Si:ch211-215k15.4

Overview
NameSi:ch211-215k15.4
Smed IDSMED30025475
Length (bp)710
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-215k15.4 (SMED30025475) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-215k15.4 (SMED30025475) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-215k15.4 (SMED30025475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-215k15.4 (SMED30025475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025475SMESG000013679.1 Contig2840newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025475SMESG000013679.1 Contig2840uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025475SMESG000031406.1 Contig2840newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025475SMESG000031406.1 Contig2840uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30025475SMESG000013679.1 SmedASXL_000617SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30025475SMESG000013679.1 dd_Smed_v4_31751_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025475SMESG000013679.1 dd_Smed_v4_31751_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025475SMESG000013679.1 dd_Smed_v4_31751_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025475SMESG000013679.1 dd_Smed_v4_31751_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:cabz01040626.2 (si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113-147])

HSP 1 Score: 50.8322 bits (120), Expect = 4.861e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:   71 NLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSV--GLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            NL+  K   QSSTF       S+ +      F      P  S  CSST  S +  +W++DL  +  V+ V + N+     +  N   I   +S          C+ + S+  G++ T  CN+   R+V++L      +L LCEV+V+G
Sbjct:  161 NLATGKNVMQSSTF-------SSWIPEQAIDFNPGLSDP--SIGCSST-NSQTDPWWRLDLGHIYQVSTVVVTNRLDCCPERMNGAEIHIGNSLENNGNNNPICAVISSIPAGVSATFACNNMEGRYVSLLIRGDTKFLTLCEVEVYG 298          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:cabz01040626.2 (si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113-147])

HSP 1 Score: 50.447 bits (119), Expect = 5.458e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:   71 NLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSV--GLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            NL+  K   QSSTF       S+ +      F      P  S  CSST  S +  +W++DL  +  V+ V + N+     +  N   I   +S          C+ + S+  G++ T  CN+   R+V++L      +L LCEV+V+G
Sbjct:  164 NLATGKNVMQSSTF-------SSWIPEQAIDFNPGLSDP--SIGCSST-NSQTDPWWRLDLGHIYQVSTVVVTNRLDCCPERMNGAEIHIGNSLENNGNNNPICAVISSIPAGVSATFACNNMEGRYVSLLIRGDTKFLTLCEVEVYG 301          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 50.0618 bits (118), Expect = 7.410e-7
Identity = 46/157 (29.30%), Postives = 72/157 (45.86%), Query Frame = 2
Query:   50 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSV--GLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            YP     N++ +   TQS    L  N + AS ANDGN    D  + +GS  C+ T K+ +  +W++DL     V  V I N    L +  N   I    +          C+ + S+  G + +  C+    R+V ++     +YL LCEV+V+G P
Sbjct:  171 YPAPNGENVALIGKATQS---FLYGNGF-ASNANDGN---KDGVYTHGS--CTHTHKTLNP-WWRLDLLKRHKVFSVVITNTLDNLPERLNGAEIRIGDNLDNNGNNNPRCATIASIPAGFSSSFDCDGMEGRYVNVVIPGREEYLTLCEVEVYGSP 317          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 50.0618 bits (118), Expect = 7.776e-7
Identity = 47/150 (31.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:   71 NLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLED-LRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADY-LDLCEVQVFGIP 514
            NL+      QSST   N N   A  A DGN    + D+  GS + +S E    + +W+VDL  VSSV +VTI N+    E+ +R  ++ + +S E   +      + + ++  + T +      R++ +   PG D  L LCEV+VF  P
Sbjct:   25 NLALGAAAVQSSTGDPNGN---AEHAVDGNT---EADYRKGSCTHTSRE---FNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLENNGNNNQLAATLLDAIKGSQTFEFQPIQGRYLNVF-LPGNDETLSLCEVEVFSGP 164          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 49.6766 bits (117), Expect = 8.485e-7
Identity = 46/157 (29.30%), Postives = 72/157 (45.86%), Query Frame = 2
Query:   50 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSV--GLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            YP     N++ +   TQS    L  N + AS ANDGN    D  + +GS  C+ T K+ +  +W++DL     V  V I N    L +  N   I    +          C+ + S+  G + +  C+    R+V ++     +YL LCEV+V+G P
Sbjct:  166 YPAPNGENVALIGKATQS---FLYGNGF-ASNANDGN---KDGVYTHGS--CTHTHKTLNP-WWRLDLLKRHKVFSVVITNTLDNLPERLNGAEIRIGDNLDNNGNNNPRCATIASIPAGFSSSFDCDGMEGRYVNVVIPGREEYLTLCEVEVYGSP 312          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 70.0922 bits (170), Expect = 1.784e-13
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
             ++NL+ L   +QSSTF     KY+A+ A DGN   N       + SCS T   N + +WQ+DL+    V +V I N+     E LR  ++ + +S   P +    C +      LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  188 ADVNLARLGEASQSSTF---SPKYNAAAAIDGNKDTNMM-----AGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDS---PDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 325          

HSP 2 Score: 56.225 bits (134), Expect = 9.400e-9
Identity = 48/151 (31.79%), Postives = 71/151 (47.02%), Query Frame = 2
Query:   71 NLSYLKPTTQSSTFVLNQNKYSASLANDGN----LFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKY-LEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            NL+      QSSTF     +Y+A  A DGN    +FQN         SCS T     S +WQ+DL+   ++  + I N+     E L   ++ + NS   P +    C +      LT    CN    R+V+++    A+YL LCEV+V+G
Sbjct:   48 NLAQSGDVKQSSTF---GAQYTAQKAVDGNKDTNMFQN---------SCSHTNNDKPS-WWQLDLKKNYNIDTIVIANRGDCCAERLLRAEIRVGNS---PDNNNPVCATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 182          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 69.707 bits (169), Expect = 1.908e-13
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
             ++NL+ L   +QSSTF     KY+A+ A DGN   N       + SCS T   N + +WQ+DL+    V +V I N+     E LR  ++ + +S   P +    C +      LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  166 ADVNLARLGEASQSSTF---SPKYNAAAAIDGNKDTNMM-----AGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDS---PDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 66.2402 bits (160), Expect = 2.846e-12
Identity = 49/148 (33.11%), Postives = 75/148 (50.68%), Query Frame = 2
Query:   68 INLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            +NL+ L    QSST+   + +Y+A+ A DGN   N         SCS T   N + +WQ+DL+    V +V I N+     E LR  +V + NS++    +   C +      LT    CN    R+V+++    A+YL LCEV+V+G
Sbjct:   25 VNLARLGDVKQSSTY---RPEYNAATAVDGNKNSNMM-----LGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPV---CATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 160          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 69.707 bits (169), Expect = 2.043e-13
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
             ++NL+ L   +QSSTF     KY+A+ A DGN   N       + SCS T   N + +WQ+DL+    V +V I N+     E LR  ++ + +S   P +    C +      LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  166 ADVNLARLGEASQSSTF---SPKYNAAAAIDGNKDTNMM-----AGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDS---PDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 60.8474 bits (146), Expect = 2.585e-10
Identity = 47/148 (31.76%), Postives = 72/148 (48.65%), Query Frame = 2
Query:   68 INLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKY-LEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            +NL+ L    QSST+   + +Y+A+ A DGN   N         SCS T   N + +WQ+DL+    V  V I N+     E LR   + + +S+     +   C +      LT    CN    R+V+++    A+YL LCEV+V+G
Sbjct:   25 VNLARLGDVRQSSTY---RPEYNAATAVDGNKNSNMM-----LGSCSHTNSDNPA-WWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVGDSANNNNPV---CATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 160          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 69.707 bits (169), Expect = 2.159e-13
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
             ++NL+ L   +QSSTF     KY+A+ A DGN   N       + SCS T   N + +WQ+DL+    V +V I N+     E LR  ++ + +S   P +    C +      LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  167 ADVNLARLGEASQSSTF---SPKYNAAAAIDGNKDTNMM-----AGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDS---PDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 304          

HSP 2 Score: 55.8398 bits (133), Expect = 1.083e-8
Identity = 48/151 (31.79%), Postives = 71/151 (47.02%), Query Frame = 2
Query:   71 NLSYLKPTTQSSTFVLNQNKYSASLANDGN----LFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKY-LEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            NL+      QSSTF     +Y+A  A DGN    +FQN         SCS T     S +WQ+DL+   ++  + I N+     E L   ++ + NS   P +    C +      LT    CN    R+V+++    A+YL LCEV+V+G
Sbjct:   27 NLAQSGDVKQSSTF---GAQYTAQKAVDGNKDTNMFQN---------SCSHTNNDKPS-WWQLDLKKNYNIDTIVIANRGDCCAERLLRAEIRVGNS---PDNNNPVCATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 161          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 68.5514 bits (166), Expect = 5.310e-13
Identity = 52/150 (34.67%), Postives = 79/150 (52.67%), Query Frame = 2
Query:   65 EINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVG-LTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            E+NL+ L    QSST+   + +Y+A+ A DGN   N         SCS T   N + +WQ+DL+    V +V I N+     E LR  +V + NS++    +    C+ V  V  LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  182 EVNLARLGDVKQSSTY---RPEYNAATAVDGNKNSNMM-----LGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPV----CATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 318          
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Match: sp|Q9I929|FUCL3_ANGJA (Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 1.495e-6
Identity = 44/125 (35.20%), Postives = 65/125 (52.00%), Query Frame = 2
Query:  137 ASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSF-VKSVGLTVTCKC-NDTNARFVTILKYPGADYLDLCEVQV 502
            AS A DGN    D ++ +GS  CS TE  NS  +W+VDL+ V ++T VTI N+     E +   ++++    E       EC +  + + G T T  C      R+VT+   P A+ L LCEV+V
Sbjct:   56 ASNAIDGN---RDSNYHHGS--CSHTEGDNS--WWRVDLKQVYTITSVTITNRGDCCGERISGARILIGKHLENNGINNPECSTINIMAAGETKTFHCPQPMIGRYVTVY-LPKAESLQLCEVEV 172          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: K1R1D4 (Fucolectin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10007847 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.779e-12
Identity = 57/158 (36.08%), Postives = 80/158 (50.63%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQA--KYLED----LRNFKVIL-QNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            TE N++  KP  QS+T+      + ASLA DGN   N  DF      CS T+  +++ +W VDLQ+V  +  V I+N+   K+  D    LR+  V +    S+V T  GV       S  + ++C       RFV I K    D+L LCEV+VFG P
Sbjct:    6 TEPNIALKKPAKQSTTYSWAGESFPASLAVDGN---NGTDFV--VDKCSCTKGGDTNPWWLVDLQAVYHIDYVRIFNRGMDKWGADVANRLRDVTVTVGMTESDVSTPCGVFAGPGTLSQVVDISCPNTLPMGRFVKISKT--TDFLTLCEVEVFGYP 156          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: K1RPD6 (Fucolectin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10007747 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.711e-10
Identity = 56/159 (35.22%), Postives = 78/159 (49.06%), Query Frame = 2
Query:   65 EINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQA--KYLED----LRNFKVIL-QNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIPNN 520
            E N++  KP  QS+T+        ASLA DGN   N  DF      CS T+  +++ +W VDLQ+V  +  V I+N+   K+  D    LR+  V +    S+V T  GV       S  + + C       RFV I K    D+L LCEV+VFG P+ 
Sbjct:   39 EPNIALKKPAKQSTTYSWAGESSPASLAVDGN---NGTDFV--VDKCSCTKGGDTNPWWLVDLQAVYHIDYVRIFNRGMDKWGADVANRLRDVTVTVGMTESDVSTPCGVFAGPGTLSQVVDIYCPNTLPMGRFVKISKT--TDFLTLCEVEVFGYPDQ 190          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A5G3LE81 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100127564 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.802e-10
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
             ++NL+ L   +QSSTF     KY+A+ A DGN   N       + SCS T   N + +WQ+DL+    V +V I N+     E LR  ++ + +S   P +    C +      LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  188 ADVNLARLGEASQSSTF---SPKYNAAAAIDGNKDTNMM-----AGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDS---PDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 325          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A5G3LDN3 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100127564 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.996e-10
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
             ++NL+ L   +QSSTF     KY+A+ A DGN   N       + SCS T   N + +WQ+DL+    V +V I N+     E LR  ++ + +S   P +    C +      LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  166 ADVNLARLGEASQSSTF---SPKYNAAAAIDGNKDTNMM-----AGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDS---PDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 66.2402 bits (160), Expect = 4.469e-9
Identity = 49/148 (33.11%), Postives = 75/148 (50.68%), Query Frame = 2
Query:   68 INLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            +NL+ L    QSST+   + +Y+A+ A DGN   N         SCS T   N + +WQ+DL+    V +V I N+     E LR  +V + NS++    +   C +      LT    CN    R+V+++    A+YL LCEV+V+G
Sbjct:   25 VNLARLGDVKQSSTY---RPEYNAATAVDGNKNSNMM-----LGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPV---CATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 160          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A5G3LFF0 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100127564 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.207e-10
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:   62 TEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYL-EDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
             ++NL+ L   +QSSTF     KY+A+ A DGN   N       + SCS T   N + +WQ+DL+    V +V I N+     E LR  ++ + +S   P +    C +      LT+T  C     R+V+++    A+YL LCEV+V+G
Sbjct:  166 ADVNLARLGEASQSSTF---SPKYNAAAAIDGNKDTNMM-----AGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDS---PDNNNPVCATVTDVSQLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 303          

HSP 2 Score: 60.8474 bits (146), Expect = 4.059e-7
Identity = 47/148 (31.76%), Postives = 72/148 (48.65%), Query Frame = 2
Query:   68 INLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKY-LEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            +NL+ L    QSST+   + +Y+A+ A DGN   N         SCS T   N + +WQ+DL+    V  V I N+     E LR   + + +S+     +   C +      LT    CN    R+V+++    A+YL LCEV+V+G
Sbjct:   25 VNLARLGDVRQSSTY---RPEYNAATAVDGNKNSNMM-----LGSCSHTNSDNPA-WWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVGDSANNNNPV---CATITDVSKLTFPVCCNGMEGRYVSVVISDRAEYLQLCEVEVYG 160          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.174e-12
Identity = 44/125 (35.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  146 ANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGL--TVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            A DGN   N F     S SC+ T K + S +W++DLQ    V+ +TI N+   + +  N  VI    +     +    C  + S+G   +VT +CN    R+VTI+     +YL LCEV+VFG P
Sbjct:  493 AIDGNRDGNYF-----SGSCTHT-KYDLSPWWKLDLQKTHKVSSITITNRQDAVPERLNGAVIRIGDNPAHNGIQNPKCGVISSIGKNPSVTFQCNGMKGRYVTIMIPGRKEYLTLCEVEVFGAP 611          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 57.7658 bits (138), Expect = 1.329e-9
Identity = 48/156 (30.77%), Postives = 72/156 (46.15%), Query Frame = 2
Query:   50 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYN-QAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            YP     N +     TQSS +      + AS A DGN         NG  SCS T   + S +W+VDL     V  V++ N Q  Y   L+  ++ + ++ E   +    C     +   TVT +CN    R+V ++     +YL LCEV+V+G+P
Sbjct:  168 YPTPHGQNAAVQGTATQSSLY----GYFLASGAIDGNR--------NGPGSCSFTNY-DLSPWWRVDLLKRHKVFSVSVTNSQDVYASRLKGAEIRIGDNLEDNGNNNPRCGVIESTGSPTVTFQCNGMEGRYVNVVISGRREYLTLCEVEVYGVP 310          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 57.7658 bits (138), Expect = 1.355e-9
Identity = 48/156 (30.77%), Postives = 72/156 (46.15%), Query Frame = 2
Query:   50 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYN-QAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            YP     N +     TQSS +      + AS A DGN         NG  SCS T   + S +W+VDL     V  V++ N Q  Y   L+  ++ + ++ E   +    C     +   TVT +CN    R+V ++     +YL LCEV+V+G+P
Sbjct:  168 YPTPHGQNAAVQGTATQSSLY----GYFLASGAIDGNR--------NGPGSCSFTNY-DLSPWWRVDLLKRHKVFSVSVTNSQDVYASRLKGAEIRIGDNLEDNGNNNPRCGVIESTGSPTVTFQCNGMEGRYVNVVISGRREYLTLCEVEVYGVP 310          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 57.7658 bits (138), Expect = 1.367e-9
Identity = 48/156 (30.77%), Postives = 72/156 (46.15%), Query Frame = 2
Query:   50 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYN-QAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            YP     N +     TQSS +      + AS A DGN         NG  SCS T   + S +W+VDL     V  V++ N Q  Y   L+  ++ + ++ E   +    C     +   TVT +CN    R+V ++     +YL LCEV+V+G+P
Sbjct:  149 YPTPHGQNAAVQGTATQSSLY----GYFLASGAIDGNR--------NGPGSCSFTNY-DLSPWWRVDLLKRHKVFSVSVTNSQDVYASRLKGAEIRIGDNLEDNGNNNPRCGVIESTGSPTVTFQCNGMEGRYVNVVISGRREYLTLCEVEVYGVP 291          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 57.7658 bits (138), Expect = 1.368e-9
Identity = 48/156 (30.77%), Postives = 72/156 (46.15%), Query Frame = 2
Query:   50 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYN-QAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            YP     N +     TQSS +      + AS A DGN         NG  SCS T   + S +W+VDL     V  V++ N Q  Y   L+  ++ + ++ E   +    C     +   TVT +CN    R+V ++     +YL LCEV+V+G+P
Sbjct:  151 YPTPHGQNAAVQGTATQSSLY----GYFLASGAIDGNR--------NGPGSCSFTNY-DLSPWWRVDLLKRHKVFSVSVTNSQDVYASRLKGAEIRIGDNLEDNGNNNPRCGVIESTGSPTVTFQCNGMEGRYVNVVISGRREYLTLCEVEVYGVP 293          
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Match: EDO35325 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLV7])

HSP 1 Score: 46.2098 bits (108), Expect = 4.432e-6
Identity = 47/155 (30.32%), Postives = 73/155 (47.10%), Query Frame = 2
Query:   56 INTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKV-----ILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVF 505
            +N   NL+  K T QS+T     +   AS A DGN    D D+  G  SC+ T+    + +W+VDL     V+ V + N+A   E L+N +V     +  N +  P  L  +  S      L++ CK   +  R+V +     +  L LCEV+V+
Sbjct:  139 LNPSANLALSKSTAQSTT----DHSGDASRAVDGN---TDGDY--GRGSCTHTQDQ-PNPWWRVDLGITQPVSEVFLVNRASGSEILQNAEVRVGDDLTDNGNTNP--LCGDMFSMATLQKLSIYCKPRRS-GRYVNVRLVGASMVLTLCEVEVY 280          
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Match: EDO35302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU7])

HSP 1 Score: 45.8246 bits (107), Expect = 5.136e-6
Identity = 45/152 (29.61%), Postives = 73/152 (48.03%), Query Frame = 2
Query:   59 NTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECC---SFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVF 505
            N  +NL+  KPTTQ S +        AS A DGN    D  F  GS  C+ T  ++++ +W+VDL +   V+ V + N+    + L+N +V + +S    ++    C    S      L++ CK   +  R+V +        L LCEV+V+
Sbjct:  122 NPTVNLALKKPTTQISLY----GAGYASRAVDGN---TDGIFSRGS--CTHT-NAHTNPWWRVDLGTTQPVSEVFLVNRVTDSQRLQNAEVRVGDSLTDNSNTNPRCGDMFSMATLQKLSIYCKPRRS-GRYVNVRLVGANMVLTLCEVEVY 262          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000013679.1 (SMESG000013679.1)

HSP 1 Score: 323.168 bits (827), Expect = 7.054e-114
Identity = 158/158 (100.00%), Postives = 158/158 (100.00%), Query Frame = 2
Query:   50 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIPNNG 523
            YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIPNNG
Sbjct:    7 YPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIPNNG 164          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000014445.1 (SMESG000014445.1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.471e-11
Identity = 53/154 (34.42%), Postives = 77/154 (50.00%), Query Frame = 2
Query:   59 NTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLGVEC--CSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            N ++ LS  KP +QSS ++     + AS A DGNL Q+          CS T K +S  +W VDLQ   ++T VTI+N+  ++ + R    I+    EV  S GV    C  +K+       +C       V I +    +YL LCEVQV+G+P
Sbjct:   15 NCDVMLSQGKPASQSSDYL----SFVASYAVDGNLGQS-----LNKDKCSHTNK-DSQPWWMVDLQGSYTITSVTIFNRNSFVSN-RLVGAIV----EVLDSNGVVVSRCGKIKTDDSVHILRCKKRIGSKVRI-RMARPEYLTLCEVQVYGLP 152          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000014428.1 (SMESG000014428.1)

HSP 1 Score: 58.9214 bits (141), Expect = 6.922e-11
Identity = 52/155 (33.55%), Postives = 77/155 (49.68%), Query Frame = 2
Query:   56 INTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLEDLRNFKVILQNSSEVPTSLG--VECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFGIP 514
            +N ++ LS  KP +QSS ++     + AS A DGN+ Q+          CS T K +S  +W VDLQ   ++T V I+N+  ++ + R    I+    EV  S G  V  C  VK+        C  +    V I +    +YL LCEVQV+G+P
Sbjct:   14 VNCDVMLSQGKPASQSSDYL----SFVASYAVDGNVGQS-----LNKDKCSHTNK-DSQPWWMVDLQGSYAITSVIIFNRNSFVSN-RLVGAIV----EVLDSNGLVVSRCGEVKTDDSVHLLHCQKSRGSKVRI-RMTRPEYLTLCEVQVYGLP 152          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000014441.1 (SMESG000014441.1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.727e-7
Identity = 47/155 (30.32%), Postives = 70/155 (45.16%), Query Frame = 2
Query:   56 INTEINLSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYN-QAKYLEDLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVT--ILKYPGADYLDLCEVQVFGI 511
            I  E+ LS  KP  QSS +      Y A  A DGN  Q+          CS T   N   +W V+L   + +T VTI+N Q ++ E +    V + + ++  T L    C  V +    +   CN     F +   +K    +YL LCEV+V+G+
Sbjct:   14 IYCELLLSRGKPAYQSSVY----EDYHAGYAVDGNNGQHL-----EKHKCSQTSNDNRP-WWMVNLTVEAKITLVTIFNRQDQFSERIEGAVVEVLDKNDEVTGL----CGIVMADNSVINLWCNQRAGIFGSKVRVKLERQEYLTLCEVEVYGV 154          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000014488.1 (SMESG000014488.1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.993e-7
Identity = 46/147 (31.29%), Postives = 76/147 (51.70%), Query Frame = 2
Query:   74 LSYLKPTTQSSTFVLNQNKYSASLANDGNLFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAK-YLEDLRNFKV-ILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILKYPGADYLDLCEVQVFG 508
            LS+ KPT QSST ++++ + ++  A DGN  Q   + P    + S T   N+S FW+VDL + S ++ VTIYN+    L  +    + IL N  +V   +GV  C  +K+     +  C     + V + + P    L + E++V+G
Sbjct:   23 LSWQKPTIQSSTAIVDEIRMASGYAVDGNTEQRQSN-PFEPLTFSQTNTENNS-FWRVDLIAKSIISNVTIYNRLDCCLNGIVGAVIEILSNRDKV---IGV--CGVIKTFREINSFDCKYAFGQKVRV-RLPRRGNLTMIELEVYG 161          
The following BLAST results are available for this feature:
BLAST of Si:ch211-215k15.4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:cabz01040626.24.861e-728.38si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
si:cabz01040626.25.458e-728.38si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
si:ch211-215k15.47.410e-729.30si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch73-359m17.27.776e-731.33si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch211-215k15.48.485e-729.30si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fucolectin1.784e-1333.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin1.908e-1333.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin2.043e-1333.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin2.159e-1333.33x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin5.310e-1334.67x-epilectin [Source:NCBI gene;Acc:100144955][more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9I929|FUCL3_ANGJA1.495e-635.20Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R1D41.779e-1236.08Fucolectin-1 OS=Crassostrea gigas OX=29159 GN=CGI_... [more]
K1RPD61.711e-1035.22Fucolectin-1 OS=Crassostrea gigas OX=29159 GN=CGI_... [more]
A0A5G3LE812.802e-1033.33Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A5G3LDN32.996e-1033.33Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A5G3LFF03.207e-1033.33Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000008051.21.174e-1235.20pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
si:ch211-215k15.41.329e-930.77si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch211-215k15.41.355e-930.77si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch211-215k15.41.367e-930.77si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch211-215k15.41.368e-930.77si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO353254.432e-630.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353025.136e-629.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013679.17.054e-114100.00SMESG000013679.1[more]
SMESG000014445.11.471e-1134.42SMESG000014445.1[more]
SMESG000014428.16.922e-1133.55SMESG000014428.1[more]
SMESG000014441.11.727e-730.32SMESG000014441.1[more]
SMESG000014488.11.993e-731.29SMESG000014488.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025475 ID=SMED30025475|Name=Si:ch211-215k15.4|organism=Schmidtea mediterranea sexual|type=transcript|length=710bp
ATTTTTTTAAATGATGATTTTGTGTTTCATGATGTTTATCATTTTTATTT
ATCCCATAAACACTGAAATCAATTTATCATATTTAAAACCTACAACACAA
TCGTCAACATTTGTTCTTAATCAAAACAAATATTCCGCATCTTTAGCAAA
TGATGGAAACCTTTTTCAGAATGATTTTGACTTTCCAAATGGGTCCGCAT
CTTGTTCTTCTACTGAAAAATCCAATTCCTCTCACTTTTGGCAAGTGGAT
TTACAATCAGTTTCCTCGGTGACAAGGGTCACGATTTACAACCAAGCTAA
ATATTTAGAGGATCTAAGGAATTTTAAAGTTATTTTACAAAATTCAAGTG
AAGTTCCTACAAGTTTAGGAGTTGAATGCTGCTCGTTTGTTAAAAGTGTT
GGTTTGACTGTTACATGTAAATGCAATGACACAAATGCTAGATTCGTAAC
TATTCTTAAATATCCAGGAGCGGATTACCTTGACTTGTGTGAAGTTCAAG
TTTTTGGCATTCCTAATAATGGTTAATTTGATTTTAAGTTTTATCATTTC
TTATTACTTTTATTAATATTATTGTTAGAAAAAAAAAATTATATTCTATA
ATTAAAGCAAATAGCATTTTAATCATTCAATAAAATAAATTAATAAATAT
TAGATATTTACCATAGTAATTCTAAAACTGATATATATATATATGAAAAC
TAGAAAACGC
back to top

protein sequence of SMED30025475-orf-1

>SMED30025475-orf-1 ID=SMED30025475-orf-1|Name=SMED30025475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MMILCFMMFIIFIYPINTEINLSYLKPTTQSSTFVLNQNKYSASLANDGN
LFQNDFDFPNGSASCSSTEKSNSSHFWQVDLQSVSSVTRVTIYNQAKYLE
DLRNFKVILQNSSEVPTSLGVECCSFVKSVGLTVTCKCNDTNARFVTILK
YPGADYLDLCEVQVFGIPNNG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006585FTP1
IPR008979Galactose-bd-like_sf