y  W  P+VL++  N   + ++ +C+   N      ++CSI I N    + + + C   R+ L       S  +FC ++ G NI ++ +D                  ++ S + + T MDS S+F+     +  + P+++V++ +A  L  +K+ ++S  EK  D+   F+DN+++D +G+ R +YDL    ++   G  +   N+  V+++ E+    ++N L    +   +++Y++++ F  N+        K  +K +L   +  L +         + + Q  + P  H+  S      F N    SF+D  +  ++N    I LL+++ TL+  L   +       + + S+ +G  Y  P DI+ C V N  C+L    + P +  Y Q    P   Q+Y      +  G+++ ++S  V  ILL+ L  E      C  I       Y+    +    C+ T + I + F         +  +EK   R P WM++     + V  +   +  +  +S+ +G  +  + F+ ++++   I   I
Sbjct:   34 IPLSYTSFCTRRLNLTGQVGCSSSTTGNSGVALFMNESEDIMQTLHSDTSTPFVILVSVKHFTNASLMRFFMSTRNVKGLIVF--SNEDVNDDNHEFSESSKCPNGLYSAYNVTKQCDLDIQWNPAGTDYSYIDWPFPVVLVADVNNTIRASMYECFSVLNKEPYDDTRCSIEIYNPMSAAGSSETCF-RRQYLMTLHISESSGIFCDELTGLNIILSASDSVNHSWNNIAVNIGTSGRSENSSVFILTRMDSRSIFERSGFSSQGVLPSVAVLISVAAHLMRQKAFKDSHLEK--DLFFGFLDNEAYDFMGSYRLSYDLGSGNIARYTGRPVMWNNVHAVIELGEVGLSQKHNNLHTFYMLTDSKSYNLTRDFTDNIFHQLTAASKASQKVDLQRPSDKLQELPLPPTSSMQTLLQTSARPLSHVVLSDHDRPPFRNKHFESFMDTKWPPTDNPTADITLLDLANTLADALHRIV------SANHTSIPSGITYPKPGDIMECFVTNLGCDLFKMYLSPVDYRYLQMLNTPVPMQTY------LPLGRHEIKVSHLV-SILLMGLTGERTLTPTCPPINERGPYTYWMGHFNSSEQCYYTRMDIMSRF--------LLMENEKL--RAPAWMRSREQSGRFVRWYRGASPTVDGSSIALGVFLMTITFLIALYIKETITKTI 688          
BLAST of Ncstrn_small domain-containing protein vs. TrEMBL
Match: A0A4S2LPW9 (Ncstrn_small domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005975 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.319e-28
Identity = 148/607 (24.38%), Postives = 262/607 (43.16%), Query Frame = 2
Query:  137 SYCSGRMNYTNRFGCKSTMRE--GVVKLIRTT------LNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMD-SSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYF-------SNVSNDENRFKGFYYS-QWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFND---------------VKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMAT-ILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLK-FNRVSPGGVNISNENIALVVKISEIDTQYNTLL-----VIDES------NETYSISQQFKTNMVKFGE----KNNLNIRTYNLYDHDN-KNIWQNFSIPFLHI-KSSIISTNLFS---NSFLDF---QVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLV-NTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIEC----EDIRNIKYFATEIHDQLMCFRTNIQIETDF 1771
            S+CS R+N T + GC S +R   GV   +         LN + IV T      ++V+   +F +  LM  V   S   +G+VVL     E      F E+      +Y         +V+   N     Y S +W  P+VL+  ++   +  +  CY+ FN      ++C I I N      +   C+  R++L     F S  V+C ++NG NI ++  +               V+  ++ S +V+ T +DS S+F+  A  +    P ISV+V +A  ++++   + L  K  D+  AF+DN++FD +G+ R AYDL+  N  +  G  +  E+I   +++ E+       L     ++DES       +T  + +Q      +FG+    +   ++    L    + +++  +   P  HI  +      L+     SFLDF     S +   LL ++ TL+  L         +   ++ +     + TP D++ C V N TC+LL   + P +  + QS   P  +QSY      +   K++ ++S  ++ +LL+ L  E     +C    E I    Y     +    C+RT + +   F
Sbjct:   83 SHCSRRLNITGQIGCSSRLRSSSGVALFVEHADEVIDFLNAKNIVPT------VLVMQYSLFLNSSLMNDVRSYSERAVGLVVLSQQTSENKHSLPFSESDECPNALYSHYGAERQCSVTPAWNPHGAAYSSIEWPFPVVLIQTADASIESELFRCYKQFNANPVDDTRCLIEIRNVMSAISSSALCI-RRESLMGLPIFESPIVYCDELNGVNILLSATNTTASIRKNSPNRSVSVQERSRNSSVVVLTRLDSRSMFERSAFASQGALPGISVLVSIAAHLIRQPAFQQLQLKR-DLFFAFLDNEAFDFMGSGRLAYDLRERNLAAYTGFPLGWEHIHSFIELGELGLPAKNPLPTYYTLVDESIYEQTKEDTDELREQLAAANERFGQISISRAPDSVARLPLPPMASLQSLLSSAPHPLPHILLADHAGPPLWDKHFESFLDFVWPPDSGSDQVLLVLANTLADALHRL------VVKDSLPMPASISHPTPGDLMLCFVNNVTCDLLRTFLSPGDLRFLQSLKTPIPAQSY------LPLDKHELKISH-IISVLLMGLTGERTATRDCPAGAESIGPYVYLMGYYNGTEQCYRTLLDLAMRF 668          
BLAST of Ncstrn_small domain-containing protein vs. TrEMBL
Match: A0A074ZCI8 (Ncstrn_small domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_07458 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.113e-27
Identity = 139/560 (24.82%), Postives = 248/560 (44.29%), Query Frame = 2
Query:  137 SYCSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMD-SSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYF-------SNVSNDENRFKGFYYS-QWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFND---------------VKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMAT-ILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLK-FNRVSPGGVNISNENIALVVKISEIDTQYNTLL-----VIDES--NETYSISQQFKTNMV----KFGE----KNNLNIRTYNLYDHDN-KNIWQNFSIPFLHI-KSSIISTNLFS---NSFLDFQVSNNS---IYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLV-NTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEE 1660
            S+CS R+N T + GC S ++   GV   +     +   ++ E     ++V+   +F +  LM  V   S   +G+VVL   I +      F E+      +Y         NV+   N     Y S +W  P+VL+  S+   +  +  CY+ FN      ++C I I N      +   C+  R++L     F S  V+C ++NG NI ++  +               V+  ++ S IV+ T +DS S+F+  A  +    P  SV+V +A  ++++   + L  K  D+  AF+DN++FD +G+ R AYDL+  N  +  GV +  E++   +++ E+       L     + DES   +T  ++ + +  +     +FG+    +   +I    L    + +++  +   P  HI  +      L+     SFLDF    +S     LL ++ TL+  L   +         NIS      + TP D++ C V N TC+LL   + P + ++ QS   P  +QSY      +   K++ ++S  +  +L+   GE 
Sbjct:   41 SHCSRRLNVTGQIGCSSRLQSSSGVALFVEHADEVTDFLNAENVAPTVLVMQYSLFLNSSLMSDVRSYSERTVGLVVLFQKISKNKHPVPFSESDECPNALYSHYGAERQCNVTPAWNPHGTAYSSIEWPFPVVLIRTSDTSIESELFRCYKQFNANPVDDTRCLIEIRNVMSAVSSSALCI-RRESLMGLPIFESPIVYCDELNGVNILLSATNTTASIRTNSPNRSVSVQERSRNSSIVVLTRLDSRSMFERSAFASQWALPGTSVLVSIAAHLIRQPAFQQLQLKR-DLFFAFLDNEAFDFMGSGRLAYDLRERNLAAYTGVPLGWEHVHSFIELGELGLAAKNPLPTYYTLADESIYEQTKVVTDELREQLAAANERFGQISISRAPDSIARLPLPPTASLQSLLSSAPHPLPHILLADHAGPPLWDKHFESFLDFVWPPDSGADQVLLVLANTLADALHRLVVKDSLPMPANIS------HPTPGDLMLCFVNNVTCDLLRTFLSPGDLHFLQSLKTPIPAQSY------LPLDKHELKISHIISVLLMGLTGER 586          
BLAST of Ncstrn_small domain-containing protein vs. TrEMBL
Match: A0A419PQB8 (Nicastrin OS=Clonorchis sinensis OX=79923 GN=NCSTN PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.842e-27
Identity = 136/561 (24.24%), Postives = 244/561 (43.49%), Query Frame = 2
Query:  137 SYCSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMD-SSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDEN-------RFKGFYYS--QWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKK---------------SVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMAT-ILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLK-FNRVSPGGVNISNENIALVVKISEIDTQYNTLL-----VIDES------NETYSISQQFKTNMVKFGE----KNNLNIRTYNLYDHDN-KNIWQNFSIPFLH-IKSSIISTNLFS---NSFLDF---QVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLV-NTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEE 1660
            S+CS R+N T + GC S ++   GV   +     +   ++ E     ++V+   +F +  LM  +   S  ++G+VVL     E      F E S    N  +S+   +            G  YS  +W  P+VL+  S+   +  +  CY+ FN      ++C I I N      +   C+  R++L     F S  V+C ++NG NI ++  +     +K               S +V+ T +DS S+F+  A  +    P ISV+V +A  ++++   + L  K  D+  AF+DN++FD +G+ R AYDL+  N  +  GV +  E+I   +++ E+       L     ++DE+        T  + +Q      +FG+    +   ++    L    + +++  +   P  H I +      L+     SFLDF     S+    LL ++ TL+  L         +   ++ +     + TP D++ C V N TC+LL   + P +  + QS   P  +QSY      +   K++ ++S  V  +L+   GE 
Sbjct:   41 SHCSRRLNVTGQIGCSSRLQSSSGVALFVEHADEVTDFLNAENIAPTVLVMQYSLFLNSSLMNDLRSYSERVVGLVVLSQQTSENKHPAPFSE-SDECPNALYSHYGAERQCSVTPAWNLHGAAYSTIEWPFPVVLIQTSDISIESELFRCYKQFNANPVDDTRCLIEIRNVMSAVSSSALCI-RRESLMGLPIFESPIVYCDELNGVNILLSATNTTASIRKNSPNRSVSVQERLRNSSVVVLTRLDSRSMFERSAFASQGALPGISVLVSVAAHLIRQPAFQQLQLKR-DLFFAFLDNEAFDFMGSGRLAYDLRERNLAAYTGVPLGWEHIHSFIELGELGLAAKNPLPTYYTLVDENIYEQTKGATDELREQLAAANERFGQISISRAPDSVARLPLPPTASLQSLLSSAPHPLPHIILADHAGPPLWDKHFESFLDFVWPPDSDADQVLLILANTLADALHRL------VVKDSLPMPASISHPTPGDLMLCFVNNVTCDLLRTFLSPGDLRFLQSLKTPIPAQSY------LPLDKHELKISHIVSVLLMGLTGER 586          
BLAST of Ncstrn_small domain-containing protein vs. TrEMBL
Match: A0A4Z2CZX9 (Nicastrin isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005923 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 7.197e-25
Identity = 119/519 (22.93%), Postives = 239/519 (46.05%), Query Frame = 2
Query:  119 IPNTAISYCSGRMNYTNRFGCKS--TMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKY-FKENSIFAKNIYFS-NVSNDEN-------RFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFND--------------VKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATIL--KKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSP-GGVNISNENIALVVKISEID-----TQYNTLLVIDESNETYSISQQFKTNMV-------KFGEKNNLNIRTYNLYD------HDNKNIWQNFSIPFLHIKSSIISTNLFSN----SFLD--FQVSNN---SIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLV-NTTCELLGYLI 1507
            IP +  S+C+ R+N T + GC S  T   GV   +  + ++   +H++T    +I++    FT+  LM+  M + ++ G++V   S  ++    + F E+S     +Y + NV+   +           + Y  W  P+VL++  N   + ++ +C+   N      ++CSI I N    + + + C   R+ L       S  +FC ++ G NI ++ +D                  ++ S + + T MDS S+F+     +  + P+++V++ +A  L  +K+ ++S  EK  D+   F+DN+++D +G+ R +YDL    ++   G  +   N+  V+++ E+         +T  ++ +S ++Y++++ F  N+        K  +K +L   +  L +         + + Q  + P  H+  S      F N    SF+D  +  ++N    I LL+++ TL+  L   +       + + S+ +G  Y  P DI+ C V N  C+L   +I
Sbjct:   34 IPLSYTSFCTRRLNLTGQVGCSSSTTGNSGVALFMNESEDIMQTLHSDTSTPFVILVSVKHFTNASLMRFFMSTRNVKGLIVF--SNEDVNDDNHEFSESSKCPNGLYSAYNVTKQCDLDIQWNPAGTDYSYIDWPFPVVLVADVNNTIRASMYECFSVLNKEPYDDTRCSIEIYNPMSAAGSSETCF-RRQYLMTLHISESSGIFCDELTGLNIILSASDSVNHSWNNIAVNIGTSGRSENSSVFILTRMDSRSIFERSGFSSQGVLPSVAVLISVAAHLMRQKAFKDSHLEK--DLFFGFLDNEAYDFMGSYRLSYDLGSGNIARYTGRPVMWNNVHAVIELGEVGLSQKHNNLHTFYMLTDS-KSYNLTRDFTDNIFHQLTAASKASQKVDLQRPSDKLQELPLPPTSSMQTLLQTSARPLSHVVLSDHDRPPFRNKHFESFMDTKWPPTDNPTADITLLDLANTLADALHRIV------SANHTSIPSGITYPKPGDIMECFVTNLGCDLFKMVI 540          
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Cavefish
Match: NCSTN (nicastrin [Source:NCBI gene;Acc:111194526])

HSP 1 Score: 70.8626 bits (172), Expect = 3.129e-12
Identity = 74/323 (22.91%), Postives = 139/323 (43.03%), Query Frame = 2
Query:   92 KLIICINMRIPNTAISYCSGRMNYTNRFGCKSTMR--EGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLR----PSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRF-----KGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNF-INDKGSK---CSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITF----NDVKMYNK-KSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLK 1000
            K+ I +N  +P      C   +N T++ GC+S++    GV+ +  +  +L+ I+        ++V+    FT   +M+M  +SS + G+ V+     PS G     +   +NS      Y   ++N  N           Y  +  PI  L   N    Q I  CYE  N  +N    +   C++++ +H         C+  R  L++ F  + + + C  +N  N++ +     + +K + + +SV++  T +D  S F   A  A      I  ++  A  L    QE+   +N  +   F   ++FD +G+ R  YD++
Sbjct:   29 KIYIQLNNTVP------CVRLLNATHQIGCQSSISGDTGVLHVFESEADLEWILTNGPHPPYMVVMEAVFFTRPTMMRM-KNSSRVAGVAVISSSTAPSEGFSPHTRCPNQNSGVYGESYGPELANCNNTVWNPLGNNLSYEDFAFPIFFLE--NDNQTQVIRKCYEDHNVRVNGTAPEYPLCAMQLFSHMHAVTDTVTCM-RRTDLQNSFSINPEKL-CDPLNDFNVWASIRPLNSSIKGHKENESVVIAATRLDGRSFFWDVATSAEGTVSGIVTLLAAAQALYPVTQEAPPPRN--IFFTFFQGEAFDYIGSSRMVYDMQ 338          
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Medaka
Match: NCSTN (nicastrin [Source:NCBI gene;Acc:101163847])

HSP 1 Score: 52.7582 bits (125), Expect = 1.255e-6
Identity = 70/342 (20.47%), Postives = 143/342 (41.81%), Query Frame = 2
Query:  143 CSGRMNYTNRFGCKSTMRE--GVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSI----GEIFKVKYFKEN-----SIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFN-FINDKGSK---CSIRITNHNPLSMTVKNCLDERKTLKHFFQFS-SKDVFCKDINGQNIYIT---FNDVKMYNKK--SVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEIDTQYNTLLVI 1105
            C   +N T++ GC+S+     GVV L+ +  NL  ++ +      ++++ + +FT           S + G+VV+ P+     G         EN       +  +    NV+       G  Y +++ PI  +  SN    + I  CY   N  +N    +   C++++ +H         C+   +       FS + +  C  +  +NI+ +    N+    +K+  SV++    MDS S F   A GA     + +  +        +L+ +  E N  +L  F   ++FD +G+ R  YD++ N+       +  +N+  ++++ ++    N+ L +
Sbjct:   23 CVRLLNATHQIGCQSSFGGDVGVVHLLESEENLDWVLSSGPNPPYMVILESTLFTRYS------QCSRVAGVVVVEPTTNPPDGFSPHTSCPNENMGVYSESYGPSYAHCNVTVWNPLGNGLSYEEFDFPIFSMKDSNDT--EVIRRCYREHNRAVNGSTPQYPLCAMQLFSHMSAVTDTATCMRRSE-----IPFSLTPEFVCDPLGDENIWASTKPLNNTAKGHKEGESVVIAAVKMDSRSFFFGLAPGA----DSTATGLVALLAAANALRNATAELNRTILYTFFHGETFDYIGSSRMVYDMENNQFP-----LDLDNVHSILEVGQVALGSNSRLWL 342          
BLAST of Ncstrn_small domain-containing protein vs. Planmine SMEST
Match: SMESG000035369.1 (SMESG000035369.1)

HSP 1 Score: 1295.41 bits (3351), Expect = 0.000e+0
Identity = 633/633 (100.00%), Postives = 633/633 (100.00%), Query Frame = 2
Query:  113 MRIPNTAISYCSGRMNYTNRFGCKSTMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEIDTQYNTLLVIDESNETYSISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIWQNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDDKEW 2011
            MRIPNTAISYCSGRMNYTNRFGCKSTMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEIDTQYNTLLVIDESNETYSISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIWQNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDDKEW
Sbjct:    1 MRIPNTAISYCSGRMNYTNRFGCKSTMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEIDTQYNTLLVIDESNETYSISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIWQNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDDKEW 633          
BLAST of Ncstrn_small domain-containing protein vs. Planmine SMEST
Match: SMESG000035369.1 (SMESG000035369.1)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 2
Query: 1127 SISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIWQNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDDKEW 2011
            SISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIWQNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDDKEW
Sbjct:  265 SISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIWQNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDDKEW 559          

HSP 2 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 266/284 (93.66%), Postives = 276/284 (97.18%), Query Frame = 2
Query:  113 MRIPNTAISYCSGRMNYTNRFGCKSTMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFD 964
            MRIPNTAISYCSGRMNYTNRFGCKSTMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQES++++    ++ F + ++ +
Sbjct:    1 MRIPNTAISYCSGRMNYTNRFGCKSTMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESISQQFKTNMVKFGEKNNLN 284          
BLAST of Ncstrn_small domain-containing protein vs. Planmine SMEST
Match: SMESG000035368.1 (SMESG000035368.1)

HSP 1 Score: 362.073 bits (928), Expect = 4.459e-116
Identity = 223/654 (34.10%), Postives = 374/654 (57.19%), Query Frame = 2
Query:  134 ISYCSGRMNYTNRFGCKSTM--REGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSI-------GEIFKVKYFKE---------NSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVF--CKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKI---SEIDTQYNTLLVIDESNETYSISQQFKTNMVKFGEKNNLNIRTYNL---YDHDNKNIW-QNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIET-LQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRF---PIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDD 2002
            IS+C+ RMNYT+ +G  S +   +G V  +R+   +Q  +     +K I+VIP  +F    L+  ++    ++G++VL P           I +V +F E              K+  +S++S     F  +Y ++W  PIVLL  S G YQ NIIDC+E +    +KG+ C + I +++ +  +V +C+  R++ ++   F +K  +  C  I+G NIYITFN  K Y K+S++++ T MD+ S+FDT + G   LY +IS++++MA+I  K+  E    KN D+L+ F+DNDS D +G++R  YDLK N++S G  NIS+ENI L++ +   S+I +++  +   D +  +  +   F   +        L+IR   +   Y  +  +IW +  +IP + +KSS+I    F  SFLD    N  +    ++  L+SV +   + T    + K +          PS II C  +  CELL   +GPK++ +Y+ +  P  +QS+++GFI  K+GKY+NRLS FVLKIL++FL     +  EC D+  +  F+T I+D L C  +NIQ+ TDF+P +++  S  R  ++F+ F   P WM++ +  +  + L++S++++IY+TS++  T+IT+L FV+SIF+YRNIN +IP++
Sbjct:    2 ISFCTYRMNYTHYYGSTSEIDGNDGKVMFVRSMKEMQFQLSFALTEKTILVIPASLFVVKNLIIELIKLQLVVGMIVLEPQYCTKKICKAVINEVPFFSEIDPCQNWFHRRFLPKHCNYSDISG----FYNYYEAKWPFPIVLLK-SGGNYQNNIIDCFEKYESTENKGNLCRLTIKSYS-MPRSVADCM--RRSSRNIVDFGTKAKYNLCSQISGNNIYITFNPSKKYLKRSMLLIITKMDTQSMFDTASAGTTELYSSISILIYMASIFNKTKFE----KNTDILVGFLDNDSLDNIGSLRMIYDLKSNKISNGVGNISDENIRLIIYLEDFSDIRSEFIYVFFHDCNRSSEDVCNIFMNRL-------KLSIRYLKIVIYYFENETDIWLKTMNIPKIVLKSSVIGKAKFRKSFLDRMEPNYDVKTDAMADILASVCLAMYITTSNSSRDKEV--------LQPSKIIPCFYSPYCELLKAYMGPKQKEFYRIYGTPLVAQSFVNGFIESKNGKYRNRLSSFVLKILVLFLSYRHVKVEECNDLLGLNNFSTRINDTLTCVISNIQVATDFDPSSYV-KSDKRVTEYFQNFSLIPSWMRSAIPSKLRLVLYVSIHSDIYMTSVIGATLITSLTFVTSIFMYRNINEIIPEE 627          
BLAST of Ncstrn_small domain-containing protein vs. Planmine SMEST
Match: SMESG000035368.1 (SMESG000035368.1)

HSP 1 Score: 353.214 bits (905), Expect = 9.564e-113
Identity = 219/647 (33.85%), Postives = 368/647 (56.88%), Query Frame = 2
Query:  155 MNYTNRFGCKSTM--REGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSIIGIVVLRPSI-------GEIFKVKYFKE---------NSIFAKNIYFSNVSNDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVF--CKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKI---SEIDTQYNTLLVIDESNETYSISQQFKTNMVKFGEKNNLNIRTYNL---YDHDNKNIW-QNFSIPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIET-LQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRF---PIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDD 2002
            MNYT+ +G  S +   +G V  +R+   +Q  +     +K I+VIP  +F    L+  ++    ++G++VL P           I +V +F E              K+  +S++S     F  +Y ++W  PIVLL  S G YQ NIIDC+E +    +KG+ C + I +++ +  +V +C+  R++ ++   F +K  +  C  I+G NIYITFN  K Y K+S++++ T MD+ S+FDT + G   LY +IS++++MA+I  K+  E    KN D+L+ F+DNDS D +G++R  YDLK N++S G  NIS+ENI L++ +   S+I +++  +   D +  +  +   F   +        L+IR   +   Y  +  +IW +  +IP + +KSS+I    F  SFLD    N  +    ++  L+SV +   + T    + K +          PS II C  +  CELL   +GPK++ +Y+ +  P  +QS+++GFI  K+GKY+NRLS FVLKIL++FL     +  EC D+  +  F+T I+D L C  +NIQ+ TDF+P +++  S  R  ++F+ F   P WM++ +  +  + L++S++++IY+TS++  T+IT+L FV+SIF+YRNIN +IP++
Sbjct:    1 MNYTHYYGSTSEIDGNDGKVMFVRSMKEMQFQLSFALTEKTILVIPASLFVVKNLIIELIKLQLVVGMIVLEPQYCTKKICKAVINEVPFFSEIDPCQNWFHRRFLPKHCNYSDISG----FYNYYEAKWPFPIVLLK-SGGNYQNNIIDCFEKYESTENKGNLCRLTIKSYS-MPRSVADCM--RRSSRNIVDFGTKAKYNLCSQISGNNIYITFNPSKKYLKRSMLLIITKMDTQSMFDTASAGTTELYSSISILIYMASIFNKTKFE----KNTDILVGFLDNDSLDNIGSLRMIYDLKSNKISNGVGNISDENIRLIIYLEDFSDIRSEFIYVFFHDCNRSSEDVCNIFMNRL-------KLSIRYLKIVIYYFENETDIWLKTMNIPKIVLKSSVIGKAKFRKSFLDRMEPNYDVKTDAMADILASVCLAMYITTSNSSRDKEV--------LQPSKIIPCFYSPYCELLKAYMGPKQKEFYRIYGTPLVAQSFVNGFIESKNGKYRNRLSSFVLKILVLFLSYRHVKVEECNDLLGLNNFSTRINDTLTCVISNIQVATDFDPSSYV-KSDKRVTEYFQNFSLIPSWMRSAIPSKLRLVLYVSIHSDIYMTSVIGATLITSLTFVTSIFMYRNINEIIPEE 619          
BLAST of Ncstrn_small domain-containing protein vs. Planmine SMEST
Match: SMESG000035367.1 (SMESG000035367.1)

HSP 1 Score: 333.954 bits (855), Expect = 6.250e-105
Identity = 223/659 (33.84%), Postives = 360/659 (54.63%), Query Frame = 2
Query:  107 INMRIPNTAISYCSGRMNYTNRFGC--KSTMREGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSII-GIVVLRP------SIG----EIFKVKYFKE----NSIFAKNIYFSNVS---NDENRFKGFYYSQWNIPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKNCLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTYMDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAFVDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISE-IDTQYNTLLV-IDESNETYSISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIW-QNFSIPFLHIKSSIISTNLFSNSFLDFQV----SNNSIYLLNISQTLSSVLIETLQTIQGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHAHPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIRNIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWMQNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLIPDD 2002
            I MRIPN A+SYC+ RMNYT+ FGC  KS+   G V L+ +   L   +     D +IIV+P  +F      K++M   S I G+V+L P      ++G    ++  V +F E      +F +  +F+  S   +D   F G Y   W  P++ L  +N  YQQ+II+CY+  N I+ K +KC I+I N +P       C+     L + ++F+S+  +C ++ G NIYITFN  K Y KK++I++ T +DSTSLFDT + G   LYP++++++ M  +   +        ++D+L+ F+DN+S D +G++R  YDLK N VS G  NIS++NI L++ I + I T+ N L   I E +    I      ++ +   K    +  Y +   D++++W +  ++P +  +SSII  N +  SFLD         N I    I + L+  +I   + + G  +   +    Y +  P  I  C  +  C LL  LIG +E+N Y ++  P  SQ+++DGF+ +K GKY  RLS  + K ++  L      ++ C D+ N+  F   ++D   C   NIQI T+FNPL ++  S     +     PI M++ V+ RQ+++LF+S + EI +TS ++ T+++AL FV SIF+YRNIN++I  +
Sbjct:   16 IKMRIPNYAVSYCTFRMNYTHFFGCNSKSSGNVGSVLLVYSLKELLYQLSEYRHDPVIIVMPAQVFIKKSTYKIMMQKKSTIEGVVILEPDYCLNHTLGICKHKVMGVPFFSEIDPCRDLFYR--HFNERSCKYSDVFGFYGMYEMIWPFPLIYLK-ANYYYQQSIIECYQKHNAISGKKNKCKIQIYNFSPKPCNSATCILIENLLTNRWRFTSRFNYCSELAGNNIYITFNPSKKYAKKAIILITTRIDSTSLFDTASAGTQELYPSVTLLMFMVQMFNITSYPP----SSDILVGFLDNESVDNLGSLRMIYDLKNNLVSNGVGNISDKNIVLIISIDDFIMTKTNHLFAFIYECSRNNIICTVLLRDLTQLCYKYGFKLIIYKM--KDSRDMWLKTINVPKIKFQSSIIDANPYKRSFLDRMKPVINPQNEI----IGRMLAEAVI---KAVNGTLNDVFNKSDKYYFILPDTISACFYDIRCPLLQRLIGKRERNLYINYGKPLVSQAFVDGFVEIKGGKYLTRLSYIISKFIIYRLRTTEEVDLNCLDMDNLNNFTMTVNDVDTCVHANIQIRTEFNPLRYVNKSTYFLNE-LSDLPISMRSNVVQRQKLELFVSSDGEIDVTSTILATLLSALSFVISIFVYRNINNIIAPE 657          
The following BLAST results are available for this feature:
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCSTN3.130e-1120.35nicastrin [Source:HGNC Symbol;Acc:HGNC:17091][more]
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nct3.118e-1423.68gene:FBgn0039234 transcript:FBtr0301865[more]
Nct3.118e-1423.68gene:FBgn0039234 transcript:FBtr0084705[more]
Nct3.243e-1423.68gene:FBgn0039234 transcript:FBtr0334570[more]
Nct3.245e-1423.68gene:FBgn0039234 transcript:FBtr0306087[more]
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ncstn1.902e-921.24nicastrin [Source:MGI Symbol;Acc:MGI:1891700][more]
back to top
BLAST of Ncstrn_small domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9VC27|NICA_DROME3.126e-1323.68Nicastrin OS=Drosophila melanogaster OX=7227 GN=Nc... [more]
sp|Q92542|NICA_HUMAN1.503e-1020.35Nicastrin OS=Homo sapiens OX=9606 GN=NCSTN PE=1 SV... [more]
sp|P57716|NICA_MOUSE1.331e-821.24Nicastrin OS=Mus musculus OX=10090 GN=Ncstn PE=1 S... [more]
sp|Q8CGU6|NICA_RAT1.475e-820.94Nicastrin OS=Rattus norvegicus OX=10116 GN=Ncstn P... [more]
back to top
BLAST of Ncstrn_small domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D0165.882e-3222.11Nicastrin isoform 2 OS=Schistosoma japonicum OX=61... [more]
A0A4S2LPW94.319e-2824.38Ncstrn_small domain-containing protein OS=Opisthor... [more]
A0A074ZCI81.113e-2724.82Ncstrn_small domain-containing protein OS=Opisthor... [more]
A0A419PQB82.842e-2724.24Nicastrin OS=Clonorchis sinensis OX=79923 GN=NCSTN... [more]
A0A4Z2CZX97.197e-2522.93Nicastrin isoform 1 OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCSTN3.129e-1222.91nicastrin [Source:NCBI gene;Acc:111194526][more]
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ncstrn_small domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCSTN1.255e-620.47nicastrin [Source:NCBI gene;Acc:101163847][more]
back to top
BLAST of Ncstrn_small domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035369.10.000e+0100.00SMESG000035369.1[more]
SMESG000035369.10.000e+0100.00SMESG000035369.1[more]
SMESG000035368.14.459e-11634.10SMESG000035368.1[more]
SMESG000035368.19.564e-11333.85SMESG000035368.1[more]
SMESG000035367.16.250e-10533.84SMESG000035367.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025476 ID=SMED30025476|Name=Ncstrn_small domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2066bp
ATTTATCTTTATTGGTTTCAAATGAGTTAAGAAGTCAACATTAATGTCAA
GAAATATAATAATATATTTTTATATTCTTTTCGAAACGGCTAAATTAATT
ATATGTATTAACATGAGAATACCCAATACTGCTATTTCGTATTGCAGTGG
AAGGATGAACTACACTAACCGGTTCGGCTGCAAATCAACGATGCGTGAAG
GCGTCGTTAAACTTATACGTACCACCTTAAATCTCCAAGCCATAGTCCAC
ACTGAAACTGAAGATAAAATAATTATTGTAATTCCAACTTTTATTTTTAC
TAGTGTCAGGCTGATGAAAATGGTCATGGATTCTTCATCTATTATTGGAA
TTGTGGTCTTACGGCCTTCAATTGGAGAAATATTTAAAGTTAAATATTTT
AAAGAAAATTCAATTTTTGCAAAAAACATTTATTTTTCTAACGTATCCAA
TGATGAAAATAGATTTAAAGGTTTCTATTATAGCCAATGGAATATACCAA
TTGTTTTATTATCTCCGAGCAACGGCAAATATCAACAAAACATTATCGAC
TGCTATGAAACCTTTAATTTCATTAATGATAAAGGCTCCAAGTGTTCAAT
AAGGATTACCAACCATAATCCTCTATCTATGACTGTCAAGAATTGTCTCG
ACGAAAGAAAAACTTTAAAACATTTCTTTCAATTCTCTTCCAAAGATGTA
TTTTGTAAAGATATAAATGGTCAAAATATATACATTACATTTAATGATGT
CAAAATGTACAATAAAAAATCAGTTATTGTCTTATATACATATATGGACT
CAACATCACTGTTTGATACCGGAGCCGTCGGGGCTATGCTACTTTATCCG
ACTATTTCTGTTATGGTTCATATGGCTACAATTTTGAAAAAAAGTCTTCA
AGAATCTTTAAATGAAAAGAACGCAGATGTTTTGATGGCCTTCGTTGATA
ACGACTCTTTCGATAAAGTTGGAACAATTAGATTTGCATACGATTTAAAA
TTTAATAGAGTAAGCCCAGGAGGGGTCAATATCTCAAATGAAAATATTGC
ATTGGTGGTCAAAATTAGTGAAATTGATACACAATACAATACCTTATTAG
TTATTGATGAAAGCAATGAAACATATTCGATTTCACAACAATTTAAAACA
AATATGGTAAAATTTGGTGAAAAGAACAACCTCAATATCCGTACCTATAA
TTTATACGACCATGATAACAAAAATATCTGGCAGAATTTTTCTATTCCCT
TTCTTCATATCAAGTCTAGCATAATTTCAACTAATTTATTTAGCAATAGC
TTTTTGGACTTTCAAGTATCAAATAATTCCATATATTTGTTAAATATATC
CCAGACCCTTTCGTCAGTGTTAATTGAGACACTTCAAACTATCCAAGGCA
TGAAAAGTAAAAATATTTCTTTAAAAACTGGATATGATTACTTTACACCT
TCTGATATTATAAATTGTTTGGTTAATACAACCTGTGAATTACTCGGATA
TCTGATTGGGCCGAAAGAGCAGAATTATTATCAGTCCCACGCGCACCCAT
TCAAATCCCAATCATATATAGACGGATTTATTACAATGAAACATGGAAAA
TACAAAAATAGGCTTAGTGAATTCGTTTTAAAGATTTTGCTCATTTTCCT
CGGTGAAGAAATGCCTCGCAACATTGAATGTGAGGATATAAGAAACATAA
AATATTTTGCAACGGAAATCCACGATCAGTTGATGTGCTTCAGAACTAAT
ATCCAAATTGAAACGGATTTCAATCCGTTGACATTTCTACCAGATTCAAT
TCCAAGGGATGAGAAATTTTTCAAAAGATTTCCAATATGGATGCAAAATG
GAGTTCTAGTGAGACAAGAGGTGGATTTATTCATTTCAGTAAATACAGAA
ATTTACATTACATCTATGGTGATCGGAACTATAATAACTGCTCTTTGCTT
TGTCAGTTCAATATTTCTTTATCGGAACATTAATTCTTTGATTCCAGATG
ATAAAGAATGGTAAAAATATTAAATCTCTATGAAAATTAATTTGATTGAA
AAAATAAATATGCTAC
back to top

protein sequence of SMED30025476-orf-1

>SMED30025476-orf-1 ID=SMED30025476-orf-1|Name=SMED30025476-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=657bp
MSRNIIIYFYILFETAKLIICINMRIPNTAISYCSGRMNYTNRFGCKSTM
REGVVKLIRTTLNLQAIVHTETEDKIIIVIPTFIFTSVRLMKMVMDSSSI
IGIVVLRPSIGEIFKVKYFKENSIFAKNIYFSNVSNDENRFKGFYYSQWN
IPIVLLSPSNGKYQQNIIDCYETFNFINDKGSKCSIRITNHNPLSMTVKN
CLDERKTLKHFFQFSSKDVFCKDINGQNIYITFNDVKMYNKKSVIVLYTY
MDSTSLFDTGAVGAMLLYPTISVMVHMATILKKSLQESLNEKNADVLMAF
VDNDSFDKVGTIRFAYDLKFNRVSPGGVNISNENIALVVKISEIDTQYNT
LLVIDESNETYSISQQFKTNMVKFGEKNNLNIRTYNLYDHDNKNIWQNFS
IPFLHIKSSIISTNLFSNSFLDFQVSNNSIYLLNISQTLSSVLIETLQTI
QGMKSKNISLKTGYDYFTPSDIINCLVNTTCELLGYLIGPKEQNYYQSHA
HPFKSQSYIDGFITMKHGKYKNRLSEFVLKILLIFLGEEMPRNIECEDIR
NIKYFATEIHDQLMCFRTNIQIETDFNPLTFLPDSIPRDEKFFKRFPIWM
QNGVLVRQEVDLFISVNTEIYITSMVIGTIITALCFVSSIFLYRNINSLI
PDDKEW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR041084Ncstrn_small
IPR008710Nicastrin
Vocabulary: biological process
TermDefinition
GO:0016485protein processing
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041084Nicastrin, small lobePFAMPF18266Ncstrn_smallcoord: 34..182
e-value: 1.5E-15
score: 57.6
NoneNo IPR availablePFAMPF05450Nicastrincoord: 244..376
e-value: 4.2E-13
score: 49.3
NoneNo IPR availableCDDcd03881M28_Nicastrincoord: 37..345
e-value: 1.39955E-20
score: 93.6402
NoneNo IPR availableTMHMMTMhelixcoord: 620..642
IPR008710NicastrinPANTHERPTHR21092NICASTRINcoord: 30..642