Heat shock protein 75 kDa, mitochondrial

Overview
NameHeat shock protein 75 kDa, mitochondrial
Smed IDSMED30025467
Length (bp)2124
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock protein 75 kDa, mitochondrial (SMED30025467) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock protein 75 kDa, mitochondrial (SMED30025467) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock protein 75 kDa, mitochondrial (SMED30025467) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock protein 75 kDa, mitochondrial (SMED30025467) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025467

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025467h1SMcG0020885 SmedASXL_005987SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025467h1SMcG0020885 SmedASXL_005987SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30025467h1SMcG0020886 Contig39081uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025467h1SMcG0020886 Contig39081newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025467h1SMcG0020885 dd_Smed_v4_1445_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025467h1SMcG0020885 Contig48898newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025467h1SMcG0020885 Contig48898uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025467h1SMcG0020885 Contig39081uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025467h1SMcG0020885 Contig39081newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gamma neoblastSMED30025467h1SMcG0020885 dd_Smed_v6_1445_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30025467h1SMcG0020885 dd_Smed_v6_1445_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Human
Match: TRAP1 (TNF receptor associated protein 1 [Source:HGNC Symbol;Acc:HGNC:16264])

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 333/663 (50.23%), Postives = 474/663 (71.49%), Query Frame = 1
Query:  112 CSKTFSSEAAVNSED-IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRY-LRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND-GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIET---------EHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
              + FS++ A + E+ +H II  +E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SNASDALEKLR+ L + G     + L   EIH++T+  K    IQDTGIGMT+EE++ NLGTIARSGS  FLD ++N+      IIG+FGVGFYS+FMVAD+VEV+SRS      G+ W S G SG +EI+EA  V  GTKII+HLKSDCKEFS E  +  ++ KYSN+V   +YLNG++++ +Q +W+  P +V E +H EFY+Y+    +D PRY ++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV +T+Q  KE+I KLLR+ESS LP+G+ TS  EY+ RM+AG+R I++  AP R +AEHSPY EA+K+KD EVL+  E +DE+ ++ L  F+ K L S+ET         E  ED S     +C +E+     + EEL  W+   +  +V NVK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H+L+KKL +L  ++  LA++L++Q+++NA++ AGLV D RA +G LNELL KA E+
Sbjct:   55 AGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDG-----QALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDG-SGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYV-AQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPA--AECLSEK-----ETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALER 703          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Human
Match: TRAP1 (TNF receptor associated protein 1 [Source:HGNC Symbol;Acc:HGNC:16264])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 325/635 (51.18%), Postives = 458/635 (72.13%), Query Frame = 1
Query:  193 GNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRY-LRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND-GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIET---------EHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SNASDALEKLR+ L + G     + L   EIH++T+  K    IQDTGIGMT+EE++ NLGTIARSGS  FLD ++N+      IIG+FGVGFYS+FMVAD+VEV+SRS      G+ W S G SG +EI+EA  V  GTKII+HLKSDCKEFS E  +  ++ KYSN+V   +YLNG++++ +Q +W+  P +V E +H EFY+Y+    +D PRY ++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV +T+Q  KE+I KLLR+ESS LP+G+ TS  EY+ RM+AG+R I++  AP R +AEHSPY EA+K+KD EVL+  E +DE+ ++ L  F+ K L S+ET         E  ED S     +C +E+     + EEL  W+   +  +V NVK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H+L+KKL +L  ++  LA++L++Q+++NA++ AGLV D RA +G LNELL KA E+
Sbjct:   30 GSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDG-----QALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDG-SGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYV-AQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAA--ECLSEK-----ETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALER 650          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Human
Match: TRAP1 (TNF receptor associated protein 1 [Source:HGNC Symbol;Acc:HGNC:16264])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 245/503 (48.71%), Postives = 358/503 (71.17%), Query Frame = 1
Query:  586 MVADKVEVFSRSHRSND-GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIET---------EHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            MVAD+VEV+SRS      G+ W S G SG +EI+EA  V  GTKII+HLKSDCKEFS E  +  ++ KYSN+V   +YLNG++++ +Q +W+  P +V E +H EFY+Y+    +D PRY ++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV +T+Q  KE+I KLLR+ESS LP+G+ TS  EY+ RM+AG+R I++  AP R +AEHSPY EA+K+KD EVL+  E +DE+ ++ L  F+ K L S+ET         E  ED S     +C +E+     + EEL  W+   +  +V NVK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H+L+KKL +L  ++  LA++L++Q+++NA++ AGLV D RA +G LNELL KA E+
Sbjct:    1 MVADRVEVYSRSAAPGSLGYQWLSDG-SGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYV-AQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAA--ECLSEK-----ETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALER 494          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Human
Match: HSP90B1 (heat shock protein 90 beta family member 1 [Source:HGNC Symbol;Acc:HGNC:12028])

HSP 1 Score: 306.99 bits (785), Expect = 1.264e-92
Identity = 218/686 (31.78%), Postives = 352/686 (51.31%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENL----KPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV--KNEDAKLDS-IIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSY-EISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKK--------------------------------------------------ISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT-LYE--ISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGR---VIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSE-DASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE---EKFMLMSATMELNPTHSLVKKLVELHKTDEELAKM--LINQLHQNALVQAG-LVTDSRASIGNLNELL 2046
            F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R +      L DEN     +   + IK D+ KNL  + DTG+GMT+EE++KNLGTIA+SG+SEFL+K+    ED +  S +IG+FGVGFYS+F+VADKV V S+ H ++    W+S     S       + +  GT I L LK +  ++ +   I+ ++ KYS ++   IY+   K                                                  ++ ++P+W +    V E E+  FYK  +  + D P   I+F  +  +  KS+ ++P+  P  L++   S++SD  + LY R+V I      ++P +L F+KGVV+SDD+PLN+SRE LQ   L+  I + L  +   +IK + D    D      F  +FG  +K G++   D S +  + KLLRF+SS  P    TS  +Y ERMK    KI+F +  +R+ AE SP++E + +K  EV+YL EP DE  +  L  F+GK   ++  E  + D S          +   +++ E L  W+ +K +K K+    ++QRLT  PC +     G    +   +K       ++     +     T E+NP H L++ ++   K DE+   +  L   L + A +++G L+ D++A    +  +L
Sbjct:   78 FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLI-----SLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSK-HNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKES-DDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDY-IKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDT-----FWKEFGTNIKLGVIE--DHSNRTRLAKLLRFQSSHHPTD-ITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESE----KTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERML 743          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Human
Match: TRAP1 (TNF receptor associated protein 1 [Source:HGNC Symbol;Acc:HGNC:16264])

HSP 1 Score: 238.424 bits (607), Expect = 1.544e-73
Identity = 108/211 (51.18%), Postives = 156/211 (73.93%), Query Frame = 1
Query:  604 EVFSRSHRSND-GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIK 1233
            EV+SRS      G+ W S G SG +EI+EA  V  GTKII+HLKSDCKEFS E  +  ++ KYSN+V   +YLNG++++ +Q +W+  P +V E +H EFY+Y+    +D PRY ++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK
Sbjct:    7 EVYSRSAAPGSLGYQWLSDG-SGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYV-AQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIK 215          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Celegans
Match: hsp-75 (Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H2L001])

HSP 1 Score: 482.641 bits (1241), Expect = 7.762e-162
Identity = 254/626 (40.58%), Postives = 395/626 (63.10%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND--GFYWQSSGTSGSYEISEADEVEHGTKIILHLK-SDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGN-----TYDSPRYVINFRIDVPLDIKSLFYIPSRK-PTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKP-KVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLT 2049
            +  EF+AETR L+DIVAKSLYS  EVF+REL+SNASDALEK RY    G    D    P EI I T++ K     +DTGIGM +E+++K LGTIA+SGS +F++   N     +++IG+FGVGFYS+FMVAD V V +R   S+D  G  W  +G   SYEI+E   ++ GTKI + LK  D   +++E  I+++INKYS +V + I +NG++++ +  +W      V +  H  F+K +         Y  P+Y I+F+ D P+ ++S+ YIP  +   L  +++++  G+SLY+R+V+I    Q+L+PN+LRF+ GVV+S+DIPLNLSRE+LQ++ ++ K+ +++T +++  L  + K+D  KY +F  ++ LY KEG+V   DQ  KE++ KLL FESS   AG+ TS  +Y +RM+ G ++I++  A  R++AE SPY E IK ++ EVL+L +P DE+V + LG F  K L  +E    E+A      D  + +     + +EL  W+++ +   +V+ +    R + HP +++V +MGA RHF++T  I   + E  +     + +N TH LVK + ++ KTD+E A +L  Q++ NAL+ AGL+ D+   +G LN+LLT
Sbjct:   43 QRHEFQAETRNLMDIVAKSLYSHSEVFVRELISNASDALEKRRYAELKG----DVAEGPSEIRITTNKDKRTITFEDTGIGMNREDLVKFLGTIAKSGSKDFIE---NNKENAEAVIGQFGVGFYSAFMVADSVVVTTRKVGSSDADGLQWTWNG-DNSYEIAETSGLQTGTKIEIRLKVGDSATYAEEDRIKEVINKYSYFVSAPILVNGERVNNLNAIWTMQAREVNKEMHETFFKQLVKTQGKQEMYTRPQYTIHFQTDTPVSLRSVIYIPQTQFNQLTFMAQQTMCGLSLYARRVLIKPDAQELIPNYLRFVIGVVDSEDIPLNLSREMLQNNPVLRKLRKIITDKILGSLQSEMKKDPVKYSEFFKNYSLYFKEGVVTEQDQGVKEDVAKLLLFESSSKKAGELTSLGDYVKRMQEGQKEIYYMYANNRQLAESSPYYEVIKSQNKEVLFLYDPADEVVFLGLGQFGMKQLVPVEKWAQEEAEKTGTDDKKDTKDFRDNEKKELLDWMKETLGSVRVSEISGNHRPSEHPVMVTVLDMGAARHFLRTGEIK--DMEHLVYFKPHVHVNLTHPLVKAMYKMRKTDKETAAILAEQIYDNALITAGLIKDTSRMVGRLNKLLT 658          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Celegans
Match: hsp-75 (Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H2L001])

HSP 1 Score: 482.641 bits (1241), Expect = 7.762e-162
Identity = 254/626 (40.58%), Postives = 395/626 (63.10%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND--GFYWQSSGTSGSYEISEADEVEHGTKIILHLK-SDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGN-----TYDSPRYVINFRIDVPLDIKSLFYIPSRK-PTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKP-KVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLT 2049
            +  EF+AETR L+DIVAKSLYS  EVF+REL+SNASDALEK RY    G    D    P EI I T++ K     +DTGIGM +E+++K LGTIA+SGS +F++   N     +++IG+FGVGFYS+FMVAD V V +R   S+D  G  W  +G   SYEI+E   ++ GTKI + LK  D   +++E  I+++INKYS +V + I +NG++++ +  +W      V +  H  F+K +         Y  P+Y I+F+ D P+ ++S+ YIP  +   L  +++++  G+SLY+R+V+I    Q+L+PN+LRF+ GVV+S+DIPLNLSRE+LQ++ ++ K+ +++T +++  L  + K+D  KY +F  ++ LY KEG+V   DQ  KE++ KLL FESS   AG+ TS  +Y +RM+ G ++I++  A  R++AE SPY E IK ++ EVL+L +P DE+V + LG F  K L  +E    E+A      D  + +     + +EL  W+++ +   +V+ +    R + HP +++V +MGA RHF++T  I   + E  +     + +N TH LVK + ++ KTD+E A +L  Q++ NAL+ AGL+ D+   +G LN+LLT
Sbjct:   43 QRHEFQAETRNLMDIVAKSLYSHSEVFVRELISNASDALEKRRYAELKG----DVAEGPSEIRITTNKDKRTITFEDTGIGMNREDLVKFLGTIAKSGSKDFIE---NNKENAEAVIGQFGVGFYSAFMVADSVVVTTRKVGSSDADGLQWTWNG-DNSYEIAETSGLQTGTKIEIRLKVGDSATYAEEDRIKEVINKYSYFVSAPILVNGERVNNLNAIWTMQAREVNKEMHETFFKQLVKTQGKQEMYTRPQYTIHFQTDTPVSLRSVIYIPQTQFNQLTFMAQQTMCGLSLYARRVLIKPDAQELIPNYLRFVIGVVDSEDIPLNLSREMLQNNPVLRKLRKIITDKILGSLQSEMKKDPVKYSEFFKNYSLYFKEGVVTEQDQGVKEDVAKLLLFESSSKKAGELTSLGDYVKRMQEGQKEIYYMYANNRQLAESSPYYEVIKSQNKEVLFLYDPADEVVFLGLGQFGMKQLVPVEKWAQEEAEKTGTDDKKDTKDFRDNEKKELLDWMKETLGSVRVSEISGNHRPSEHPVMVTVLDMGAARHFLRTGEIK--DMEHLVYFKPHVHVNLTHPLVKAMYKMRKTDKETAAILAEQIYDNALITAGLIKDTSRMVGRLNKLLT 658          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Celegans
Match: hsp-75 (Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H2L001])

HSP 1 Score: 343.969 bits (881), Expect = 9.249e-111
Identity = 180/415 (43.37%), Postives = 271/415 (65.30%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND--GFYWQSSGTSGSYEISEADEVEHGTKIILHLK-SDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGN-----TYDSPRYVINFRIDVPLDIKSLFYIPSRK-PTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEY 1419
            +  EF+AETR L+DIVAKSLYS  EVF+REL+SNASDALEK RY    G    D    P EI I T++ K     +DTGIGM +E+++K LGTIA+SGS +F++   N     +++IG+FGVGFYS+FMVAD V V +R   S+D  G  W  +G   SYEI+E   ++ GTKI + LK  D   +++E  I+++INKYS +V + I +NG++++ +  +W      V +  H  F+K +         Y  P+Y I+F+ D P+ ++S+ YIP  +   L  +++++  G+SLY+R+V+I    Q+L+PN+LRF+ GVV+S+DIPLNLSRE+LQ++ ++ K+ +++T +++  L  + K+D  KY +F  ++ LY KEG+V   DQ  KE++ KLL FESS   AG+ TS  +Y
Sbjct:   43 QRHEFQAETRNLMDIVAKSLYSHSEVFVRELISNASDALEKRRYAELKG----DVAEGPSEIRITTNKDKRTITFEDTGIGMNREDLVKFLGTIAKSGSKDFIE---NNKENAEAVIGQFGVGFYSAFMVADSVVVTTRKVGSSDADGLQWTWNG-DNSYEIAETSGLQTGTKIEIRLKVGDSATYAEEDRIKEVINKYSYFVSAPILVNGERVNNLNAIWTMQAREVNKEMHETFFKQLVKTQGKQEMYTRPQYTIHFQTDTPVSLRSVIYIPQTQFNQLTFMAQQTMCGLSLYARRVLIKPDAQELIPNYLRFVIGVVDSEDIPLNLSREMLQNNPVLRKLRKIITDKILGSLQSEMKKDPVKYSEFFKNYSLYFKEGVVTEQDQGVKEDVAKLLLFESSSKKAGELTSLGDY 449          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Celegans
Match: hsp-75 (Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H2L001])

HSP 1 Score: 343.969 bits (881), Expect = 9.249e-111
Identity = 180/415 (43.37%), Postives = 271/415 (65.30%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND--GFYWQSSGTSGSYEISEADEVEHGTKIILHLK-SDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGN-----TYDSPRYVINFRIDVPLDIKSLFYIPSRK-PTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEY 1419
            +  EF+AETR L+DIVAKSLYS  EVF+REL+SNASDALEK RY    G    D    P EI I T++ K     +DTGIGM +E+++K LGTIA+SGS +F++   N     +++IG+FGVGFYS+FMVAD V V +R   S+D  G  W  +G   SYEI+E   ++ GTKI + LK  D   +++E  I+++INKYS +V + I +NG++++ +  +W      V +  H  F+K +         Y  P+Y I+F+ D P+ ++S+ YIP  +   L  +++++  G+SLY+R+V+I    Q+L+PN+LRF+ GVV+S+DIPLNLSRE+LQ++ ++ K+ +++T +++  L  + K+D  KY +F  ++ LY KEG+V   DQ  KE++ KLL FESS   AG+ TS  +Y
Sbjct:   43 QRHEFQAETRNLMDIVAKSLYSHSEVFVRELISNASDALEKRRYAELKG----DVAEGPSEIRITTNKDKRTITFEDTGIGMNREDLVKFLGTIAKSGSKDFIE---NNKENAEAVIGQFGVGFYSAFMVADSVVVTTRKVGSSDADGLQWTWNG-DNSYEIAETSGLQTGTKIEIRLKVGDSATYAEEDRIKEVINKYSYFVSAPILVNGERVNNLNAIWTMQAREVNKEMHETFFKQLVKTQGKQEMYTRPQYTIHFQTDTPVSLRSVIYIPQTQFNQLTFMAQQTMCGLSLYARRVLIKPDAQELIPNYLRFVIGVVDSEDIPLNLSREMLQNNPVLRKLRKIITDKILGSLQSEMKKDPVKYSEFFKNYSLYFKEGVVTEQDQGVKEDVAKLLLFESSSKKAGELTSLGDY 449          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Celegans
Match: hsp-90 (Heat shock protein 90 [Source:UniProtKB/Swiss-Prot;Acc:Q18688])

HSP 1 Score: 330.102 bits (845), Expect = 8.416e-103
Identity = 207/660 (31.36%), Postives = 360/660 (54.55%), Query Frame = 1
Query:  196 NLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISEAD--EVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSI------------------------------------------------YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGL 2001
            N E   F+AE  +L+ ++  + YS+KE+++REL+SNASDAL+K+RY   T     D   + F I I  ++ +    I DTGIGMTK +++ NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+F+VADKV V S+++  +D + W+SS   GS+ +   +  EV  GTKI++H+K D  +F +ER I++I+ K+S ++G  I                                                Y   ++++  +P+W ++P++++  E+ EFYK ++ N ++    V +F ++  L+ ++L ++P R P  L+E +++S   + LY R+V IM   ++L+P +L F+KGVV+S+D+PLN+SRE+LQ S ++  I + L  + ++ L D+   D + + +F+  FG  LK GI    D + ++ +   LR+ +S     + TS +EY  RMK    +I++ +  ++++   S ++E +K +  EVLY+ +P DE  + QL  ++GK L S+  E  E            E  +  E    L   I+  ++ KV  V ++ RL + PC +     G    +   +K   +  +    +M     +E+NP H+++K L   VE+ K D+ + K L+  L + AL+ +G 
Sbjct:    4 NAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDTGKELF-IKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAFLVADKVVVTSKNN-DDDSYQWESSA-GGSFVVRPFNDPEVTRGTKIVMHIKEDQIDFLEERKIKEIVKKHSQFIGYPIKLVVEKEREKEVEDEEAVEAKDEEKKEGEVENVADDADKKKTKKIKEKYFEDEELNKTKPIWTRNPDDISNEEYAEFYKSLS-NDWEDHLAVKHFSVEGQLEFRALLFVPQRAPFDLFE-NKKSKNSIKLYVRRVFIMENCEELMPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCME-LIDEVAEDKDNFKKFYEQFGKNLKLGI--HEDSTNRKKLSDFLRYSTS--AGDEPTSLKEYVSRMKENQTQIYYITGESKDVVAASAFVERVKSRGFEVLYMCDPIDEYCVQQLKEYDGKKLVSVTKEGLELPETEEEKKKFEEDKVAYEN---LCKVIKDILEKKVEKVGVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRDRVEVDKNDKTV-KDLVVLLFETALLASGF 646          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Fly
Match: Trap1 (gene:FBgn0026761 transcript:FBtr0086149)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 319/633 (50.39%), Postives = 454/633 (71.72%), Query Frame = 1
Query:  199 LEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENL----KPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDS-----IIGKFGVGFYSSFMVADKVEVFSRSHRSN-DGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKL-PAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            ++  EF+AETR+LLDIVA+SLYSD EVF+REL+SNASDALEK RY   T L  G ENL    +P EI I TD+     IIQDTGIGMTKEE++ NLGTIARSGS +FL+++K       S     IIG+FGVGFYSSF+VA+KVEVF+R+   N  G  W + G SG+YEI E  +VE GT+I+LHLK+DC+E++DE  I+ +I KYSN+VGS I LNGK+ + ++PLWL  P ++++ +H +FY++I+ N++D PR+ +++  DVPL I +L Y P  KP L+E+SR+ + GV+LY+RKV+I S+T+ LLP WLRF+KGVV+S+DIPLNLSRELLQ+S+LI K++ V++ RVI++L +++K+  E+Y  F+ D+GL+LKEGIV S+D SEKE I KLLRFESSK   A    S +EY   + A  + I++ +AP R +AE SPY E++K+++  VL+  EPYDE+V+MQLG F+ K L S+E E  E++          E S+ + + + L  W+E++++ +V  VK T RL THPC+++V+ M A RHFI+T      E+ +F L+   +E+NP H ++KKL +L ++D++LA+++  QL  NA+V AGL  D R  + N+N LL++A EK
Sbjct:   63 VDKHEFQAETRQLLDIVARSLYSDHEVFVRELISNASDALEKFRY---TSLSAGGENLAGKDRPLEIRITTDKPLMQLIIQDTGIGMTKEELVSNLGTIARSGSKKFLEQMKGTQQGASSEASSNIIGQFGVGFYSSFIVANKVEVFTRAAVPNAPGLRWSTDG-SGTYEIEEVPDVELGTRIVLHLKTDCREYADEERIKAVIKKYSNFVGSPILLNGKQANEIKPLWLLEPQSISKEQHHDFYRFIS-NSFDVPRFTLHYNADVPLSIHALLYFPEGKPGLFEMSRDGNTGVALYTRKVLIQSKTEHLLPKWLRFVKGVVDSEDIPLNLSRELLQNSSLIRKLSSVISTRVIRFLQERSKKQPEEYEAFYRDYGLFLKEGIVTSSDASEKEEIAKLLRFESSKSETASGRMSLEEYYNAVPAEQQNIYYLAAPNRVLAESSPYYESLKKRNELVLFCYEPYDELVLMQLGKFKSKKLVSVEKEMREESKETTATTDFGEGSLLRSELDTLIPWLEEELRGQVIKVKATTRLDTHPCVITVEEMAAARHFIRTQSHQVPEQNRFALLQPELEINPKHPIIKKLNKLRESDKDLAQLIAKQLFANAMVGAGLAEDPRMLLTNMNTLLSRALEK 690          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Fly
Match: Trap1 (gene:FBgn0026761 transcript:FBtr0336666)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 319/633 (50.39%), Postives = 454/633 (71.72%), Query Frame = 1
Query:  199 LEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENL----KPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDS-----IIGKFGVGFYSSFMVADKVEVFSRSHRSN-DGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKL-PAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            ++  EF+AETR+LLDIVA+SLYSD EVF+REL+SNASDALEK RY   T L  G ENL    +P EI I TD+     IIQDTGIGMTKEE++ NLGTIARSGS +FL+++K       S     IIG+FGVGFYSSF+VA+KVEVF+R+   N  G  W + G SG+YEI E  +VE GT+I+LHLK+DC+E++DE  I+ +I KYSN+VGS I LNGK+ + ++PLWL  P ++++ +H +FY++I+ N++D PR+ +++  DVPL I +L Y P  KP L+E+SR+ + GV+LY+RKV+I S+T+ LLP WLRF+KGVV+S+DIPLNLSRELLQ+S+LI K++ V++ RVI++L +++K+  E+Y  F+ D+GL+LKEGIV S+D SEKE I KLLRFESSK   A    S +EY   + A  + I++ +AP R +AE SPY E++K+++  VL+  EPYDE+V+MQLG F+ K L S+E E  E++          E S+ + + + L  W+E++++ +V  VK T RL THPC+++V+ M A RHFI+T      E+ +F L+   +E+NP H ++KKL +L ++D++LA+++  QL  NA+V AGL  D R  + N+N LL++A EK
Sbjct:   63 VDKHEFQAETRQLLDIVARSLYSDHEVFVRELISNASDALEKFRY---TSLSAGGENLAGKDRPLEIRITTDKPLMQLIIQDTGIGMTKEELVSNLGTIARSGSKKFLEQMKGTQQGASSEASSNIIGQFGVGFYSSFIVANKVEVFTRAAVPNAPGLRWSTDG-SGTYEIEEVPDVELGTRIVLHLKTDCREYADEERIKAVIKKYSNFVGSPILLNGKQANEIKPLWLLEPQSISKEQHHDFYRFIS-NSFDVPRFTLHYNADVPLSIHALLYFPEGKPGLFEMSRDGNTGVALYTRKVLIQSKTEHLLPKWLRFVKGVVDSEDIPLNLSRELLQNSSLIRKLSSVISTRVIRFLQERSKKQPEEYEAFYRDYGLFLKEGIVTSSDASEKEEIAKLLRFESSKSETASGRMSLEEYYNAVPAEQQNIYYLAAPNRVLAESSPYYESLKKRNELVLFCYEPYDELVLMQLGKFKSKKLVSVEKEMREESKETTATTDFGEGSLLRSELDTLIPWLEEELRGQVIKVKATTRLDTHPCVITVEEMAAARHFIRTQSHQVPEQNRFALLQPELEINPKHPIIKKLNKLRESDKDLAQLIAKQLFANAMVGAGLAEDPRMLLTNMNTLLSRALEK 690          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Fly
Match: Gp93 (gene:FBgn0039562 transcript:FBtr0085254)

HSP 1 Score: 297.36 bits (760), Expect = 1.571e-89
Identity = 206/664 (31.02%), Postives = 346/664 (52.11%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFL----DKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSY-EISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL----------------------------------------NGKKISMM----------QPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT--LYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKH-TSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSL------IDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDE--ELAKMLINQLHQNALVQAGLV 2004
            F+ E  +++ ++  SLY +KE+F+REL+SNASDA++K+R L  +  +  + N +   I IK D+      I D+GIGMT +++I NLGTIA+SG+++FL    D  K+E   ++ +IG+FGVGFYS+F+VAD+V V +  H  +  + W+S   S S  E    D ++ G+ I L+LK + ++F +E  + ++I KYS ++   I +                                          KK+S            +P+W + P  VTE E+  FYK +T ++ + P    +F  +  +  KSL Y+P  +P+        +SD  + LY R+V I      ++PN+L F++GVV+SDD+PLN+SRE LQ   LI  I + L  +V+  L    K D E Y +F  +F   +K G++   D S +  + KLLRF++S    GK  TS  EY ERMKA    I++ +   R   E SP++E +  K  EVLYL+E  DE  +  L  F+GK   ++  E  +   N +     N +S+ +   E L  W+ +  +K +++  ++++RL+  PC +     G   +  + ++       D  +   ++    T+E+NP H L+++L+   + DE  + AK +   + + A +++G +
Sbjct:   77 FQTEVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLALSNSKELETNPE-LHIRIKADKENKALHIMDSGIGMTHQDLINNLGTIAKSGTADFLAKMQDPSKSEGLDMNDMIGQFGVGFYSAFLVADRV-VVTTKHNDDKQYIWESDANSFSITEDPRGDTLKRGSVISLYLKEEAQDFLEEDTVRELIRKYSQFINFPIRMWSSKTVEEEVPVEEEAKPEKSEDDVEDEDAKVEEAEDEKPKTKKVSKTTWDWTLINDSKPIWTRKPAEVTEDEYTSFYKSLTKDSSE-PLTQTHFIAEGEVTFKSLLYVPKVQPSESFNRYGTKSD-NIKLYVRRVFITDEFNDMMPNYLSFIRGVVDSDDLPLNVSRETLQQHKLIKVIKKKLVRKVLDMLK---KIDKEAYEKFWKEFSTNIKLGVME--DPSNRSRLAKLLRFQTSN---GKGVTSLAEYKERMKAKQEHIYYIAGANRAEVEKSPFVERLLSKGYEVLYLVEAVDEYCISALPEFDGKKFQNVAKEGFQ--LNESEKSKKNFESL-KSTFEPLVKWLNDVALKDQISKAQVSERLSNSPCALVAGVFGWTGNMERLAMSNAHQKSDDPQRTYYLNQKKTLEINPRHPLMRELLRRVEADEADDTAKDMAVMMFRTATLRSGYM 725          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0332873)

HSP 1 Score: 184.496 bits (467), Expect = 4.739e-49
Identity = 114/408 (27.94%), Postives = 217/408 (53.19%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQA--EELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTD--EELAKMLINQLHQNALVQAGLVTDS 2013
            Y   ++++  +P+W ++P+++++ E+ EFYK +T N ++    V +F ++  L+ ++L +IP R P  L+E  ++ +  + LY R+V IM   + L+P +L F+KGVV+S+D+PLN+SRE+LQ + ++  I + L  + ++ L ++   D E Y +F++ F   LK G+    D + +  +   LRF +S        S  +Y  RMK   + ++F +  +++   +S ++E +K +  EV+Y+ EP DE V+  L  ++GK L S+  E  E        D + ++   +++A  E L   ++  +  KV  V ++ RL   PC +     G    +   +K   +  T    +M     +E+NP H +V+ L +    D  ++  K L+  L + +L+ +G   DS
Sbjct:  269 YTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRN-NIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTME-LIEELTEDKENYKKFYDQFSKNLKLGV--HEDSNNRAKLADFLRFHTSA-SGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPE-----DESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDS 665          

HSP 2 Score: 154.451 bits (389), Expect = 7.273e-39
Identity = 84/204 (41.18%), Postives = 137/204 (67.16%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            F+AE  +L+ ++  + YS+KE+F+REL+SNASDAL+K+RY   T     D   K   I +  +++     I DTGIGMTK +++ NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VADKV V S+++  ++ + W+SS G S +     ++ +  GTKI+L++K D  ++ +E  I++I+NK+S ++G  I L
Sbjct:   10 FQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSG-KELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVADKVTVTSKNN-DDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKL 208          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0073040)

HSP 1 Score: 184.496 bits (467), Expect = 4.739e-49
Identity = 114/408 (27.94%), Postives = 217/408 (53.19%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQA--EELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTD--EELAKMLINQLHQNALVQAGLVTDS 2013
            Y   ++++  +P+W ++P+++++ E+ EFYK +T N ++    V +F ++  L+ ++L +IP R P  L+E  ++ +  + LY R+V IM   + L+P +L F+KGVV+S+D+PLN+SRE+LQ + ++  I + L  + ++ L ++   D E Y +F++ F   LK G+    D + +  +   LRF +S        S  +Y  RMK   + ++F +  +++   +S ++E +K +  EV+Y+ EP DE V+  L  ++GK L S+  E  E        D + ++   +++A  E L   ++  +  KV  V ++ RL   PC +     G    +   +K   +  T    +M     +E+NP H +V+ L +    D  ++  K L+  L + +L+ +G   DS
Sbjct:  269 YTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRN-NIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTME-LIEELTEDKENYKKFYDQFSKNLKLGV--HEDSNNRAKLADFLRFHTSA-SGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPE-----DESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDS 665          

HSP 2 Score: 154.451 bits (389), Expect = 7.273e-39
Identity = 84/204 (41.18%), Postives = 137/204 (67.16%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            F+AE  +L+ ++  + YS+KE+F+REL+SNASDAL+K+RY   T     D   K   I +  +++     I DTGIGMTK +++ NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VADKV V S+++  ++ + W+SS G S +     ++ +  GTKI+L++K D  ++ +E  I++I+NK+S ++G  I L
Sbjct:   10 FQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSG-KELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVADKVTVTSKNN-DDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKL 208          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Zebrafish
Match: trap1 (TNF receptor-associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4257])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 330/642 (51.40%), Postives = 466/642 (72.59%), Query Frame = 1
Query:  151 EDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRY-LRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSN-DGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQS--ITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            E +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+ + T G   GD    P EIH++TD +K  F IQDTG+GM KE+++ NLGTIARSGS  FLD ++N+     SIIG+FGVGFYS+FMVADKVEV+S+S  ++  G+ W S G SG +E++EA  V  GTKI+LHLK DCKEFS E  +++++ KYSN+V   I+LNG++++ +Q LW+  P +++E +H EFY+Y+    YD PRY +++R D PL+I+S+FY+P  KP+++++SRE  + V+LYSRK++I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+SALI K+  VL  RVI++L DQ+K+D EKY +F  D+GL+++EGIV + +QS KE+I KLLRFESS LPAG+ TS  EYS RMKAG+R I++  AP R +AEHSPY EA+K+KD+EVL+  E +DE+ ++ L  F+ K L S ET+   D         +   S  ++ EQAE+L  W+   +  +V N+K+T RL THP +++V  MGA RHF++T  + ++ EE+  ++  T+E+N  H L+KKL  L  ++ ELA++L+ Q++ NA++ AGL  D R  I  LN+LLT+A EK
Sbjct:  147 ETLHNIITDTENVQGSFSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRHRMITAG---GDT--APMEIHLQTDSAKGTFTIQDTGVGMNKEDLVSNLGTIARSGSKAFLDALQNQAEASSSIIGQFGVGFYSAFMVADKVEVYSQSAEADAPGYKWSSDG-SGVFEVAEASGVRQGTKIVLHLKDDCKEFSSEDRVKEVVTKYSNFVSFPIFLNGRRLNTLQALWMMEPKDISEWQHEEFYRYV-AQAYDKPRYTLHYRADAPLNIRSIFYVPEMKPSMFDVSREMGSSVALYSRKILIQTKATDILPKWLRFLRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRVIRFLLDQSKKDPEKYARFFEDYGLFMREGIVTTAEQSVKEDIAKLLRFESSALPAGQQTSLMEYSSRMKAGTRNIYYLCAPNRHLAEHSPYFEAMKQKDMEVLFCFEQFDELTLLHLREFDRKKLISAETDIVVDHYKEEKFQDSKPASERLSSEQAEDLLAWMRNALVQRVTNIKVTPRLDTHPAMITVLEMGAARHFLRTQQLARSSEERAQILQPTLEINTGHDLIKKLHALKDSNPELAQLLLEQIYDNAMIAAGLNEDPRPMISRLNQLLTRALEK 781          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Zebrafish
Match: trap1 (TNF receptor-associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4257])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 331/642 (51.56%), Postives = 466/642 (72.59%), Query Frame = 1
Query:  151 EDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRY-LRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSN-DGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQS--ITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            E +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+ + T G   GD    P EIH++TD +K  F IQDTG+GM KE+++ NLGTIARSGS  FLD ++N+     SIIG+FGVGFYS+FMVADKVEV+S+S  ++  G+ W S G SG +E++EA  V  GTKI+LHLK DCKEFS E  +++++ KYSN+V   I+LNG++++ +Q LW+  P +++E +H EFY+Y+    YD PRY +++R D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+SALI K+  VL  RVI++L DQ+K+D EKY +F  D+GL+++EGIV + +QS KE+I KLLRFESS LPAG+ TS  EYS RMKAG+R I++  AP R +AEHSPY EA+K+KD+EVL+  E +DE+ ++ L  F+ K L S ET+   D         +   S  ++ EQAE+L  W+   +  +V N+K+T RL THP +++V  MGA RHF++T  + ++ EE+  ++  T+E+N  H L+KKL  L  ++ ELA++L+ Q++ NA++ AGL  D R  I  LN+LLT+A EK
Sbjct:   84 ETLHNIITDTENVQGSFSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRHRMITAG---GDT--APMEIHLQTDSAKGTFTIQDTGVGMNKEDLVSNLGTIARSGSKAFLDALQNQAEASSSIIGQFGVGFYSAFMVADKVEVYSQSAEADAPGYKWSSDG-SGVFEVAEASGVRQGTKIVLHLKDDCKEFSSEDRVKEVVTKYSNFVSFPIFLNGRRLNTLQALWMMEPKDISEWQHEEFYRYV-AQAYDKPRYTLHYRADAPLNIRSIFYVPEMKPSMFDVSREMGSSVALYSRKVLIQTKATDILPKWLRFLRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRVIRFLLDQSKKDPEKYARFFEDYGLFMREGIVTTAEQSVKEDIAKLLRFESSALPAGQQTSLMEYSSRMKAGTRNIYYLCAPNRHLAEHSPYFEAMKQKDMEVLFCFEQFDELTLLHLREFDRKKLISAETDIVVDHYKEEKFQDSKPASERLSSEQAEDLLAWMRNALVQRVTNIKVTPRLDTHPAMITVLEMGAARHFLRTQQLARSSEERAQILQPTLEINTGHDLIKKLHALKDSNPELAQLLLEQIYDNAMIAAGLNEDPRPMISRLNQLLTRALEK 718          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Zebrafish
Match: trap1 (TNF receptor-associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4257])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 331/642 (51.56%), Postives = 466/642 (72.59%), Query Frame = 1
Query:  151 EDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRY-LRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSN-DGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQS--ITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            E +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+ + T G   GD    P EIH++TD +K  F IQDTG+GM KE+++ NLGTIARSGS  FLD ++N+     SIIG+FGVGFYS+FMVADKVEV+S+S  ++  G+ W S G SG +E++EA  V  GTKI+LHLK DCKEFS E  +++++ KYSN+V   I+LNG++++ +Q LW+  P +++E +H EFY+Y+    YD PRY +++R D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+SALI K+  VL  RVI++L DQ+K+D EKY +F  D+GL+++EGIV + +QS KE+I KLLRFESS LPAG+ TS  EYS RMKAG+R I++  AP R +AEHSPY EA+K+KD+EVL+  E +DE+ ++ L  F+ K L S ET+   D         +   S  ++ EQAE+L  W+   +  +V N+K+T RL THP +++V  MGA RHF++T  + ++ EE+  ++  T+E+N  H L+KKL  L  ++ ELA++L+ Q++ NA++ AGL  D R  I  LN+LLT+A EK
Sbjct:   84 ETLHNIITDTENVQGSFSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRHRMITAG---GDT--APMEIHLQTDSAKGTFTIQDTGVGMNKEDLVSNLGTIARSGSKAFLDALQNQAEASSSIIGQFGVGFYSAFMVADKVEVYSQSAEADAPGYKWSSDG-SGVFEVAEASGVRQGTKIVLHLKDDCKEFSSEDRVKEVVTKYSNFVSFPIFLNGRRLNTLQALWMMEPKDISEWQHEEFYRYV-AQAYDKPRYTLHYRADAPLNIRSIFYVPEMKPSMFDVSREMGSSVALYSRKVLIQTKATDILPKWLRFLRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRVIRFLLDQSKKDPEKYARFFEDYGLFMREGIVTTAEQSVKEDIAKLLRFESSALPAGQQTSLMEYSSRMKAGTRNIYYLCAPNRHLAEHSPYFEAMKQKDMEVLFCFEQFDELTLLHLREFDRKKLISAETDIVVDHYKEEKFQDSKPASERLSSEQAEDLLAWMRNALVQRVTNIKVTPRLDTHPAMITVLEMGAARHFLRTQQLARSSEERAQILQPTLEINTGHDLIKKLHALKDSNPELAQLLLEQIYDNAMIAAGLNEDPRPMISRLNQLLTRALEK 718          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Zebrafish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 313.538 bits (802), Expect = 2.564e-95
Identity = 214/677 (31.61%), Postives = 353/677 (52.14%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQL--GDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDK---VKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSY-EISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKK--------------------------------------------------ISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT--LYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYI--QFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSE-DASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE---EKFMLMSATMELNPTHSLVKKLVELHKTDEE--LAKMLINQLHQNALVQAGL-VTDSRA 2019
            E   F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R L  T      G+E L    I IK+D+ KN+  I DTGIGMTKEE++KNLGTIA+SG+SEFL+K   V+++      +IG+FGVGFYS+F+VADKV V S+ H ++    W+S     S  E    D +  GT I L +K +  ++ +   I+ ++ KYS ++   IY+   K                                                  ++ ++P+W +    V E E+  FYK  + +T D P   I+F  +  +  KS+ ++P+  P     E   + +  + L+ R+V I      ++P +L F+KGVV+SDD+PLN+SRE LQ   L+    +V+  ++++   D  K+ AE+    +F  +FG  +K G++   D S +  + KLLRF++S       +S ++Y ERMK    KI+F +  +R+ AE SP++E + +K  EV+YL EP DE  +  L  F+GK   ++  E  + D S+        ++   +++ E LT W+ +K +K ++    ++QRLT  PC +     G    +   +K       ++     +     T+E+NP H L+K+++     D E   A  L   L + A +++G  + D++A
Sbjct:   74 EKHAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLLSLTNEDALAGNEELT---IKIKSDKEKNMLHITDTGIGMTKEELVKNLGTIAKSGTSEFLNKMTEVQDDSQSTSELIGQFGVGFYSAFLVADKVIVTSK-HNNDTQHMWESDSNQFSVIEDPRGDTLGRGTTITLVMKEEASDYLELETIKNLVKKYSQFINFPIYVWSSKTETVEEPIEDEAEAEKEEATEDEAEVEEEEEDKDKPKTKKVEKTVWDWELMNDIKPIWQRPAKEVEEDEYTAFYKTFSRDT-DEPLSHIHFTAEGEVTFKSILFVPASAPRGLFDEYGTKKNDFIKLFVRRVFITDDFHDMMPKYLNFIKGVVDSDDLPLNVSRETLQQHKLL----KVIRKKLVRKTLDMIKKIAEEQYNDKFWKEFGTNIKLGVIE--DHSNRTRLAKLLRFQTSH-SDTVLSSLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVVYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESD----KAKEKREALEKEFEPLTTWMKDKALKEQIEKAVLSQRLTNSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTLEINPKHPLIKEMLRRVNEDAEDKTAADLAVVLFETATLRSGYQLQDTKA 734          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Zebrafish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 313.153 bits (801), Expect = 5.956e-95
Identity = 214/677 (31.61%), Postives = 353/677 (52.14%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQL--GDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDK---VKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSY-EISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKK--------------------------------------------------ISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT--LYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYI--QFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSE-DASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE---EKFMLMSATMELNPTHSLVKKLVELHKTDEE--LAKMLINQLHQNALVQAGL-VTDSRA 2019
            E   F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R L  T      G+E L    I IK+D+ KN+  I DTGIGMTKEE++KNLGTIA+SG+SEFL+K   V+++      +IG+FGVGFYS+F+VADKV V S+ H ++    W+S     S  E    D +  GT I L +K +  ++ +   I+ ++ KYS ++   IY+   K                                                  ++ ++P+W +    V E E+  FYK  + +T D P   I+F  +  +  KS+ ++P+  P     E   + +  + L+ R+V I      ++P +L F+KGVV+SDD+PLN+SRE LQ   L+    +V+  ++++   D  K+ AE+    +F  +FG  +K G++   D S +  + KLLRF++S       +S ++Y ERMK    KI+F +  +R+ AE SP++E + +K  EV+YL EP DE  +  L  F+GK   ++  E  + D S+        ++   +++ E LT W+ +K +K ++    ++QRLT  PC +     G    +   +K       ++     +     T+E+NP H L+K+++     D E   A  L   L + A +++G  + D++A
Sbjct:   75 EKHAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLLSLTNEDALAGNEELT---IKIKSDKEKNMLHITDTGIGMTKEELVKNLGTIAKSGTSEFLNKMTEVQDDSQSTSELIGQFGVGFYSAFLVADKVIVTSK-HNNDTQHMWESDSNQFSVIEDPRGDTLGRGTTITLVMKEEASDYLELETIKNLVKKYSQFINFPIYVWSSKTETVEEPIEDEAEAEKEEATEDEAEVEEEEEDKDKPKTKKVEKTVWDWELMNDIKPIWQRPAKEVEEDEYTAFYKTFSRDT-DEPLSHIHFTAEGEVTFKSILFVPASAPRGLFDEYGTKKNDFIKLFVRRVFITDDFHDMMPKYLNFIKGVVDSDDLPLNVSRETLQQHKLL----KVIRKKLVRKTLDMIKKIAEEQYNDKFWKEFGTNIKLGVIE--DHSNRTRLAKLLRFQTSH-SDTVLSSLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVVYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESD----KAKEKREALEKEFEPLTTWMKDKALKEQIEKAVLSQRLTNSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTLEINPKHPLIKEMLRRVNEDAEDKTAADLAVVLFETATLRSGYQLQDTKA 735          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Xenopus
Match: TRAP1 (TNF receptor-associated protein 1 [Source:NCBI gene;Acc:100492593])

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 324/666 (48.65%), Postives = 472/666 (70.87%), Query Frame = 1
Query:   94 PRVLTVCS-KTFSSEAAVNSED--IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRS-HRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETE-----HSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            P  L+  + + ++++AA N E+  +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+     L  G   L   EIH++TD  K    IQDTG+GMT++++I NLGTIARSGS  FL+ ++N+      IIG+FGVGFYS+FMVADKV V+S+S    + G+ W S G SG +E+ EA  V  GTK+++HLK DCKEF++E  +++++ KYSN+V   +YLNGK+++ +Q LW+  P  + E +H EFY++I    YD PRY+++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+S LI K+  VL  R+IK+  DQ+K+D EKY +F  D+GL+++EGIV + +Q  KE+I KLLRFESS LP G+ TS  EY+ RM+ G+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ M+ L  F+ K L S+ET+     + ED    +I      + +++++AE+L  W+   +  ++ NVK+T RL THP +++V  MGA RHF++T  + KT EE+  ++  T+E+N  H L+KKL +L   ++ELAK+L++Q+++NA++ AGL  D R  IG LNELL KA EK
Sbjct:   52 PTALSAAAGRRYTTQAAENKEEEILHKIISDTENVQGSASKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRH---NHLAQGSA-LPEMEIHLQTDADKGTLTIQDTGVGMTRDDLISNLGTIARSGSKAFLEALQNQADSSSKIIGQFGVGFYSAFMVADKVVVYSQSSEEGSTGYCWSSDG-SGVFELVEASGVRPGTKVVIHLKDDCKEFANEDRVKEVVTKYSNFVSFPLYLNGKRMNTLQALWMMDPKEIGEWQHEEFYRFI-AQAYDKPRYMLHYKADAPLNIRSIFYVPEMKPSMFDVSREMGSSVALYSRKVLIQTKAADILPKWLRFLRGVVDSEDIPLNLSRELLQESVLIRKLRDVLQRRLIKFFIDQSKKDPEKYAKFFEDYGLFMREGIVTTAEQEVKEDIAKLLRFESSSLPEGQQTSLTEYASRMQPGTRNIYYLCAPNRHLAEHSPYYEAMKKKQTEVLFCYEQFDELTMLHLREFDKKKLISVETDIVVDHYKEDKFEESI---PASERLSEKEAEDLMAWMRNGLGTRITNVKVTPRLDTHPAMITVLEMGAARHFLRTQQLAKTSEERAQILQPTLEINTGHPLIKKLWQLKDGEQELAKLLLDQIYENAMIAAGLNEDPRPMIGRLNELLAKALEK 708          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Xenopus
Match: TRAP1 (TNF receptor-associated protein 1 [Source:NCBI gene;Acc:100492593])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 324/666 (48.65%), Postives = 472/666 (70.87%), Query Frame = 1
Query:   94 PRVLTVCS-KTFSSEAAVNSED--IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRS-HRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETE-----HSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            P  L+  + + ++++AA N E+  +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+     L  G   L   EIH++TD  K    IQDTG+GMT++++I NLGTIARSGS  FL+ ++N+      IIG+FGVGFYS+FMVADKV V+S+S    + G+ W S G SG +E+ EA  V  GTK+++HLK DCKEF++E  +++++ KYSN+V   +YLNGK+++ +Q LW+  P  + E +H EFY++I    YD PRY+++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+S LI K+  VL  R+IK+  DQ+K+D EKY +F  D+GL+++EGIV + +Q  KE+I KLLRFESS LP G+ TS  EY+ RM+ G+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ M+ L  F+ K L S+ET+     + ED    +I      + +++++AE+L  W+   +  ++ NVK+T RL THP +++V  MGA RHF++T  + KT EE+  ++  T+E+N  H L+KKL +L   ++ELAK+L++Q+++NA++ AGL  D R  IG LNELL KA EK
Sbjct:   18 PTALSAAAGRRYTTQAAENKEEEILHKIISDTENVQGSASKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRH---NHLAQGS-ALPEMEIHLQTDADKGTLTIQDTGVGMTRDDLISNLGTIARSGSKAFLEALQNQADSSSKIIGQFGVGFYSAFMVADKVVVYSQSSEEGSTGYCWSSDG-SGVFELVEASGVRPGTKVVIHLKDDCKEFANEDRVKEVVTKYSNFVSFPLYLNGKRMNTLQALWMMDPKEIGEWQHEEFYRFI-AQAYDKPRYMLHYKADAPLNIRSIFYVPEMKPSMFDVSREMGSSVALYSRKVLIQTKAADILPKWLRFLRGVVDSEDIPLNLSRELLQESVLIRKLRDVLQRRLIKFFIDQSKKDPEKYAKFFEDYGLFMREGIVTTAEQEVKEDIAKLLRFESSSLPEGQQTSLTEYASRMQPGTRNIYYLCAPNRHLAEHSPYYEAMKKKQTEVLFCYEQFDELTMLHLREFDKKKLISVETDIVVDHYKEDKFEESI---PASERLSEKEAEDLMAWMRNGLGTRITNVKVTPRLDTHPAMITVLEMGAARHFLRTQQLAKTSEERAQILQPTLEINTGHPLIKKLWQLKDGEQELAKLLLDQIYENAMIAAGLNEDPRPMIGRLNELLAKALEK 674          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Xenopus
Match: TRAP1 (TNF receptor-associated protein 1 [Source:NCBI gene;Acc:100492593])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 324/666 (48.65%), Postives = 471/666 (70.72%), Query Frame = 1
Query:   94 PRVLTVCS-KTFSSEAAVNSED--IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRS-HRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETE-----HSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            P  L+  + + ++++AA N E+  +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+     L  G   L   EIH++TD  K    IQDTG+GMT++++I NLGTIARSGS  FL+ ++N+      IIG+FGVGFYS+FMVADKV V+S+S    + G+ W S G SG +E+ EA  V  GTK+++HLK DCKEF++E   ++++ KYSN+V   +YLNGK+++ +Q LW+  P  + E +H EFY++I    YD PRY+++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+S LI K+  VL  R+IK+  DQ+K+D EKY +F  D+GL+++EGIV + +Q  KE+I KLLRFESS LP G+ TS  EY+ RM+ G+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ M+ L  F+ K L S+ET+     + ED    +I      + +++++AE+L  W+   +  ++ NVK+T RL THP +++V  MGA RHF++T  + KT EE+  ++  T+E+N  H L+KKL +L   ++ELAK+L++Q+++NA++ AGL  D R  IG LNELL KA EK
Sbjct:   36 PTALSAAAGRRYTTQAAENKEEEILHKIISDTENVQGSASKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRH---NHLAQGS-ALPEMEIHLQTDADKGTLTIQDTGVGMTRDDLISNLGTIARSGSKAFLEALQNQADSSSKIIGQFGVGFYSAFMVADKVVVYSQSSEEGSTGYCWSSDG-SGVFELVEASGVRPGTKVVIHLKDDCKEFANE---DRVVTKYSNFVSFPLYLNGKRMNTLQALWMMDPKEIGEWQHEEFYRFI-AQAYDKPRYMLHYKADAPLNIRSIFYVPEMKPSMFDVSREMGSSVALYSRKVLIQTKAADILPKWLRFLRGVVDSEDIPLNLSRELLQESVLIRKLRDVLQRRLIKFFIDQSKKDPEKYAKFFEDYGLFMREGIVTTAEQEVKEDIAKLLRFESSSLPEGQQTSLTEYASRMQPGTRNIYYLCAPNRHLAEHSPYYEAMKKKQTEVLFCYEQFDELTMLHLREFDKKKLISVETDIVVDHYKEDKFEESI---PASERLSEKEAEDLMAWMRNGLGTRITNVKVTPRLDTHPAMITVLEMGAARHFLRTQQLAKTSEERAQILQPTLEINTGHPLIKKLWQLKDGEQELAKLLLDQIYENAMIAAGLNEDPRPMIGRLNELLAKALEK 689          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Xenopus
Match: TRAP1 (TNF receptor-associated protein 1 [Source:NCBI gene;Acc:100492593])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 324/673 (48.14%), Postives = 473/673 (70.28%), Query Frame = 1
Query:   91 KPRVLTVCS-KTFSSEAAVNSED--IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRS-HRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSR------KPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETE-----HSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            +P  L+  + + ++++AA N E+  +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+     L  G   L   EIH++TD  K    IQDTG+GMT++++I NLGTIARSGS  FL+ ++N+      IIG+FGVGFYS+FMVADKV V+S+S    + G+ W S G SG +E+ EA  V  GTK+++HLK DCKEF++E  +++++ KYSN+V   +YLNGK+++ +Q LW+  P  + E +H EFY++I    YD PRY+++++ D PL+I+S+FY+P        KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+S LI K+  VL  R+IK+  DQ+K+D EKY +F  D+GL+++EGIV + +Q  KE+I KLLRFESS LP G+ TS  EY+ RM+ G+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ M+ L  F+ K L S+ET+     + ED    +I      + +++++AE+L  W+   +  ++ NVK+T RL THP +++V  MGA RHF++T  + KT EE+  ++  T+E+N  H L+KKL +L   ++ELAK+L++Q+++NA++ AGL  D R  IG LNELL KA EK
Sbjct:    3 RPTALSAAAGRRYTTQAAENKEEEILHKIISDTENVQGSASKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRH---NHLAQGS-ALPEMEIHLQTDADKGTLTIQDTGVGMTRDDLISNLGTIARSGSKAFLEALQNQADSSSKIIGQFGVGFYSAFMVADKVVVYSQSSEEGSTGYCWSSDG-SGVFELVEASGVRPGTKVVIHLKDDCKEFANEDRVKEVVTKYSNFVSFPLYLNGKRMNTLQALWMMDPKEIGEWQHEEFYRFI-AQAYDKPRYMLHYKADAPLNIRSIFYVPEMVIPELCKPSMFDVSREMGSSVALYSRKVLIQTKAADILPKWLRFLRGVVDSEDIPLNLSRELLQESVLIRKLRDVLQRRLIKFFIDQSKKDPEKYAKFFEDYGLFMREGIVTTAEQEVKEDIAKLLRFESSSLPEGQQTSLTEYASRMQPGTRNIYYLCAPNRHLAEHSPYYEAMKKKQTEVLFCYEQFDELTMLHLREFDKKKLISVETDIVVDHYKEDKFEESI---PASERLSEKEAEDLMAWMRNGLGTRITNVKVTPRLDTHPAMITVLEMGAARHFLRTQQLAKTSEERAQILQPTLEINTGHPLIKKLWQLKDGEQELAKLLLDQIYENAMIAAGLNEDPRPMIGRLNELLAKALEK 666          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Xenopus
Match: TRAP1 (TNF receptor-associated protein 1 [Source:NCBI gene;Acc:100492593])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 324/672 (48.21%), Postives = 472/672 (70.24%), Query Frame = 1
Query:   94 PRVLTVCS-KTFSSEAAVNSED--IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRS-HRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSR------KPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETE-----HSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            P  L+  + + ++++AA N E+  +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+     L  G   L   EIH++TD  K    IQDTG+GMT++++I NLGTIARSGS  FL+ ++N+      IIG+FGVGFYS+FMVADKV V+S+S    + G+ W S G SG +E+ EA  V  GTK+++HLK DCKEF++E  +++++ KYSN+V   +YLNGK+++ +Q LW+  P  + E +H EFY++I    YD PRY+++++ D PL+I+S+FY+P        KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+S LI K+  VL  R+IK+  DQ+K+D EKY +F  D+GL+++EGIV + +Q  KE+I KLLRFESS LP G+ TS  EY+ RM+ G+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ M+ L  F+ K L S+ET+     + ED    +I      + +++++AE+L  W+   +  ++ NVK+T RL THP +++V  MGA RHF++T  + KT EE+  ++  T+E+N  H L+KKL +L   ++ELAK+L++Q+++NA++ AGL  D R  IG LNELL KA EK
Sbjct:   52 PTALSAAAGRRYTTQAAENKEEEILHKIISDTENVQGSASKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRH---NHLAQGSA-LPEMEIHLQTDADKGTLTIQDTGVGMTRDDLISNLGTIARSGSKAFLEALQNQADSSSKIIGQFGVGFYSAFMVADKVVVYSQSSEEGSTGYCWSSDG-SGVFELVEASGVRPGTKVVIHLKDDCKEFANEDRVKEVVTKYSNFVSFPLYLNGKRMNTLQALWMMDPKEIGEWQHEEFYRFI-AQAYDKPRYMLHYKADAPLNIRSIFYVPEMVIPELCKPSMFDVSREMGSSVALYSRKVLIQTKAADILPKWLRFLRGVVDSEDIPLNLSRELLQESVLIRKLRDVLQRRLIKFFIDQSKKDPEKYAKFFEDYGLFMREGIVTTAEQEVKEDIAKLLRFESSSLPEGQQTSLTEYASRMQPGTRNIYYLCAPNRHLAEHSPYYEAMKKKQTEVLFCYEQFDELTMLHLREFDKKKLISVETDIVVDHYKEDKFEESI---PASERLSEKEAEDLMAWMRNGLGTRITNVKVTPRLDTHPAMITVLEMGAARHFLRTQQLAKTSEERAQILQPTLEINTGHPLIKKLWQLKDGEQELAKLLLDQIYENAMIAAGLNEDPRPMIGRLNELLAKALEK 714          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Mouse
Match: Trap1 (TNF receptor-associated protein 1 [Source:MGI Symbol;Acc:MGI:1915265])

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 326/656 (49.70%), Postives = 479/656 (73.02%), Query Frame = 1
Query:  112 CSKTFSSEAAVNSED--IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRS-NDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTN--EQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
              + +S++AA + E+  +H II ++E + G++   EF+AET+KLLDIVA+SLYS+KEVFIREL+SNASDALEKLR+     L    + L   EIH++TD  K    IQDTGIGMT+EE++ NLGTIARSGS  FL+ ++N+      IIG+FGVGFYS+FMVADKVEV+SRS    + G+ W S G SG +EI+EA  V  GTKII+HLKSDCK+F+ E  ++ ++ KYSN+V   +YLNGK+I+ +Q +W+  P +++E +H EFY+YI    YD PR+ ++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV + +Q  KE+I KLLR+ESS LPAG+ TS  +Y+ RM+AG+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ ++ L  F+ K L S+ET+   D       + T+  ++ +++++ E+L  W+   +  +V NVK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H+L+KKL +L +++ ELA++L++Q+++NA++ AGLV D RA +G LN+LL K  EK
Sbjct:   56 AGQLYSTQAAEDKEEESLHSIISNTEAVRGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRH----KLVCEGQVLPEMEIHLQTDAKKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLEALQNQAETSSKIIGQFGVGFYSAFMVADKVEVYSRSAAPESPGYQWLSDG-SGVFEIAEASGVRPGTKIIIHLKSDCKDFASESRVQDVVTKYSNFVSFPLYLNGKRINTLQAIWMMDPKDISEFQHEEFYRYI-AQAYDKPRFTLHYKTDAPLNIRSIFYVPEMKPSMFDVSRELGSSVALYSRKVLIQTKAADILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTTAEQDIKEDIAKLLRYESSALPAGQLTSLPDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKQKHTEVLFCYEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDTSPADERLSEKETEDLMAWMRNALGSRVTNVKVTFRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHTLIKKLCQLRESEPELAQLLVDQIYENAMIAAGLVDDPRAMVGRLNDLLVKVLEK 705          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Mouse
Match: Hsp90b1 (heat shock protein 90, beta (Grp94), member 1 [Source:MGI Symbol;Acc:MGI:98817])

HSP 1 Score: 306.22 bits (783), Expect = 1.850e-92
Identity = 218/684 (31.87%), Postives = 354/684 (51.75%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTT--GLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV--KNEDAKLDS-IIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSY-EISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKK--------------------------------------------------ISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT-LYE--ISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGR---VIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSE-DASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE---EKFMLMSATMELNPTHSLVKKLVELHKTDEELAKM--LINQLHQNALVQAG-LVTDSRASIGNLNELL 2046
            F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R +  T      G+E L    + IK D+ KNL  + DTG+GMT+EE++KNLGTIA+SG+SEFL+K+    ED +  S +IG+FGVGFYS+F+VADKV V S+ H ++    W+S     S       + +  GT I L LK +  ++ +   I+ ++ KYS ++   IY+   K                                                  ++ ++P+W +    V E E+  FYK  +  + D P   I+F  +  +  KS+ ++P+  P  L++   S++SD  + LY R+V I      ++P +L F+KGVV+SDD+PLN+SRE LQ   L+  I + L  +   +IK + D+   D      F  +FG  +K G++   D S +  + KLLRF+SS   +   TS  +Y ERMK    KI+F +  +R+ AE SP++E + +K  EV+YL EP DE  +  L  F+GK   ++  E  + D S          +  T+++ E L  W+ +K +K K+    ++QRLT  PC +     G    +   +K       ++     +     T E+NP H L++ ++   K DE+   +  L   L + A +++G L+ D++A    +  +L
Sbjct:   78 FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT---VKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSK-HNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKES-DDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDY-IKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYNDT-----FWKEFGTNIKLGVIE--DHSNRTRLAKLLRFQSSH-HSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESE----KTKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMDLAVVLFETATLRSGYLLPDTKAYGDRIERML 743          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 189.119 bits (479), Expect = 1.999e-50
Identity = 117/403 (29.03%), Postives = 223/403 (55.33%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGL 2001
            Y++ ++++  +P+W ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E +R+    + LY R+V IM   ++L+P +L F++GVV+S+D+PLN+SRE+LQ S ++  I + L  + ++   + A+ D E Y +F+  F   +K GI    D   ++ + +LLR+ +S     +  S ++Y  RMK   + I+F +  T++   +S ++E +++  +EV+Y++EP DE  + QL  FEGK L S+  E  E   +        +Q   + + E L   ++  ++ KV  V ++ RL T PC +     G    +   +K   +       +M     +E+NP HS+++ L    E  K D+ +  ++I  L++ AL+ +G 
Sbjct:  285 YIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLT-NDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFE-NRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAE-DKENYKKFYEQFSKNIKLGI--HEDSQNRKKLSELLRYYTSA-SGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEE---KKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVI-LLYETALLSSGF 677          

HSP 2 Score: 159.458 bits (402), Expect = 2.287e-40
Identity = 87/209 (41.63%), Postives = 136/209 (65.07%), Query Frame = 1
Query:  199 LEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            +E   F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RY   T     D   K   I++   +      I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA+KV V ++ H  ++ + W+SS G S +      + +  GTK+ILHLK D  E+ +ER I++I+ K+S ++G  I L
Sbjct:   17 VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSG-KELHINLIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAEKVTVITK-HNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITL 220          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 189.119 bits (479), Expect = 1.999e-50
Identity = 117/403 (29.03%), Postives = 223/403 (55.33%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGL 2001
            Y++ ++++  +P+W ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E +R+    + LY R+V IM   ++L+P +L F++GVV+S+D+PLN+SRE+LQ S ++  I + L  + ++   + A+ D E Y +F+  F   +K GI    D   ++ + +LLR+ +S     +  S ++Y  RMK   + I+F +  T++   +S ++E +++  +EV+Y++EP DE  + QL  FEGK L S+  E  E   +        +Q   + + E L   ++  ++ KV  V ++ RL T PC +     G    +   +K   +       +M     +E+NP HS+++ L    E  K D+ +  ++I  L++ AL+ +G 
Sbjct:  285 YIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLT-NDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFE-NRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAE-DKENYKKFYEQFSKNIKLGI--HEDSQNRKKLSELLRYYTSA-SGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEE---KKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVI-LLYETALLSSGF 677          

HSP 2 Score: 159.458 bits (402), Expect = 2.287e-40
Identity = 87/209 (41.63%), Postives = 136/209 (65.07%), Query Frame = 1
Query:  199 LEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            +E   F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RY   T     D   K   I++   +      I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA+KV V ++ H  ++ + W+SS G S +      + +  GTK+ILHLK D  E+ +ER I++I+ K+S ++G  I L
Sbjct:   17 VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSG-KELHINLIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAEKVTVITK-HNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITL 220          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Mouse
Match: Hsp90ab1 (heat shock protein 90 alpha (cytosolic), class B member 1 [Source:MGI Symbol;Acc:MGI:96247])

HSP 1 Score: 186.037 bits (471), Expect = 1.892e-49
Identity = 115/402 (28.61%), Postives = 221/402 (54.98%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTD--EELAKMLINQLHQNALVQAGL 2001
            Y++ ++++  +P+W ++P+++T+ E+ EFYK +T N ++    V +F ++  L+ ++L +IP R P  L+E  ++    + LY R+V IM    +L+P +L F++GVV+S+D+PLN+SRE+LQ S ++  I + +  + ++   + A+ D E Y +F+  F   LK GI    D + +  + +LLR+ +S+    + TS  EY  RMK   + I++ +  ++E   +S ++E ++++  EV+Y+ EP DE  + QL  F+GK L S+  E  E   +        +   ++ + E L   +++ +  KV  V I+ RL + PC +     G    +   +K   +       +M+    +E+NP H +V+ L +  + D  ++  K L+  L + AL+ +G 
Sbjct:  276 YIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKK-NNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAE-DKENYKKFYEAFSKNLKLGI--HEDSTNRRRLSELLRYHTSQ-SGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEE---KKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGF 668          

HSP 2 Score: 160.229 bits (404), Expect = 1.172e-40
Identity = 85/204 (41.67%), Postives = 135/204 (66.18%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            F+AE  +L+ ++  + YS+KE+F+REL+SNASDAL+K+RY   T     D   K  +I I  +  +    + DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA+KV V ++ H  ++ + W+SS G S +      + +  GTK+ILHLK D  E+ +ER +++++ K+S ++G  I L
Sbjct:   17 FQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSG-KELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAEKVVVITK-HNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITL 215          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5XHZ0|TRAP1_RAT (Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus OX=10116 GN=Trap1 PE=1 SV=1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 326/656 (49.70%), Postives = 480/656 (73.17%), Query Frame = 1
Query:  112 CSKTFSSEAAVNS--EDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSR-SHRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNE--QSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
              + +S++AA +   E +H II ++E + G++   EF+AET+KLLDIVA+SLYS+KEVFIREL+SNASDALEKLR+ R    Q+    L   EIH++TD  K    IQDTGIGMTKEE++ NLGTIARSGS  FL+ ++++      IIG+FGVGFYS+FMVADKVEV+SR +   + G+ W S G SG +EI+EA  V  GTKII+HLKSDCK+F++E  ++ ++ KYSN+V   +YLNG++I+ +Q +W+  P +++E +H EFY+YI    YD PR++++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV + +Q  KE+I KLLR+ESS LPAG+ TS  +Y+ RM+AG+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ ++ L  F+ K L S+ET+   D       + T+   + +++++ EEL  W+   +  +V NVK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H+L+KKL +L + + ELA++L++Q+++NA++ AGLV D RA +G LN+LL KA E+
Sbjct:   56 AGQLYSTQAAEDKKEEALHSIISNTEAVQGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKRVCEGQV----LPEMEIHLQTDAEKGTITIQDTGIGMTKEELVSNLGTIARSGSKAFLEALQHQAETSSRIIGQFGVGFYSAFMVADKVEVYSRPAAPESPGYQWLSDG-SGVFEIAEASGVRPGTKIIIHLKSDCKDFANESRVQDVVTKYSNFVSFPLYLNGRRINTLQAIWMMDPKDISEFQHEEFYRYI-AQAYDKPRFILHYKTDAPLNIRSIFYVPEMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFVRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTTAEQDIKEDIAKLLRYESSALPAGQLTSLSDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKQKQTEVLFCYEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDTSPAGERLSEKETEELMAWMRNALGSRVTNVKVTFRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHTLIKKLNQLREREPELAQLLVDQIYENAMIAAGLVDDPRAMVGRLNDLLVKALER 705          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9CQN1|TRAP1_MOUSE (Heat shock protein 75 kDa, mitochondrial OS=Mus musculus OX=10090 GN=Trap1 PE=1 SV=1)

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 326/656 (49.70%), Postives = 479/656 (73.02%), Query Frame = 1
Query:  112 CSKTFSSEAAVNSED--IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRS-NDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTN--EQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
              + +S++AA + E+  +H II ++E + G++   EF+AET+KLLDIVA+SLYS+KEVFIREL+SNASDALEKLR+     L    + L   EIH++TD  K    IQDTGIGMT+EE++ NLGTIARSGS  FL+ ++N+      IIG+FGVGFYS+FMVADKVEV+SRS    + G+ W S G SG +EI+EA  V  GTKII+HLKSDCK+F+ E  ++ ++ KYSN+V   +YLNGK+I+ +Q +W+  P +++E +H EFY+YI    YD PR+ ++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV + +Q  KE+I KLLR+ESS LPAG+ TS  +Y+ RM+AG+R I++  AP R +AEHSPY EA+K+K  EVL+  E +DE+ ++ L  F+ K L S+ET+   D       + T+  ++ +++++ E+L  W+   +  +V NVK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H+L+KKL +L +++ ELA++L++Q+++NA++ AGLV D RA +G LN+LL K  EK
Sbjct:   56 AGQLYSTQAAEDKEEESLHSIISNTEAVRGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRH----KLVCEGQVLPEMEIHLQTDAKKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLEALQNQAETSSKIIGQFGVGFYSAFMVADKVEVYSRSAAPESPGYQWLSDG-SGVFEIAEASGVRPGTKIIIHLKSDCKDFASESRVQDVVTKYSNFVSFPLYLNGKRINTLQAIWMMDPKDISEFQHEEFYRYI-AQAYDKPRFTLHYKTDAPLNIRSIFYVPEMKPSMFDVSRELGSSVALYSRKVLIQTKAADILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTTAEQDIKEDIAKLLRYESSALPAGQLTSLPDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKQKHTEVLFCYEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDTSPADERLSEKETEDLMAWMRNALGSRVTNVKVTFRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHTLIKKLCQLRESEPELAQLLVDQIYENAMIAAGLVDDPRAMVGRLNDLLVKVLEK 705          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. UniProt/SwissProt
Match: sp|Q12931|TRAP1_HUMAN (Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 333/663 (50.23%), Postives = 474/663 (71.49%), Query Frame = 1
Query:  112 CSKTFSSEAAVNSED-IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRY-LRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND-GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIET---------EHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
              + FS++ A + E+ +H II  +E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SNASDALEKLR+ L + G     + L   EIH++T+  K    IQDTGIGMT+EE++ NLGTIARSGS  FLD ++N+      IIG+FGVGFYS+FMVAD+VEV+SRS      G+ W S G SG +EI+EA  V  GTKII+HLKSDCKEFS E  +  ++ KYSN+V   +YLNG++++ +Q +W+  P +V E +H EFY+Y+    +D PRY ++++ D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV +T+Q  KE+I KLLR+ESS LP+G+ TS  EY+ RM+AG+R I++  AP R +AEHSPY EA+K+KD EVL+  E +DE+ ++ L  F+ K L S+ET         E  ED S     +C +E+     + EEL  W+   +  +V NVK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H+L+KKL +L  ++  LA++L++Q+++NA++ AGLV D RA +G LNELL KA E+
Sbjct:   55 AGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDG-----QALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDG-SGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYV-AQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPA--AECLSEK-----ETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALER 703          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. UniProt/SwissProt
Match: sp|Q2TBI4|TRAP1_BOVIN (Heat shock protein 75 kDa, mitochondrial OS=Bos taurus OX=9913 GN=TRAP1 PE=2 SV=1)

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 324/674 (48.07%), Postives = 472/674 (70.03%), Query Frame = 1
Query:   94 PRVLTV---CSKTFSSEAAVNSED---IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRY-LRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND-GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIET---------EHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            PR L       + FSS+AA +  +   +H +I   E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SNASDALEKLR+ L + G  L D      EIH++TD  +    IQDTG+GM++EE++ NLGTIARSGS  FLD ++N+      IIG+FGVGFYS+FMVAD+VEV+SRS  +   G+ W S G SG +E++EA  V  GTKII+HLK+D +EF+ E  +  ++ KYSN+V   +YLNG++++ +Q +W+  P +V E +H EFY+Y+    +D PRY +++R D PL I+S+FY+P  KP+++++SRE  + VSLYSRKV+I ++   +LP WLRF++GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+IK+  DQ+K+DAEKY +F  D+GL+++EGIV + +Q  KE+I KLLR+ESS LPAG+ TS  +Y+ RM+AG+R I++  AP R +AEHSPY EA+K K+ EVL+  E +DE+ ++ L  F+ K L S+ET         E  ED +     DC +E+     + E+L  W+   +  ++ +VK+T RL THP +++V  MGA RHF++   + KT+EE+  L+  T+E+NP H L+KKL +L  ++ +LA++L++Q+++NA++ AGL+ D R  +G LN+LL KA E+
Sbjct:   43 PRSLASSFHVGRPFSSQAAEDQAEAGPLHSVISSLEAVQGSATKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSEGQALPD-----MEIHLQTDADRGTITIQDTGVGMSREELVSNLGTIARSGSKAFLDALQNQAEAGSKIIGQFGVGFYSAFMVADRVEVYSRSVDAGSLGYRWLSDG-SGVFEVAEASGVRTGTKIIIHLKADSREFASEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVGEGQHEEFYRYV-AQAHDRPRYTLHYRTDAPLSIRSIFYVPDAKPSMFDVSRELGSSVSLYSRKVLIQTKATNILPTWLRFVRGVVDSEDIPLNLSRELLQESALIRKLQGVLQQRLIKFFTDQSKKDAEKYARFFEDYGLFVREGIVTTAEQEVKEDIAKLLRYESSALPAGQLTSLSDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKRKNTEVLFCYEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDGAPAG--DCLSEK-----ETEDLMAWMRNALGSRITDVKVTLRLDTHPAMITVLEMGAARHFLRMRQLAKTQEERAQLLQPTLEINPRHVLIKKLSQLRDSEPDLAQLLVDQIYENAMITAGLIDDPRPMVGRLNQLLVKALER 702          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. UniProt/SwissProt
Match: sp|Q86L04|TRAP1_DICDI (TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=trap1 PE=2 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.911e-171
Identity = 272/630 (43.17%), Postives = 402/630 (63.81%), Query Frame = 1
Query:  169 IKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHR-SNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHT---SFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELL 2046
            IK++E++IG  E   F+ ET+K+L IVA+SLY++KEVFIREL+SNASDA+EK+R+ + T   + ++   PFEI I TDE     IIQD+GIGMTK+EMIKNLG I  SGSS+F+ K+  E+    SIIG+FGVGFYS FMV   ++++++S    + G+ W+S GT GSY I+EA+ V  GTKII+HLK    E+S +  +E II KYSN+VG  I LNG  ++ ++PLW  + N ++E EH EFY++++  +YD+P Y ++F  D PL I+S+FYIPS+    Y + +  + GVSL+SRKV+I  +   +LP W+RF++GVV+S+DIPLN+SRE LQD+ LI +I+ VL  R++K+L+D+AK D EK+  F  +FG + KEGI+  TD   K+ I KLLRFESS       T   S ++Y  RMK   + I+F S P R +   SPY E  + KDIEV++L    DE V+  +G F  K + S+E++ +E+    N    T  ++++Q++ ++   W+      KV   K T R  + P ++        R  +K     K  E         +E N  H ++ KLV+  +++  +AK++I+Q+  NA V AGL+ D+R  I  +N+LL
Sbjct:   88 IKETERVIGLSEKLSFQTETQKILHIVAESLYTEKEVFIRELISNASDAIEKVRHTQLTNASMIEDASIPFEIKISTDEDNKTLIIQDSGIGMTKDEMIKNLGKIGYSGSSDFIKKL-GENPDKASIIGQFGVGFYSCFMVGHTIKIYTKSATPGSKGYLWESDGT-GSYSITEAEGVSRGTKIIIHLKPSSYEYSKKSIVENIIKKYSNFVGFPIALNGTTVNTIKPLWTLNKNAISEEEHKEFYQFLS-KSYDTPSYRVHFSTDTPLSIRSIFYIPSQHMEKYGMGK-MEPGVSLFSRKVLIQQKANGILPEWMRFVRGVVDSEDIPLNVSREHLQDNGLIQRISSVLVKRILKHLNDEAKSDPEKFNVFMTEFGGFFKEGII--TDFKWKDEISKLLRFESSNGSTASKTDAVSLEQYVSRMKPEQKNIYFLSVPNRAVGLSSPYYEPFQLKDIEVIFLYNAVDEFVLTNVGHFGDKKIVSVESKEAEEFLATNQDKKT--ETLSQDEIDKFLSWVSTVASDKVTQAKSTTRSISSPAIIIDHESANFRRMLKMVEPGKQHETP----KQVVEFNMNHPIILKLVQQTESNPTIAKLVIDQVVDNAFVSAGLIEDNREMIPRINQLL 705          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. TrEMBL
Match: A0A2T7PPB7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06539 PE=3 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 350/668 (52.40%), Postives = 498/668 (74.55%), Query Frame = 1
Query:   76 LANAIKPRVLTVCSKTFSSEAAVN-SEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAK--LDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND-GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEKI 2067
            L    KP  L+ CS +  SE  V  +E+ H IIK++E+  G  +  EF+AETRKLLDIVAKSLYSDKEVFIREL+SNASDALE+LRYL+  G   GDE     EIHI TD+ K  F IQDTGIG+T+ E+I NLGTIA+SGS  FL+ +K E A     ++IG+FGVGFYS+FMV D VEV++RS+ +N  G  W S G SG+YE+SEAD V+ GTKI++HLK DC +F+ E  I  ++ +YSN+VG  IYLNG +++++Q LW+  P +VTE  H EFY++I  N YD PRY  +++ D PL+I++LFY+P  KPTL+++SRE+D+G++LYSR+VMIM++   +LP W+RF++GVV+S+DIPLNLSRELLQ+SALI K+  VLT RV+++  DQAK++ EKY+ F++D+GL+ +EGIV + DQ+++E + KLLRFESSK  +G+  S  +Y+ RMKAG R I+F +AP+R +AE SPY EA +++DIEVL+L E YDE+V+M L  ++ K+L SIE E  +D  N + +D ++  S+++E AE L  W++  +  +V N+K+T+RL +HPC+++V+ MGA RHF++T+L DK++EE+  L+  T+ELNP+HSLVKKL +L  +D +LA+ML  QL++NA++ AGL+ D+R  +  L+ LL +A E +
Sbjct:  175 LPGTGKP-FLSQCSLSTESETTVQETEEYHTIIKNTEQGKGPTDKHEFQAETRKLLDIVAKSLYSDKEVFIRELISNASDALERLRYLQLKGEIAGDEKTT-LEIHIATDDVKKTFTIQDTGIGLTRNELIDNLGTIAKSGSKAFLEHLKEESAGDVGRTLIGQFGVGFYSTFMVGDTVEVYTRSYHANSPGLKWTSDG-SGTYEVSEADGVQRGTKIVVHLKGDCYDFAKEDVISGVVKRYSNFVGVPIYLNGHRVNILQALWMTDPRDVTETMHEEFYRFI-ANAYDKPRYHFHYKTDAPLNIRALFYVPEYKPTLFDMSRETDSGLTLYSRRVMIMAKANNILPKWMRFIRGVVDSEDIPLNLSRELLQESALIRKLREVLTNRVLRFFADQAKKEPEKYMSFYDDYGLFFREGIVTTADQNQREAVAKLLRFESSKSSSGERISLDDYASRMKAGERNIYFLAAPSRHLAETSPYYEAFRKRDIEVLFLYEAYDELVLMNLAQYDRKNLRSIENELHDDKENTDTVDTSDLHSLSKEDAESLKDWLKGVLLNRVNNIKMTRRLESHPCVITVQEMGAARHFLRTTLADKSQEERLRLLQPTLELNPSHSLVKKLSKLKSSDPQLAEMLAQQLYENAMINAGLIEDARLGMERLHHLLDRALESV 838          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. TrEMBL
Match: K1QDN1 (Heat shock protein 75 kDa, mitochondrial (Fragment) OS=Crassostrea gigas OX=29159 GN=CGI_10024309 PE=3 SV=1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 350/640 (54.69%), Postives = 482/640 (75.31%), Query Frame = 1
Query:  151 EDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKL-DSIIGKFGVGFYSSFMVADKVEVFSRSHR-SNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            ED H IIKD+E+  G  +  EF+AETRKLLDIVA+SLYS+KEVFIREL+SNASDALEKLRY + T  ++ D ++ P EIHI  DE K  F IQDTGIGMTKEEMI+NLGTIA+SGS EFL+ V  +   +  SIIG+FGVGFYSSFMVA+KVEV+S+S++  +  F W S GT GSY+I+EA+ V+ GTKI+LHLK D   ++ E  I+++I KYSN+VG  IYLNGK+ +++QPLW+  P ++T+  H EFY++I GN YD PRYV+ ++ID PL+I++LFY+P  KPT++++SRE+D  V+LYSRKVMIM +   +LP WLRF+KGVV+S+DIPLNLSRELLQDSALI K+N VLT R+IK+  DQ+K+D + Y+QF+ D+GL+ +EGIV + DQ  +E I KLLRFESSK   G+     EY++RMKAG+R IF+ SAP R++AE SPYLEA++++D EVL+L EPYDE+V+M LG F  K+L SIE E +        I+     S+++ +A++L  WI   +  KV+ VK+T+RL++HPC+++V  M + RHF++T+L  K++EE++ L+  T+E+NP+H L+KKL  L   + +L ++++ QL+ NA++ AGLV D R  +  LNELL KA +K
Sbjct:    2 EDYHSIIKDTERSKGPSDHHEFQAETRKLLDIVARSLYSEKEVFIRELISNASDALEKLRYQQMTDSEIRDSDV-PLEIHIGVDEDKKTFTIQDTGIGMTKEEMIENLGTIAKSGSKEFLETVSKKPGDIGSSIIGQFGVGFYSSFMVAEKVEVYSQSNKPGSQAFCWTSDGT-GSYDIAEAEGVQRGTKIVLHLKGDSYNYAKEDRIKEVIKKYSNFVGVPIYLNGKRANIVQPLWMMDPKSITDDMHEEFYRFI-GNVYDKPRYVLQYKIDAPLNIRALFYVPEYKPTMFDMSRETDVSVNLYSRKVMIMPKANYILPRWLRFMKGVVDSEDIPLNLSRELLQDSALIRKLNDVLTTRIIKFFMDQSKKDPQTYLQFYEDYGLFFREGIVTTHDQDLRERIAKLLRFESSKTAPGELIGLDEYADRMKAGARDIFYLSAPNRQLAERSPYLEALQKEDKEVLFLYEPYDELVLMNLGQFYKKNLKSIENEITS-VDKDGEIEEGEPGSLSRTEAKDLMDWISNVLMNKVSKVKVTKRLSSHPCVITVAEMASARHFLRTTLAGKSQEERYRLLQPTLEINPSHPLIKKLNSLQTNNPDLGRLVLEQLYDNAMIHAGLVDDPRTMVDRLNELLEKALDK 637          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. TrEMBL
Match: G7Y4A3 (TNF receptor-associated protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_100803 PE=3 SV=1)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 347/665 (52.18%), Postives = 486/665 (73.08%), Query Frame = 1
Query:  100 VLTVCSKTFSSEAAVNSEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV--KNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND----GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEK--DIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVEL--HKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            +L   S++  S++    E +   ++D E + G    ++F+AET+KLLDIVAKSLYS+KEVFIREL+SNASDA+E+LR+ RTT     D++  P EIH+KTDE K+L +IQDTG+GM++EEM  NLGTIARSGS EFL  +  +N+ A    IIG+FGVGFY++FMVADKVEV+SR H  +     G  W S+G  G +E+ EA+ V  GTKII+HLK    EF+ E  +E I+ KYSN+VG+ IYLNG++++ ++P+WLK P+ VTE EH  FY+Y++GNTYDSPRY + ++ D P++++ L Y+P+ KP++++++RESD GV+LYSRKV+IM+RT  LLP WLRF KGVV+S+D+PLNLSRELLQDSALI++I R+LT RV+++   Q+ R+ EK+ +F  DFGLYLKEG++   +Q  +E I KLLR+E+S LP  + TS +EY+ RM AG R I+F SAP+R++AE SPYLEAI++K   IEVL+L EPYDE+V+MQLG ++ K L SIET  +EDA++ + +       +TQ++A  L  W +  +  KV NVK+TQRLT+HPC +SV+  GA+RHF++T+L D+  EE+F +M   +ELNP H LV+ L +L  + +DE+LAK L+  L   A+ QAGL+ D R   G +N+L+TK   K
Sbjct:   10 ILGYDSRSLDSDS--TQERLLLSVEDVEHVRGPATKKKFQAETQKLLDIVAKSLYSEKEVFIRELISNASDAIERLRFERTTAESTSDDS--PMEIHVKTDEKKHLLVIQDTGVGMSREEMELNLGTIARSGSREFLSSLDKQNQGASNTDIIGQFGVGFYATFMVADKVEVYSRPHPQDGQETVGHRWSSTGHDGEFELHEAENVSPGTKIIMHLKDSALEFAREEVVEGILKKYSNFVGAPIYLNGRRVNAIEPIWLKDPSQVTEEEHNSFYQYLSGNTYDSPRYTLMYKTDAPINLRVLLYVPNWKPSIFDVARESDNGVALYSRKVLIMNRTATLLPKWLRFFKGVVDSEDVPLNLSRELLQDSALINRIKRLLTARVLRFFSQQSSREPEKFGRFLKDFGLYLKEGLITEPEQEVREQIAKLLRWETSALPPEQTTSLEEYAGRMVAGERTIYFLSAPSRQLAEASPYLEAIRKKSPQIEVLFLYEPYDELVLMQLGQYDKKSLRSIETTIAEDAADTDSVGPERPNCLTQDEASRLVSWAKNVLGLKVKNVKVTQRLTSHPCFVSVREAGAMRHFLRTTLADRPAEERFHVMEPILELNPEHDLVRYLSQLLSNPSDEDLAKALLGHLFDCAIAQAGLLDDVRGLAGRMNDLVTKLIHK 670          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. TrEMBL
Match: A0A3R7FDC4 (Heat shock protein 75 kDa OS=Clonorchis sinensis OX=79923 GN=Trap1 PE=3 SV=1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 343/642 (53.43%), Postives = 476/642 (74.14%), Query Frame = 1
Query:  169 IKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV--KNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND----GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEK--DIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVEL--HKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            ++D E + G    ++F+AET+KLLDIVAKSLYS+KEVFIREL+SNASDA+E+LR+ RTT     D++  P EIH+KTDE K+L +IQDTG+GM++EEM  NLGTIARSGS EFL  +  +N+ A    IIG+FGVGFY++FMVADKVEV+SR H  +     G  W S+G  G +E+ EA+ V  GTKII+HLK    EF+ E  +E I+ KYSN+VG+ IYLNG++++ ++P+WLK P+ VTE EH  FY+Y++GNTYDSPRY + ++ D P++++ L Y+P+ KP++++++RESD GV+LYSRKV+IM+RT  LLP WLRF KGVV+S+D+PLNLSRELLQDSALI++I R+LT RV+++   Q+ R+ EK+ +F  DFGLYLKEG++   +Q  +E I KLLR+E+S LP  + TS +EY+ RM AG R I+F SAP+R++AE SPYLEAI++K   IEVL+L EPYDE+V+MQLG ++ K L SIET  +EDA++ + +       +TQ++A  L  W +  +  KV NVK+TQRLT+HPC +SV+  GA+RHF++T+L D+  EE+F +M   +ELNP H LV+ L +L  + +DE+LAK L+  L   A+ QAGL+ D R   G +N+L+TK   K
Sbjct:   93 VEDVEHVRGPATKKKFQAETQKLLDIVAKSLYSEKEVFIRELISNASDAIERLRFERTTAESTSDDS--PMEIHVKTDEKKHLLVIQDTGVGMSREEMELNLGTIARSGSREFLSSLDKQNQGASNTDIIGQFGVGFYATFMVADKVEVYSRLHPQDGQETVGHRWSSTGHDGEFELHEAENVSPGTKIIMHLKDSALEFAREEVVEGILKKYSNFVGAPIYLNGRRVNAIEPIWLKDPSQVTEEEHNSFYQYLSGNTYDSPRYTLMYKTDAPINLRVLLYVPNWKPSIFDVARESDNGVALYSRKVLIMNRTATLLPKWLRFFKGVVDSEDVPLNLSRELLQDSALINRIKRLLTARVLRFFSQQSSREPEKFGRFLKDFGLYLKEGLITEPEQEVREQIAKLLRWETSALPPEQTTSLEEYAGRMVAGERTIYFLSAPSRQLAEASPYLEAIRKKSPQIEVLFLYEPYDELVLMQLGQYDKKSLRSIETTIAEDAADTDSVGPERPNCLTQDEASRLVSWAKNVLGLKVKNVKVTQRLTSHPCFVSVREAGAMRHFLRTTLADRPAEERFHVMEPILELNPEHDLVRYLSQLLSNPSDEDLAKALLGHLFDCAIAQAGLLDDVRGLAGRMNDLVTKLIHK 732          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. TrEMBL
Match: A0A074ZNT9 (Hsp90 protein OS=Opisthorchis viverrini OX=6198 GN=T265_07448 PE=3 SV=1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 355/695 (51.08%), Postives = 496/695 (71.37%), Query Frame = 1
Query:   22 MFRII----QRSLINRSVIKFGLANAIKPRVLTVCSKTFSSEAAVNSEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV--KNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSND----GFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEK--DIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVEL--HKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            +FR +    +R+L +R  I F  +  + P   T+  ++FS      S D      + E + G    ++F+AET+KLLDIVAKSLYS+KEVFIREL+SNASDA+E+LR+ RTT     D++  P EIH+KTDE K+L +IQDTG+GM++EEM  NLGTIARSGS EFL  +  +N+ A    IIG+FGVGFY++FMVADKVEV+SR +  +     G  W S+G  G +E+ EA+ V  GTKII+HLK    EFS E  +E I+ KYSN+VG+ IYLNG++++ ++P+WLK P+ VTE EH  FY+Y++GNTYDSPRY + ++ D P++++ L Y+P+ KP++++++RESD GV+LYSRKV+IM+RT  LLP WLRF KGVV+S+D+PLNLSRELLQDSALI++I R+LT RV+++   Q+ R+ EK+ +F  DFGLYLKEG++   +Q  +E I KLLR+E+S LP GK TS +EY+ RM AG R I+F SAP+R++AE SPYLEAI++K   IEVL+L EPYDE+V+MQLG ++ K L SIET  +ED+++ + +       +TQ++A  L  W +  +  KV NVK+TQRL  HPC +SV+  GA+RHF++T+L D+  EE+F +M   +ELNP H LV+ L +L  + +DE+LAK L+  L   A+ QAGL+ D R   G +N+L+TK   K
Sbjct:   14 IFRCVALANRRTLTHRHSI-FANSKTVTP---TLVGRSFSVANPSLSVD------EVEHVRGPATKKKFQAETQKLLDIVAKSLYSEKEVFIRELISNASDAIERLRFQRTTAESTSDDS--PMEIHVKTDERKHLLVIQDTGVGMSREEMELNLGTIARSGSREFLSSLEKQNQGASNTDIIGQFGVGFYATFMVADKVEVYSRPNSQDGQETVGHRWSSTGHDGEFELHEAENVSPGTKIIMHLKDSALEFSREDVVEGILKKYSNFVGAPIYLNGRRVNAIEPIWLKDPSQVTEEEHNSFYQYLSGNTYDSPRYTLMYKTDAPINLRVLLYVPNWKPSIFDVARESDNGVALYSRKVLIMNRTATLLPKWLRFFKGVVDSEDVPLNLSRELLQDSALINRIKRLLTARVLRFFSQQSSREPEKFERFLKDFGLYLKEGLITEPEQEVREQIAKLLRWETSALPPGKTTSLEEYAGRMVAGERTIYFLSAPSRQLAETSPYLEAIRKKSPQIEVLFLYEPYDELVLMQLGQYDRKSLRSIETTIAEDSADTDSVGPERPNCLTQDEASRLVSWAKGVLGLKVKNVKVTQRLVNHPCFVSVREAGAMRHFLRTTLADRPAEERFHVMEPILELNPEHDLVRYLSQLLSNPSDEDLAKTLLEHLFDCAIAQAGLLDDVRGLAGRMNDLVTKLIHK 696          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Cavefish
Match: trap1 (TNF receptor associated protein 1 [Source:NCBI gene;Acc:103028524])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 330/663 (49.77%), Postives = 474/663 (71.49%), Query Frame = 1
Query:   85 AIKPRVLTVCSKTFSSEAAVNSEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSN-DGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQS--ITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            ++  R + +C   +S+ A    E  H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+   TG   G ++  P E+H++TD +K + IIQDTGIGM +EE++ NLGTIARSGS  FLD ++++    +SIIG+FGVGFYS+FMVADKV+V+S+S  S   G+ W S G SG +EI+EA  V  GTKI+LHLK +C+EFS E  ++++INKYSN+V  SIYLNG++++ +Q LW+  P  ++E +H EFY+Y+    YD PRY +++R D PL+I+S+FY+P  KP+++++SRE  + V+LYS+KV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+SALI K+  VL  R+I++L DQ+K++ EKY +F  D+GL+++EGI+ + +Q  KE+I KLLRFESS LP GK TS  EY+ RMKAG+R +++  AP R +AE SPY EA+K+KDIEVL+  E +DE+ ++ L  F+ K L S ET+   D         +  +S  +T+ QAE L  W+   +  KV N+K+T RL THP +++V  MGA RHF++T  + +  +E+  ++  T+E+N  H L+KKL  L  ++ ELA++L+ Q+++NA++ AGL  D R  I  LN+LLTKA EK
Sbjct:  109 SVNHRNVNLC--FYSTHAETAEEPHHNIISDTENVQGSFIKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRHKIITG---GGQD-APLELHLQTDAAKGILIIQDTGIGMNQEELVNNLGTIARSGSKAFLDTLQSQSETSNSIIGQFGVGFYSAFMVADKVDVYSQSAESGVPGYKWSSDG-SGIFEIAEASGVRQGTKIVLHLKEECREFSSEDRVKEVINKYSNFVSFSIYLNGRRLNTLQALWMNDPKEISEWQHEEFYRYV-AQAYDKPRYTLHYRADAPLNIRSIFYVPETKPSMFDVSRELGSSVALYSKKVLIQTKATDILPKWLRFLRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRIIRFLLDQSKKEPEKYDRFFEDYGLFVREGIITTAEQDVKEDIAKLLRFESSILPPGKQTSLLEYTSRMKAGTRNVYYLCAPNRHLAECSPYFEAMKQKDIEVLFCFEQFDELTLLHLREFDKKKLISAETDIVVDHYKEEKFQDSRPESERLTEPQAEGLMAWMRNSLGQKVTNIKVTPRLDTHPAMITVLEMGAARHFLRTQQLARNVDERAQILQPTLEINIGHDLIKKLHMLKDSNPELAQLLLEQIYENAMITAGLTDDPRPMISRLNDLLTKALEK 763          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Cavefish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 307.375 bits (786), Expect = 3.509e-93
Identity = 216/693 (31.17%), Postives = 358/693 (51.66%), Query Frame = 1
Query:  139 AVNSEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTG--LQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV---KNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSY-EISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQ---------------------------------------------PLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT--LYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYI--QFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSE-DASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE---EKFMLMSATMELNPTHSLVKKLVEL--HKTDEELAKMLINQLHQNALVQAGL-VTDSRA 2019
             +N+  I  I + SEK +       F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R L  T      G+E L    + IK D+ KN+  I DTGIGMTKEE++KNLGTIA+SG+SEFL+K+   ++E      +IG+FGVGFYS+F+VAD V V S+ H ++    W+S     S  E    D +  GT I L LK +  ++ +   I+ ++ KYS ++   IY+  + I   Q                                             P+W +    V E E+  FYK  + +T + P   I+F  +  +  KS+ ++P+  P     E   + +  + L+ R+V I      ++P +L F+KGVV+SDD+PLN+SRE LQ   L+    +V+  ++++   D  K+ AE+    +F  +FG  +K G++   D S +  + KLLRF++S       +S ++Y ERMK    KI+F +  +R+ AE SP++E + +K  EV+YL EP DE  +  L  F+GK   ++  E  + D S         ++   +++ E LT W+ +  +K K+    ++QRLT  PC +     G    +   +K       ++     +     T+E+NP H L+K++++      +++ A  L   L + A +++G  + D++A
Sbjct:   60 GLNAAQIKEIREKSEKHV-------FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLLSLTNDDALAGNEELT---VKIKADKEKNMLHITDTGIGMTKEELVKNLGTIAKSGTSEFLNKMTEMQSEGQSTSELIGQFGVGFYSAFLVADSVIVTSK-HNNDTQHIWESDSNEFSVIEDPRGDTLGRGTTITLVLKEEASDYLELETIKNLVRKYSQFINFPIYVWSRPIDEEQAEPEAEKETTEDEAEVEEEEEDKDKPKTKKVEKTVWDWELMNDIKPIWQRHAKEVEEDEYKAFYKTFSRDT-EEPMSHIHFTAEGEVTFKSILFVPASAPRGLFDEYGSKKNDFIKLFVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLL----KVIRKKLVRKTLDMIKKIAEEQYNDKFWKEFGTNIKLGVIE--DHSNRTRLAKLLRFQTSH-SETVLSSLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVVYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESE----KAKEKREALEKEFEPLTTWMKDNALKDKIEKAVLSQRLTNSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTLEINPKHPLIKEMLKRVQDNAEDQTASDLAVVLFETATLRSGYQLADTKA 729          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 183.341 bits (464), Expect = 1.283e-48
Identity = 116/413 (28.09%), Postives = 223/413 (54.00%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            Y++ ++++  +PLW ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E  ++    + LY R+V IM    +L+P +L F++GVV+S+D+PLN+SRE+LQ S ++  I + L  + ++   + A+ D + Y +F+  F   +K GI    D   ++ + +LLR+ +S     +  S ++Y  RMK   + I++ +  T++   +S ++E +++  +EV+Y++EP DE  + QL  FEGK+L S+  E  E   +        +Q   + Q E L   ++  ++ KV  V ++ RL + PC +     G    +   +K   +       +M     +E+NP H +++ L    E  K D+ +  ++I  L + AL+ +G   D   +  N
Sbjct:  283 YIDQEELNKTKPLWTRNPDDITNEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKKK-NNIKLYVRRVFIMDNCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAE-DKDNYKKFYEQFSKNIKLGI--HEDSQNRKKLSELLRYYTSA-SGDEMVSLKDYVTRMKDTQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEFEGKNLVSVTKEGLELPEDEE---EKKKQEEKKAQFENLCKIMKDILEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHPIIETLRQKAEADKNDKSVKDLVI-LLFETALLSSGFTLDDPQTHSN 685          

HSP 2 Score: 165.236 bits (417), Expect = 1.807e-42
Identity = 89/210 (42.38%), Postives = 142/210 (67.62%), Query Frame = 1
Query:  196 NLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            ++E   F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RY   T     D   K  +I I  ++ +    I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA+KV V ++ H  ++ + W+SS G S + ++  ++ V  GTK+ILHLK D  E+ +ER I++I+ K+S ++G  I L
Sbjct:   13 DVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTEPSKLDSG-KDLKIEIIPNKEERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAEKVTVITK-HNDDEQYAWESSAGGSFTVKVDNSEPVNRGTKVILHLKEDQTEYIEERRIKEIVKKHSQFIGYPITL 217          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 183.341 bits (464), Expect = 1.425e-48
Identity = 116/413 (28.09%), Postives = 223/413 (54.00%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            Y++ ++++  +PLW ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E  ++    + LY R+V IM    +L+P +L F++GVV+S+D+PLN+SRE+LQ S ++  I + L  + ++   + A+ D + Y +F+  F   +K GI    D   ++ + +LLR+ +S     +  S ++Y  RMK   + I++ +  T++   +S ++E +++  +EV+Y++EP DE  + QL  FEGK+L S+  E  E   +        +Q   + Q E L   ++  ++ KV  V ++ RL + PC +     G    +   +K   +       +M     +E+NP H +++ L    E  K D+ +  ++I  L + AL+ +G   D   +  N
Sbjct:  282 YIDQEELNKTKPLWTRNPDDITNEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKKK-NNIKLYVRRVFIMDNCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAE-DKDNYKKFYEQFSKNIKLGI--HEDSQNRKKLSELLRYYTSA-SGDEMVSLKDYVTRMKDTQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEFEGKNLVSVTKEGLELPEDEE---EKKKQEEKKAQFENLCKIMKDILEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHPIIETLRQKAEADKNDKSVKDLVI-LLFETALLSSGFTLDDPQTHSN 684          

HSP 2 Score: 164.081 bits (414), Expect = 4.462e-42
Identity = 88/204 (43.14%), Postives = 139/204 (68.14%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RY   T     D   K  +I I  ++ +    I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA+KV V ++ H  ++ + W+SS G S + ++  ++ V  GTK+ILHLK D  E+ +ER I++I+ K+S ++G  I L
Sbjct:   18 FQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTEPSKLDSG-KDLKIEIIPNKEERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAEKVTVITK-HNDDEQYAWESSAGGSFTVKVDNSEPVNRGTKVILHLKEDQTEYIEERRIKEIVKKHSQFIGYPITL 216          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 182.956 bits (463), Expect = 1.563e-48
Identity = 110/412 (26.70%), Postives = 222/412 (53.88%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTD--EELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            Y++ ++++  +P+W ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R    L+E +++    + LY R+V IM   ++L+P +L F+KGVV+S+D+PLN+SRE+LQ S ++  I + L  + ++ L  +   D + Y + +  F   +K GI    D   ++ + +LLR+ +S     +  S ++Y  RMK   + I++ +  T++   +S ++E +++  +EV+Y++EP DE  + QL  ++GK+L S+  E  E   +    +   +Q   + + E L   ++  +  K+  V ++ RL   PC +     G    +   +K+  +       +M     +E+NP H +V+ L E  + D  ++  K L+  L + AL+ +G   +   +  N
Sbjct:  275 YIDAQELNKTKPIWTRNPDDITNEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRRAAFDLFE-NKKKRNNIKLYVRRVFIMDNCEELMPEYLNFMKGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLE-LFTEISEDKDNYKKLYEQFSKNIKLGI--HEDSQNRKKLSELLRYYTSN-SGDEMVSLKDYVSRMKDSQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKEYDGKNLLSVTKEGLELPEDE---EEKKKQDELKTKFENLCKIMKDILDKKIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLEDPQTHAN 677          

HSP 2 Score: 159.458 bits (402), Expect = 1.915e-40
Identity = 84/210 (40.00%), Postives = 140/210 (66.67%), Query Frame = 1
Query:  196 NLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQS-SGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            ++E   F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RY   T      E+ K  +I +  D       I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA++V V ++ H  ++ + W+S +G S + +    + +  GTK+ILHLK D  E+++E+ I++++ K+S ++G  I L
Sbjct:   13 DVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPS-KLESCKDLKIELIPDLKNRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAERVTVITK-HNDDEQYVWESAAGGSFTVKPDNGESIGRGTKVILHLKEDQSEYTEEKRIKEVVKKHSQFIGYPITL 217          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Sea Lamprey
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 214.542 bits (545), Expect = 7.416e-60
Identity = 189/686 (27.55%), Postives = 313/686 (45.63%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTT---GLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISE---ADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKK---------------------------------------------------ISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP--TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQ--FHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDE-MVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEEEK---FMLMSATMELNPTHSLVKKLVELHKTDEE--LAKMLINQLHQNALVQAG-LVTDSRASIGNLNELL 2046
            E   F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R +  T    L   DE      I IK D+ KNL  I            +     +A  G S               +IG+FGVGFYS+F+VAD++ V S+ H ++    W+S   S  + ++E    + +  GT I L LK +  ++ +   I+ ++ KYS ++   IY+   K                                                   ++ ++P+W +    V + E+  FYK  + ++ D P   I+F  +  +  +S+ ++P+  P     E   +    + +Y R+V I      ++P +L F+KGVV+SDD+PLN+SRE LQ   L+  I + L  + +    D  K+ A++  Q  F  +FG  +K G++   D S +  + KLLRF+SS     K TS +EY ERMK    KI+F +   R+  E SP++E + +K  EVL+L E  DE  +   LG F       + T  S    ++ +       ++ +      T  IEK          ++QRL   PC +     G    +   +K       ++     +     T E+NP H L+K+L+   +  EE   AK L   L + A +++G L+ D+R+    +  +L
Sbjct:   76 EKHVFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLMSLTDGKALDATDE----LTIKIKADKEKNLLHI-----------FLSRAQELATEGQS------------TSELIGQFGVGFYSAFLVADRIVVTSK-HNNDTQHIWESD--SSEFTVTEDPRGNTLARGTTITLVLKEEAADYLELETIKNLVKKYSQFINFPIYVWSSKTETVEEPIEEEEEEAKEEKADDSDDDVEVEEEDEKKPKTKKVEKTIWDWELMNDIKPIWQRVTKEVEDDEYKAFYKSFSKDS-DEPLTWIHFTAEGEVTFRSILFVPTSAPRGMFDEYGTKKTDFIKMYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIKKKLVRKTL----DMIKKIADESYQEKFWKEFGTNIKLGVIE--DHSNRTRLAKLLRFQSS-YGTDKLTSLEEYVERMKEKQDKIYFIAGANRKEVESSPFVERLLKKGYEVLFLTEAVDEYCIQSDLGQFMDLYASILITAWSRLGPSLRVYAA--RFAVQRGFPLLCTRQIEK--------ATVSQRLLGSPCALVASQYGWSGNMERIMKAQAYQTGKDAASNFYGSQKKTFEINPRHPLIKELLTRVQASEEDATAKDLALVLFETATLRSGYLLQDTRSFSDRIERML 713          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003399.1 (pep scaffold:Pmarinus_7.0:GL479675:6143:15195:1 gene:ENSPMAG00000002912.1 transcript:ENSPMAT00000003399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 2.355e-49
Identity = 115/413 (27.85%), Postives = 223/413 (54.00%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            Y++ ++++  +PLW ++P+++++ E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E  ++    + LY R+V IM   + L+P +L F+KGVV+S+D+PLN+SRE+LQ S ++  I + +  + ++     A+ D E Y +F+  F   +K GI    D   ++ + ++LR+ +S +      S +EY  RMK   + I++ +  ++E   +S ++E ++++ +EV+Y+ EP DE  + QL  F+GK L S+  E  E   + +      +Q   + + E L   +++ +  KV  V ++ RL   PC +     G    +   +K   +  +    +M     +E+NP H +V+ L    E  K D+ +  ++I  L + AL+ +G   D   +  N
Sbjct:  254 YVDKEELNKTKPLWTRNPDDISQEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKKK-NNIKLYVRRVFIMDNCEDLIPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCMELFTGLAE-DKENYKKFYEQFSKNMKLGI--HEDSQNRKRLSEMLRYHTS-VTGEDVCSLKEYVSRMKENQKHIYYITGESKEQVSNSAFVERVRKRGLEVVYMTEPIDEYCVQQLKEFDGKTLVSVTKEGLELPEDEDE---KKKQEEAKAKYENLCKVVKEILDKKVEKVTVSNRLVASPCCIVTSTYGWTANMERIMKAQALRDSSTMGYMAAKKHLEINPEHPIVETLRQKAEADKNDKSVKDLII-LLFETALLSSGFSLDDPQTHSN 656          

HSP 2 Score: 115.161 bits (287), Expect = 6.431e-27
Identity = 73/204 (35.78%), Postives = 124/204 (60.78%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RY          E+L        TD SK      D+G  + K ++I N     R+  + F++ ++   A  D S+IG+FGVGFYS++++A++V V ++ H  ++ + W+SS G S +  +   + +  GTKI+LHLK D  E+ +E+ I+ I+ K+S ++G  I L
Sbjct:   19 FQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRY----------ESL--------TDPSK-----MDSGKEL-KIDVIPN-----RNERTAFMEALQ---AGADISMIGQFGVGFYSAYLIAERVSVVTK-HNDDEQYLWESSAGGSFTVRLDNGESIGRGTKIVLHLKEDQSEYLEEKRIKDIVKKHSQFIGYPITL 189          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Sea Lamprey
Match: hsp90ab1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 80.4925 bits (197), Expect = 7.163e-17
Identity = 38/95 (40.00%), Postives = 67/95 (70.53%), Query Frame = 1
Query:  544 SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEI---SEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            S+IG+FGVGFYS+++VA++V V ++ H  ++ + W+SS   GS+ +   ++ + +  GTKI+LH+K D  E+ +ER+I+ I+ K+S ++G  I L
Sbjct:   51 SMIGQFGVGFYSAYLVAERVTVVTK-HNDDEQYVWESSA-GGSFTVRPDNDGEPLGRGTKIVLHIKEDQTEYLEERSIKDIVKKHSQFIGYPITL 143          

HSP 2 Score: 47.3654 bits (111), Expect = 5.411e-6
Identity = 19/64 (29.69%), Postives = 42/64 (65.62%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSR 1005
            Y + ++++  +PLW ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R
Sbjct:  208 YTDKEELNKTKPLWTRNPDDITAEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRR 270          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Yeast
Match: HSP82 (Hsp90 chaperone; redundant in function with Hsc82p; required for pheromone signaling, negative regulation of Hsf1p; docks with Tom70p for mitochondrial preprotein delivery; promotes telomerase DNA binding, nucleotide addition; protein abundance increases in response to DNA replication stress; contains two acid-rich unstructured regions that promote solubility of chaperone-substrate complexes; HSP82 has a paralog, HSC82, that arose from the whole genome duplication [Source:SGD;Acc:S000006161])

HSP 1 Score: 189.119 bits (479), Expect = 1.352e-51
Identity = 121/420 (28.81%), Postives = 230/420 (54.76%), Query Frame = 1
Query:  826 KKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQA----EELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGN-LNELLT 2049
            ++++  +PLW ++P+++T+ E+  FYK I+ N ++ P YV +F ++  L+ +++ +IP R P  L+E S++    + LY R+V I    + L+P WL F+KGVV+S+D+PLNLSRE+LQ + ++  I + +  ++I+  ++ A+ D+E++ +F++ F   +K G+    D   +  + KLLR+ S+K    + TS  +Y  RM    + I++ +  + +  E SP+L+A+K K+ EVL+L +P DE    QL  FEGK L  I  +          ++ T+E+   +E+     E LT  +++ +  +V  V ++ +L   P  +     G    +   +K   +  +    +M    T E++P   ++K+L   V+     ++  K L   L++ AL+ +G   D   S  + +N L++
Sbjct:  268 EELNKTKPLWTRNPSDITQEEYNAFYKSIS-NDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFE-SKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAE-DSEQFEKFYSAFSKNIKLGV--HEDTQNRAALAKLLRYNSTK-SVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFE--------LEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLIS 673          

HSP 2 Score: 149.058 bits (375), Expect = 6.092e-38
Identity = 86/209 (41.15%), Postives = 138/209 (66.03%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQS-SGTSGSYEISEADE-VEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            E  EF+AE  +L+ ++  ++YS+KE+F+REL+SNASDAL+K+RY   +  +  +     F I I     + +  I+D+GIGMTK E+I NLGTIA+SG+  F++ +    A  D S+IG+FGVGFYS F+VAD+V+V S+S+  ++ + W+S +G S +  + E +E +  GT + L LK D  E+ +E+ I+++I ++S +V   I L
Sbjct:    4 ETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLF-IRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALS---AGADVSMIGQFGVGFYSLFLVADRVQVISKSN-DDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQL 207          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Yeast
Match: HSC82 (Cytoplasmic chaperone of the Hsp90 family; plays a role in determining prion variants; redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels than HSP82 and induced 2-3 fold by heat shock; contains two acid-rich unstructured regions that promote the solubility of chaperone-substrate complexes; HSC82 has a paralog, HSP82, that arose from the whole genome duplication [Source:SGD;Acc:S000004798])

HSP 1 Score: 188.734 bits (478), Expect = 1.742e-51
Identity = 121/420 (28.81%), Postives = 229/420 (54.52%), Query Frame = 1
Query:  826 KKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQA----EELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGN-LNELLT 2049
            ++++  +PLW ++P+++T+ E+  FYK I+ N ++ P YV +F ++  L+ +++ +IP R P  L+E S++    + LY R+V I    + L+P WL F+KGVV+S+D+PLNLSRE+LQ + ++  I + +  ++I+  ++ A+ D+E++ +F++ F   +K G+    D   +  + KLLR+ S+K    + TS  +Y  RM    + I++ +  + +  E SP+L+A+K K+ EVL+L +P DE    QL  FEGK L  I  +          ++ T+E+   +E+     E LT  ++  +  +V  V ++ +L   P  +     G    +   +K   +  +    +M    T E++P   ++K+L   V+     ++  K L N L + AL+ +G   +   S  + +N L++
Sbjct:  264 EELNKTKPLWTRNPSDITQEEYNAFYKSIS-NDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFE-SKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAE-DSEQFDKFYSAFAKNIKLGV--HEDTQNRAALAKLLRYNSTK-SVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFE--------LEETDEEKAEREKEIKEYEPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLFETALLTSGFSLEEPTSFASRINRLIS 669          

HSP 2 Score: 147.517 bits (371), Expect = 1.668e-37
Identity = 85/209 (40.67%), Postives = 138/209 (66.03%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQS-SGTSGSYEISEADE-VEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            E  EF+AE  +L+ ++  ++YS+KE+F+REL+SNASDAL+K+RY   +  +  +     F I I     + +  I+D+GIGMTK E+I NLGTIA+SG+  F++ +    A  D S+IG+FGVGFYS F+VAD+V+V S+++  ++ + W+S +G S +  + E +E +  GT + L LK D  E+ +E+ I+++I ++S +V   I L
Sbjct:    4 ETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEPDLF-IRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALS---AGADVSMIGQFGVGFYSLFLVADRVQVISKNNE-DEQYIWESNAGGSFTVTLDEVNERIGRGTVLRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQL 207          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Nematostella
Match: EDO45666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS03])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 283/624 (45.35%), Postives = 435/624 (69.71%), Query Frame = 1
Query:  187 IIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNED-AKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSN-DGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKP-KVANVKITQRL--TTHPCLMSVKNMGAVRHF---IKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQA----GLVTDSRAS 2022
            ++G  + QEF+AET++LLDIVAKSLYS+KEVFIRE++SNASDALEK+R+   TG  +  E     EI I+TD+    F IQD G+GMT+EE++ +LG IA+SGS  F++K+KNE  +  ++IIG+FGVGFYS+FMVADKV+V+++S++ N  G++W S G SGSYE +EA+ V  GTK++LHLK DCK F+ +  +E I+ +YSN+VG  IYLNG  I+ +QPLW   P ++++ +H EFY++++   YD PRY ++++ D PL+I+S+FY P   P ++ + ++ ++G+SLYSR+V+I ++ +K+LP WLRF++GVV+S+DIPLNLSRELLQDSALI K++ VL+ R++K+L +QA++D  KY +F  D G++++EG+V + D+ +KE I KLL FESS    G  T+   Y  RMK   +K+++  AP+R++AE SPY E +K+ D+EVL+     D++V+  L  +E K + S E   SE A +    +    + +T E+ ++L GW+   + P +V  VK+++RL  T HP +++V +M A +H+   IKT    + E  K+ ++  T+E+NP H L+K+L +   ++ ELA ++ NQ++ NAL+ A    G   D R S
Sbjct:    6 VLGTPKRQEFQAETKQLLDIVAKSLYSEKEVFIREVISNASDALEKVRHFFLTGKDVS-ETETSLEIMIETDQEAGTFTIQDNGVGMTEEELMDHLGVIAKSGSKVFMEKLKNEARSSHENIIGQFGVGFYSTFMVADKVDVYTKSYQPNSQGYFWTSDG-SGSYEYAEANGVARGTKLVLHLKEDCKRFAMKTAVEDIVQRYSNFVGFPIYLNGVCINTIQPLWTLEPRDISKEQHDEFYQFLSKG-YDKPRYYLHYKTDAPLNIRSIFYFPETLPQMFNM-QQMESGISLYSRRVLIQAKAEKVLPRWLRFIRGVVDSEDIPLNLSRELLQDSALIKKLSNVLSARLVKFLQEQARKDRVKYEKFFKDCGIFIREGVVTTEDEEQKEEIAKLLLFESSNEKPGTLTNLPAYVSRMKPTQKKVYYLCAPSRDLAETSPYYETLKQNDVEVLFSYNEQDDVVLHYLRKYENKAVISAENFLSE-AEDTKPKNEPEVEDVTPEEGKDLAGWMSSILGPTRVVGVKVSKRLANTNHPAMITVPDMVAAKHWLKLIKTEHNKEVENMKYQIIQPTLEINPKHDLIKRLEKARGSNTELATLITNQMYDNALIAAVSDGGSTRDGRQS 624          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Nematostella
Match: HSP90 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ66])

HSP 1 Score: 186.037 bits (471), Expect = 6.713e-50
Identity = 119/407 (29.24%), Postives = 221/407 (54.30%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGW---IEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSL---VKKLVELHKTDEELAKMLINQLHQNALVQAGLV 2004
            Y   ++++  +P+W+++ + +T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E SR+    + LY R+V IM   + L+P +L F+KGVV+S+D+PLN+SRE+LQ + ++  I + L  + ++ L ++   D + Y +F+  FG  LK GI    D   +  +  LLR+ SS     + TS ++Y  RMK   + I+F +  +++   HS ++E +K +  EVLY++EP DE  + QL  ++GK L S+  E       + + +  +E+   +E+  +  G    I+  +  K+  V ++ RL + PC +     G    +   +K   +       +M     +E+NP H++   ++K VE  K D+ L K L+  L++ +L+ +G  
Sbjct:  278 YTEMEELNKTKPIWMRNADEITTEEYGEFYKSLT-NDWEEHLAVKHFSVEGQLEFRALLFVPKRAPFDLFE-SRKKRNNIKLYVRRVFIMDNCEDLIPEYLGFIKGVVDSEDLPLNISREMLQQNKILKVIRKNLVKKCME-LFNEIAEDQDNYKKFYEQFGKNLKLGI--HEDSVNRAKLADLLRYHSSS-SGDELTSLKDYVTRMKENQKDIYFITGESKDQVSHSAFVERVKSRGFEVLYMVEPIDEYAIQQLKEYDGKKLVSVTKE------GLELPEDEDEKKAREEKVAKYEGLCKVIKDILDKKIEKVVVSSRLVSSPCCIVTSQFGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHAIMDSLRKKVEADKNDKSL-KDLVMLLYETSLLTSGFT 671          

HSP 2 Score: 159.458 bits (402), Expect = 6.730e-41
Identity = 83/210 (39.52%), Postives = 144/210 (68.57%), Query Frame = 1
Query:  196 NLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQS-SGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            ++E   F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RYL  T   + D + K  +I +  ++ +N   IQD+G+GMTK +++ NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA+KV V +  H  ++ + W+S +G S + +    + +  GTKI+L+LK D  E+ +E+ I++I+ K+S ++G  + L
Sbjct:   15 DVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYLSLTDPSVLD-SCKDLKITLIPNKEENSLTIQDSGVGMTKADLVNNLGTIAKSGTKTFMEALQ---AGADISMIGQFGVGFYSAYLVAEKV-VVTTKHNDDEQYIWESAAGGSFTVKRDSGEPLGRGTKIVLYLKEDQTEYLEEKRIKEIVKKHSQFIGYPLSL 219          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Nematostella
Match: EDO45344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT97])

HSP 1 Score: 171.014 bits (432), Expect = 1.702e-44
Identity = 95/215 (44.19%), Postives = 142/215 (66.05%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLR---TTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDS---IIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISE---ADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            E  EF+AE  +++ ++  SLY +KE+F+REL+SN+SDAL+K+R +     T    GDE      I IK D+  N+  + DTGIGMTKEE+IKNLGTIA+SG+SEF  K++ E A  DS   +IG+FGVGFYSSF+VAD+V V S+++  +  + W+S  +  S+ ISE      ++ GT I LHLK + +++ +   I+ ++ KYS ++   I+L
Sbjct:   77 EKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNSSDALDKIRLMSLTDKTAFDSGDE----LSIKIKADKENNILHVTDTGIGMTKEELIKNLGTIAKSGTSEFFQKIQ-EAASSDSASDLIGQFGVGFYSSFLVADRVIVTSKNN-DDKQYIWESDAS--SFSISEDPRGPTLKRGTTISLHLKEEARDYLEPETIKDLVKKYSQFINFPIFL 283          

HSP 2 Score: 169.088 bits (427), Expect = 6.514e-44
Identity = 128/425 (30.12%), Postives = 217/425 (51.06%), Query Frame = 1
Query:  820 NGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT--LYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEH---SEDASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE---EKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAG-LVTDSRASIGNLNELL 2046
            + ++++  +P+W + P  + + E+ EFYK  T  + D P   I+F  +  +  +S+ ++P   P+    +  ++ DA + L+ R+V I    ++++P +L F++GVV+SDD+PLN+SRE LQ   L+  I + L  + +  +    K D      F  ++   +K G++   D S +  + KLLRF SS       TS  EY ERMK     I+F +   R+  E SP++E + ++  EVLYL+EP DE  M  L  FEGK   ++  E     ED+          E++      E L  W+ E  +K ++    I++RL   PC +   + G    +   +++    K+ +   E +     T+E+NP H LVK+L   VE +K D++ AK L   L + A +++G LV DS    G +  +L
Sbjct:  349 DWEQLNTNKPIWTRKPKEIKDDEYNEFYKSFTKESED-PLAKIHFVAEGEVTFRSILFVPKAAPSNLFSDYGKKMDA-IKLFVRRVFITDNFEEMMPKYLSFIRGVVDSDDLPLNVSREQLQQHKLLKVIKKKLVRKALDMIKKIPKEDY--MATFWKEYSTNIKLGVIE--DHSNRTRLAKLLRFYSSN-SEKDMTSLAEYIERMKEKQDVIYFMAGHNRKEVESSPFVEKLLKEGYEVLYLIEPVDEYCMQSLPEFEGKKFQNVAKEGLKIGEDSDKKKKKFEELEKTY-----EPLLKWLKEDALKDQIEKATISERLHDSPCALVASSYGWSGNMERIMRSQAYAKSSDPSNEYYATQKKTLEVNPRHPLVKQLLKRVEENK-DDQTAKDLSRILFETATLRSGYLVKDSADFAGRIERML 760          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Medaka
Match: trap1 (TNF receptor associated protein 1 [Source:NCBI gene;Acc:101155112])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 330/639 (51.64%), Postives = 461/639 (72.14%), Query Frame = 1
Query:  157 IHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRS-HRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQS--ITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEK 2064
            +H II D+E + G+    EF+AET+KLLDIVA+SLYS+KEVFIREL+SN SDALEKLR+   T    G E   P EIH+KTD  K    IQDTG+GM KEE++ NLGTIARSGS  FLD ++N+     SIIG+FGVGFYS+FMVAD+V+VF+RS  R   G+ W S G SG +E++EA  V+ GTKI+LHLK DCKEFS E  +++++ KYSN+V   I+LNG++++ +Q LWL  P  +++ +H EFY+YI    YD PRY +++R D PL+I+S+FY+P  KP+++++SRE  + V+LYSRKV+I ++   +LP WLRFL+GVV+S+DIPLNLSRELLQ+SALI K+  VL  RVI++L DQ+K++ EKY  F  D+GL+++EGIV + +Q  KE+I KLLRFESS LPAG+ T+  EY  RMKAG+R I++  AP R +AEHSPY EA+K+KD+EVL+  E +DE+ ++ L  F+ K L S+ET+   D       + +   S  +TQEQA++L  W++  + P+V N+K+T RL THP +++V  MGA RHF++T  + ++ EE+  ++  T+E+N  H L+KKL  L  ++ ELA +L+ Q++ NA++ AGL  D R  I  LN+LLTKA EK
Sbjct:   82 LHTIISDTESVQGSFSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNGSDALEKLRHKLITA---GGET-APMEIHLKTDAGKGTITIQDTGVGMNKEELVANLGTIARSGSKAFLDALQNQAEASSSIIGQFGVGFYSAFMVADRVDVFTRSADRDAPGYKWSSDG-SGLFEVAEASGVQQGTKIVLHLKDDCKEFSSEDRVKEVVTKYSNFVSFPIFLNGRRLNTLQALWLMEPKEISDWQHEEFYRYI-AQAYDKPRYTLHYRADAPLNIRSIFYVPDSKPSMFDVSREMGSSVALYSRKVLIQTKASDILPKWLRFLRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRVIRFLLDQSKKEPEKYNTFFEDYGLFMREGIVTTQEQDIKEDIAKLLRFESSALPAGQQTNLMEYGSRMKAGTRNIYYLCAPNRHLAEHSPYFEAMKKKDMEVLFCYEQFDELTLLHLREFDKKKLISVETDIMVDHYKEEKFEDSKPASERLTQEQADDLMAWMKNALGPRVTNIKLTPRLDTHPAMITVLEMGAARHFLRTQQLARSAEERAQILQPTLEINAGHDLIKKLHTLKDSNSELAVLLLEQVYDNAMIAAGLNDDPRPMIARLNDLLTKALEK 714          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Medaka
Match: hsp90b1 (heat shock protein 90 beta family member 1 [Source:NCBI gene;Acc:101166123])

HSP 1 Score: 312.383 bits (799), Expect = 6.720e-95
Identity = 219/694 (31.56%), Postives = 351/694 (50.58%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTT---GLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV---KNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSY-EISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQ-----------------------------------------------------PLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT--LYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYI--QFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCS-----IETEHSEDASNVNIIDCTNEQSITQEQAEELTGWI-EKQMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE---EKFMLMSATMELNPTHSLVKKLVELHKTDEE--LAKMLINQLHQNALVQAGL-VTDSRASIGNLNELL 2046
            E   F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R L  T    L   +E      I IK+D+ KN+  I DTGIGMTKEE+IKNLGTIA+SG+SEFL+K+   ++E      +IG+FGVGFYS+F+VADKV + S  H ++    W+S     S  E    D +  GT I L LK +  +F +   I+ ++ KYS ++   IY+   K   ++                                                     P+W +    V E E+  FYK  + ++ D P   I+F  +  +  KS+ ++PS  P     E   + +  V L+ R+V I      ++P +L F+KGVV+SDD+PLN+SRE LQ   L+    +V+  ++++   D  K+ AE+    +F  +FG  +K G++   D S +  + KLLRF++S    G   S ++Y ERMK    KI+F +  +R+ AE SP++E + +K  EV+YL EP DE  +  L  F+GK   +     ++ E SE A          ++   +++ E L  W+ +K +K K+    ++QRLT  PC +     G    +   +K       ++     +     T+E+NP H L+K+++     D E   A  L   L + A +++G  + D++A    +  +L
Sbjct:   75 EKHMFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLLSLTHEDALAANEE----LTIKIKSDKEKNMLHITDTGIGMTKEELIKNLGTIAKSGTSEFLNKMSEMQSEGQSTSELIGQFGVGFYSAFLVADKV-IVSSKHNNDTQHIWESDSNQFSVIEDPRGDTLGRGTTITLVLKEEASDFLELETIKNLVRKYSQFINFPIYVWASKTETVEEPIEEDAETEEPEKEASEDEVEVEEEEGEDKDKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKTFSKDSED-PLTHIHFTAEGEVTFKSILFVPSAAPRGLFDEYGSKKNDFVKLFVRRVFITDDFNDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLL----KVIRKKLVRKTLDMIKKIAEEQYNEKFWKEFGTNIKLGVIE--DHSNRTRLAKLLRFQTSNSETG-LASLEQYVERMKEKQDKIYFMAGTSRKEAESSPFVEKLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFEESEKAK--------EKREALEKEFEPLMTWLKDKALKDKIEKAVLSQRLTDSPCALVASQYGWSGNMERIMKAQAYQTGKDISTSYYASQKKTLEINPKHPLIKQMLGRVNDDAEDQTASDLAVVLFETATLRSGYQLADTKAYGDRIERML 747          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Medaka
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:100125466])

HSP 1 Score: 189.889 bits (481), Expect = 8.184e-51
Identity = 115/412 (27.91%), Postives = 225/412 (54.61%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTD--EELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            Y++ ++++  +P+W ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E  ++    + LY R+V IM   ++L+P +L F++GVV+S+D+PLN+SRE+LQ S ++  I + +  + ++   + A+ D E Y +F+  F   +K GI    D   ++ + +LLR+ SS+    + TS  EY  RMK   + I++ +  +++   +S ++E ++++  EVLY+ EP DE  + QL  F+GK+L S+  E  E   +        +    + + E L   +++ +  KV  V ++ RL + PC +     G    +   +K   +       +M+    +E+NP H +++ L +  +TD  ++  K L+  L + AL+ +G   D   +  N
Sbjct:  273 YIDQEELNKTKPIWTRNPDDITSEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKKK-NNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFGELAE-DKENYKKFYEGFSKNIKLGI--HEDSQNRKKLSELLRYHSSQ-SGDEMTSLTEYLSRMKENQKSIYYITGESKDQVANSAFVERVRKRGFEVLYMTEPIDEYCVQQLKEFDGKNLVSVTKEGLELPEDEE---EKKKMEDDKAKFENLCKLMKEILDKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIMETLRQKAETDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSN 675          

HSP 2 Score: 161.77 bits (408), Expect = 2.695e-41
Identity = 86/204 (42.16%), Postives = 138/204 (67.65%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            F+AE  +L+ ++  + YS+KE+F+REL+SNASDAL+K+RY   T     D   K  +I I  +++     I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA++V V ++ H  ++ + W+SS G S + ++   + +  GTKIILHLK D  E+ +E+ +++I+ K+S ++G  I L
Sbjct:   16 FQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSG-KDLKIDIIPNKADRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAERVVVITK-HNDDEQYAWESSAGGSFTVKVDSGEPIGRGTKIILHLKEDQTEYIEEKRVKEIVKKHSQFIGYPITL 214          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Medaka
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:100125466])

HSP 1 Score: 181.03 bits (458), Expect = 6.208e-48
Identity = 114/412 (27.67%), Postives = 219/412 (53.16%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTD--EELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            Y++ ++++  +P+W ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R P  L+E  ++    + LY R+V IM   ++L+P +L F++GVV+S+D+PLN+SRE+LQ S ++  I + +  + ++   + A+ D E Y +F+  F   +K GI    D   ++ + +LLR+ SS+    + TS  EY  RMK   + I++ +  +++   +S ++E ++++  EVLY+ EP DE  + QL  F+GK+L S+  E                     E  E+     + +   KV  V ++ RL + PC +     G    +   +K   +       +M+    +E+NP H +++ L +  +TD  ++  K L+  L + AL+ +G   D   +  N
Sbjct:  273 YIDQEELNKTKPIWTRNPDDITSEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKKK-NNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFGELAE-DKENYKKFYEGFSKNIKLGI--HEDSQNRKKLSELLRYHSSQ-SGDEMTSLTEYLSRMKENQKSIYYITGESKDQVANSAFVERVRKRGFEVLYMTEPIDEYCVQQLKEFDGKNLVSVTKE-------------------GLELPEDEEEKKKMEDDKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIMETLRQKAETDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSN 659          

HSP 2 Score: 161.77 bits (408), Expect = 2.334e-41
Identity = 86/204 (42.16%), Postives = 138/204 (67.65%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSS-GTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            F+AE  +L+ ++  + YS+KE+F+REL+SNASDAL+K+RY   T     D   K  +I I  +++     I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA++V V ++ H  ++ + W+SS G S + ++   + +  GTKIILHLK D  E+ +E+ +++I+ K+S ++G  I L
Sbjct:   16 FQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSG-KDLKIDIIPNKADRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAERVVVITK-HNDDEQYAWESSAGGSFTVKVDSGEPIGRGTKIILHLKEDQTEYIEEKRVKEIVKKHSQFIGYPITL 214          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 179.489 bits (454), Expect = 2.869e-47
Identity = 112/413 (27.12%), Postives = 221/413 (53.51%), Query Frame = 1
Query:  814 YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKP-TLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            Y++ ++++  +P+W ++P+++T  E+ EFYK +T N ++    V +F ++  L+ ++L ++P R    L+E +++    + LY R+V IM    +L+P +L F+KGVV+S+D+PLN+SRE+LQ S ++  I + L  + ++ L  +   D + Y + +  F   +K GI    D   ++ + +LLR+ +S     +  S ++Y  RMK   + I++ +  T++   +S ++E +++  +EV+Y++EP DE  + QL  F+GK+L S+  E  E   +        +Q   + Q E L   ++  ++ KV  V ++ RL + PC +     G    +   +K   +       +M     +E+NP H +++ L    E  K D+ +  ++I  L + AL+ +G   +   +  N
Sbjct:  276 YIDAQELNKTKPIWTRNPDDITNEEYGEFYKSLT-NDWEDHLAVKHFSVEGQLEFRALLFVPRRAAFDLFE-NKKKRNNIKLYVRRVFIMDNCDELIPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLE-LFTELSEDKDNYKKLYEQFSKNIKLGI--HEDSQNRKKLSELLRYYTSA-SGDEMVSLKDYVSRMKDNQKHIYYITGETKDQVANSAFVERLRKAGLEVIYMIEPIDEYCVQQLKDFDGKNLVSVTKEGLELPEDEEE---KKKQEEKKAQFENLCKIMKDILEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHPIMETLRQKAEADKNDKSVKDLVI-LLFETALLSSGFTLEDPQTHAN 678          

HSP 2 Score: 163.31 bits (412), Expect = 8.372e-42
Identity = 86/209 (41.15%), Postives = 139/209 (66.51%), Query Frame = 1
Query:  199 LEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQS-SGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL 819
            +E   F+AE  +L+ ++  + YS+KE+F+REL+SN+SDAL+K+RY   T     D + K  +I ++ D       I DTGIGMTK ++I NLGTIA+SG+  F++ ++   A  D S+IG+FGVGFYS+++VA+KV V ++ H  ++ + W+S +G S + +    + +  GTK+ILHLK D  E+ +E+ I+++I K+S ++G  I L
Sbjct:   13 VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLD-SCKELKIEVRPDLHARTLTINDTGIGMTKADLINNLGTIAKSGTKAFMEALQ---AGADISMIGQFGVGFYSAYLVAEKVTVITK-HNDDEQYIWESAAGGSFTVKPDNGEPIGRGTKVILHLKEDQTEYCEEKRIKEVIKKHSQFIGYPITL 216          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Planmine SMEST
Match: SMESG000016949.1 (SMESG000016949.1)

HSP 1 Score: 1405.19 bits (3636), Expect = 0.000e+0
Identity = 682/682 (100.00%), Postives = 682/682 (100.00%), Query Frame = 1
Query:   22 MFRIIQRSLINRSVIKFGLANAIKPRVLTVCSKTFSSEAAVNSEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEKI 2067
            MFRIIQRSLINRSVIKFGLANAIKPRVLTVCSKTFSSEAAVNSEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEKI
Sbjct:    1 MFRIIQRSLINRSVIKFGLANAIKPRVLTVCSKTFSSEAAVNSEDIHCIIKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQLHQNALVQAGLVTDSRASIGNLNELLTKAFEKI 682          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Planmine SMEST
Match: SMESG000025598.1 (SMESG000025598.1)

HSP 1 Score: 299.671 bits (766), Expect = 3.635e-91
Identity = 199/675 (29.48%), Postives = 352/675 (52.15%), Query Frame = 1
Query:  190 IGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLD-SIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISEADE--VEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSI-----------------------------------------------------YLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMG---AVRHFIKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTD--EELAKMLINQLHQNALVQAGLVTDSRASIGN 2031
            I   E   F+AE  +L+ ++  + YS+KE+F+REL+SNASDAL+K+RY   T   + D   K   I +  D+  N   + DTG+GMTK E+I NLGTIARSG+  F++ +    A  D S+IG+FGVGFYS+++VAD+V+V ++S+  ++ + W+SS   GS+ I   D   +  GTKIILH+K D  E+ DE+ I++II K+S ++G  I                                                     Y++ ++++  +P+W ++P+++++ ++ EFYK ++ N ++    V +F ++  L+ K++ + P R       +++    + LY R+V IM   + L+P +L F+KGVV+S+D+PLN+SRE+LQ + ++  + + +  + I+ L D+   D + Y +F+  F   +K GI    D   +  + + LR+ S+     +  S ++Y  RMK   + I++ +   +E    S ++E + ++  EVL++++P DE  + QL  F+GK L  +  E  E   +        +    + + E L   ++  +  KV  V ++ RL   PC +     G    +   +K   +  +    +M     +E+NP HS++K L +   TD  ++  K LIN L + +L+ +G   +     GN
Sbjct:    4 IPEAETFAFQAEISQLMSLIINTFYSNKEIFLRELISNASDALDKVRYKSLTDPSVLDSQ-KELMIKVIPDKDSNTLTLYDTGVGMTKAELINNLGTIARSGTKAFMEALT---AGADISMIGQFGVGFYSAYLVADRVQVITKSNE-DEQYMWESSA-GGSFTIKHDDSEPIGRGTKIILHMKEDQVEYLDEKKIKEIIKKHSQFIGYPIKLVLEKERDTEVADDEVEEETEKDDEDKPKIEDLDEEEGEKSSEKKKKTIKEKYIDEEELNKTKPIWTRNPDDISQEDYSEFYKSLS-NDWEDHLAVKHFAVEGQLEFKAILFCPKRASFDMFENKKKRNNIKLYVRRVFIMDNCEDLIPEYLSFIKGVVDSEDLPLNISREMLQQNKILKVVRKNIVKKCIE-LFDEIMEDKDNYKKFYEQFAKNIKLGI--HEDSVNRNKLAEFLRYNSTS-SGEEMISLKDYVSRMKENQKDIYYITGENKETVAKSAFVERLSKRGFEVLFMVDPIDEYSVQQLKEFDGKKLVCVTKEGLELPEDEEE---KKKFEEQKAEFESLCKVMKDVLDKKVEKVTVSNRLVDSPCCVVTSQFGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSIMKSLKKRVDTDKNDKAVKDLINLLFETSLLTSGFSLEEPQVHGN 664          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Planmine SMEST
Match: SMESG000041107.1 (SMESG000041107.1)

HSP 1 Score: 299.671 bits (766), Expect = 2.822e-90
Identity = 205/656 (31.25%), Postives = 345/656 (52.59%), Query Frame = 1
Query:  214 FKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDA--KLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGS-YEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYLNGKK----------------------------------------------ISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDA-GVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQ-SITQEQAEELTGWIEKQ-MKPKVANVKITQRLTTHPCLMSVKN---MGAVRHFIKTSLIDKTEEEKFMLMSAT---MELNPTHSLVKKL---VELHKTDEELAKMLINQLHQNALVQAG 1998
            F+AE  K++ ++  SLY +KE+F+REL+SNASDAL+K+R++  T     D   K   I IK D+      I DTG+GMTK+++I NLGTIA+SG+S+FL K+ +  +  ++  +IG+FGVGFYSSF+VADKV V S+ H  +    W+S   S S  E    + +  GT+IILHLK +  E+ +  +++ ++ KYS ++   IYL   K                                              ++  +P+W +  +++ + E+ EFYK   G T ++P   I+F  +  +  KS+ ++P++ P  Y  + E+    + +Y R+V I      ++P +L F+ G+V+SDD+PLN+SRE LQ + L+  I + L  + +  L   ++ D +K   F  +F   LK G+V   D S +  + KLLRF +S     K ++  +Y  RMK     I++ +  +++    SP +E + +K  EV+Y+++P DE V+  L  FEGK + ++  E        +  D   EQ  IT ++ E L  W++   +  ++   +I++RL+T PC +        G +   +K               S+    +E+NP H L+K+L   VE + TDE+ AK +   L++ A++++G
Sbjct:   86 FQAEVDKMMKLIINSLYKNKEIFLRELISNASDALDKIRFISLTDSTALDA-FKDLHIKIKADKDGKSLHIVDTGVGMTKQDLITNLGTIAKSGTSDFLKKLSDSKSTNEMSDLIGQFGVGFYSSFLVADKVTVISK-HNDDKQHIWESDANSFSVVEDPRGNTLLRGTEIILHLKEEAHEYLEADSLKNLVTKYSQFINFPIYLWSSKTETVEEKPIETKNEDTEKKDEDVTVEEEKEKEKPKKVDKTVWDWELVNKNKPIWTRKASDIKDEEYNEFYKSF-GKTSENPLAKIHFTAEGEVTFKSILFVPAKPPYNYYQNPETHRDNIKMYVRRVFITDDFNDMMPKYLSFIVGIVDSDDLPLNVSRETLQQNKLLKVIKKKLVRKTLDMLKKMSEEDFDK---FWKEFSTSLKLGVVE--DVSNRTRLAKLLRFWTSH-NDKKQSTLTDYVSRMKEKQEVIYYIAGHSKDDLIKSPLVEKVLKKGFEVVYMIDPVDEYVVQSLTEFEGKKMQNLGKE----GVKFDDSDKAKEQREITAKEFEPLLKWLKDSVLNEQIEKAEISERLSTSPCAVVASTYGWTGNMERIMKAQAYQSASNSYNEYQSSQKKILEINPKHPLIKELKRQVEKNPTDEK-AKDIALTLYETAILRSG 727          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Planmine SMEST
Match: SMESG000054819.1 (SMESG000054819.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.486e-88
Identity = 205/662 (30.97%), Postives = 349/662 (52.72%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKV---KNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGS-YEISEADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL----------------------------NGKK-----------ISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEK-YIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEK-QMKPKVANVKITQRLTTHPCLMSVKNMGA---VRHFIKTSLIDKTEE--EKFML-MSATMELNPTHSLVKKLVELHKTDEEL--AKMLINQLHQNALVQAGLVTDSRASIG 2028
            E   F+AE  +++ ++  SLY +KE+F+REL+SNASDAL+K+R++  T      +N +   I IK D++     I DTG+GMTK E+IKNLGTIA+SG+S+F+ K+   KN   +L+ +IG+FGVGFYSSF+VADKV V S+S  ++  + W+S  ++ S       + +E GT++ILHLK +  EF +   +  +I+KYS ++   IYL                            N +K           ++  +P+W +      + E+ EFYK  + ++ ++P    +F  +  +  K++ YIP +    +    + +  + LY ++V I      ++P +L F+KG+++SDD+PLN+SRE LQ   L+  I + L  + +    D  K+  E  + +F  ++   +K G++   D S +  + KL+RF SS       TS  +Y  RMK    KIFF +  +    + SP +E + +K  EVLYL+EP DE     L  FEGK   ++  E  +   +   I+   +    +++ E L  W++  ++K  +  V+I++RLTT PC++     G    +   +K     K+EE  + + +     +E+N  HSL++ L       +++   + L   L+  AL+++G + D+ AS  
Sbjct:   94 EKYTFQAEVDRMMKLIINSLYKNKEIFLRELISNASDALDKIRFISLTNQDRNFDN-EDLYIKIKADKAAKTIHILDTGVGMTKTELIKNLGTIAKSGTSDFIQKLSEAKNT-GELNELIGQFGVGFYSSFLVADKVTVISKSD-ADYQYIWESDASTFSIVRDPRGNTLERGTEVILHLKDEVLEFLEIDVLRNLIHKYSQFINFPIYLWKSSVKNVDEDHESAVSKRDEDANVENENERKSTERTVWDWELVNKNKPIWTRKSGETPDEEYNEFYKSFSKDS-ENPLAKTHFTAEGEVQFKAILYIPKKSNVEFNSVDKKNDNIKLYVKRVFITDDFDDIMPKYLSFMKGIIDSDDLPLNVSRETLQQHKLLKVIKKKLVRKTL----DMFKKLPEDIFKEFWKEYATNIKLGVIE--DVSNRNRLAKLIRFWSSH-SQESQTSLADYVSRMKPTQDKIFFIAGVSLSDVQLSPMVEILLKKQYEVLYLIEPIDEYTFQSLPEFEGKKFQNVAKEGFKLDDSDKKIEIKEK---LEKEYEPLINWLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFS 741          
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Planmine SMEST
Match: SMESG000068132.1 (SMESG000068132.1)

HSP 1 Score: 294.664 bits (753), Expect = 4.548e-88
Identity = 208/694 (29.97%), Postives = 367/694 (52.88%), Query Frame = 1
Query:  202 EAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDALEKLRYLRTTGLQ-LGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIKNLGTIARSGSSEFLDKVKNEDAKLDS-IIGKFGVGFYSSFMVADKVEVFSRSHRSNDGFYWQSSGTSGSYEISE---ADEVEHGTKIILHLKSDCKEFSDERNIEKIINKYSNYVGSSIYL------------------------------------------------NGKKISMMQPLWLKSPNNVTEMEHVEFYKYITGNTYDSPRYVINFRIDVPLDIKSLFYIPSRKPT-LYEISRE-SDAGVSLYSRKVMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLTGRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLRFESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKEKDIEVLYLLEPYDEMVMMQLGSFEGKDLCSI--------ETEHSEDASNVNIIDCTNEQSITQEQAEELTGWIEKQMKPK---VANVKITQRLTTHPCLMSVKNMGAVRHF--IKTSLIDKTEE----EKFMLMSATMELNPTHSLVKKLVEL--HKTDEELAKMLIN---QLHQNALVQAGLVTDSRASIGNLNELLTK 2052
            E  +F+AE  +++ ++  SLY++KE+F+REL+SNASDAL+K+R++  T    LG  N     I IK D+  N+  I DTGIGMT++E++K LGTIA+SG++EFL K++ E  +  S  IG+FGVGFYS ++VAD V V S+++ ++D + W+S  +S ++ +++    + +  GT+I+L LK    E+ +  N+ +++ +YS Y+   IYL                                                + ++I+  +P+W + P  V+E E+ EF+K +  +  D P   I+F  +  +  KSL YIPS+ P  L+E  RE  D+ + LY R+V I  + + ++P +L F+ G+V+SDD+PLN+SRE LQ   L+  I + L  +V+  +    K  +E++ +F  +F   +K G++   D + +  + KL++  SSK  A   T+F EY  RMK+   +I++      E A++SP++E   + D EVL+  +  DE  +  +  +EG  L ++        +TE S+   N       N+++    +   L  +I+  ++P    + N+ +T RL + P ++  ++ G   +   +  S   K EE    ++ + +   +E+NP H ++ KL  L  +  +     +LIN    L + A++ +G +        N+ E + K
Sbjct:   97 EKFQFQAEVDRMMKLIINSLYTNKEIFLRELISNASDALDKIRFISLTDPSVLG--NFPELSIKIKADKINNMLRIIDTGIGMTRDELVKQLGTIAKSGTTEFLSKIEKEKTENTSDFIGQFGVGFYSVYLVADSVTVISKNN-NDDQYIWESD-SSNTFSVTKDPRGNTLGRGTEIVLRLKPSASEYLESENLRRLVRQYSQYLSFPIYLWTSKTSEENSLKKTNEVKADSKDDESATVTDEEPKSDVSPPKKSSVVWDWERINSQKPIWTRKPAEVSEEEYNEFFKTLLKSD-DKPLSKIHFNAEGEVSFKSLLYIPSKAPANLFE--REIKDSSIRLYVRRVFITDKIRDIIPRYLSFIIGIVDSDDLPLNVSRETLQQEKLLKVIQKKLVRKVLDMIK---KLKSEQFGKFWKEFRAGIKMGLIE--DDTNRNRLTKLIQMHSSKSLAN-LTTFAEYVSRMKSQQEEIYYIVEENLEQAKNSPFIEKFLKYDYEVLFFTDTLDEHALHLMEKYEGTKLSNLARGGIFFDKTEGSKSRLN-------NKKN----EFRPLIDFIKTDIEPGKEFIENIVLTDRLVSAPMMVVPQDQGWTGNMERLARSQSGKQEESGVIQQHIKVKKNLEINPKHPIIIKLNNLINNHANPRSDLLLINYAQSLLETAIISSGYLVSDVTKYANMVEDILK 766          
The following BLAST results are available for this feature:
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAP10.000e+050.23TNF receptor associated protein 1 [Source:HGNC Sym... [more]
TRAP10.000e+051.18TNF receptor associated protein 1 [Source:HGNC Sym... [more]
TRAP10.000e+048.71TNF receptor associated protein 1 [Source:HGNC Sym... [more]
HSP90B11.264e-9231.78heat shock protein 90 beta family member 1 [Source... [more]
TRAP11.544e-7351.18TNF receptor associated protein 1 [Source:HGNC Sym... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-757.762e-16240.58Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H... [more]
hsp-757.762e-16240.58Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H... [more]
hsp-759.249e-11143.37Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H... [more]
hsp-759.249e-11143.37Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:H... [more]
hsp-908.416e-10331.36Heat shock protein 90 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trap10.000e+050.39gene:FBgn0026761 transcript:FBtr0086149[more]
Trap10.000e+050.39gene:FBgn0026761 transcript:FBtr0336666[more]
Gp931.571e-8931.02gene:FBgn0039562 transcript:FBtr0085254[more]
Hsp834.739e-4927.94gene:FBgn0001233 transcript:FBtr0332873[more]
Hsp834.739e-4927.94gene:FBgn0001233 transcript:FBtr0073040[more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trap10.000e+051.40TNF receptor-associated protein 1 [Source:ZFIN;Acc... [more]
trap10.000e+051.56TNF receptor-associated protein 1 [Source:ZFIN;Acc... [more]
trap10.000e+051.56TNF receptor-associated protein 1 [Source:ZFIN;Acc... [more]
hsp90b12.564e-9531.61heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90b15.956e-9531.61heat shock protein 90, beta (grp94), member 1 [Sou... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAP10.000e+048.65TNF receptor-associated protein 1 [Source:NCBI gen... [more]
TRAP10.000e+048.65TNF receptor-associated protein 1 [Source:NCBI gen... [more]
TRAP10.000e+048.65TNF receptor-associated protein 1 [Source:NCBI gen... [more]
TRAP10.000e+048.14TNF receptor-associated protein 1 [Source:NCBI gen... [more]
TRAP10.000e+048.21TNF receptor-associated protein 1 [Source:NCBI gen... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trap10.000e+049.70TNF receptor-associated protein 1 [Source:MGI Symb... [more]
Hsp90b11.850e-9231.87heat shock protein 90, beta (Grp94), member 1 [Sou... [more]
Hsp90aa11.999e-5029.03heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90aa11.999e-5029.03heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90ab11.892e-4928.61heat shock protein 90 alpha (cytosolic), class B m... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XHZ0|TRAP1_RAT0.000e+049.70Heat shock protein 75 kDa, mitochondrial OS=Rattus... [more]
sp|Q9CQN1|TRAP1_MOUSE0.000e+049.70Heat shock protein 75 kDa, mitochondrial OS=Mus mu... [more]
sp|Q12931|TRAP1_HUMAN0.000e+050.23Heat shock protein 75 kDa, mitochondrial OS=Homo s... [more]
sp|Q2TBI4|TRAP1_BOVIN0.000e+048.07Heat shock protein 75 kDa, mitochondrial OS=Bos ta... [more]
sp|Q86L04|TRAP1_DICDI1.911e-17143.17TNF receptor-associated protein 1 homolog, mitocho... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PPB70.000e+052.40Uncharacterized protein OS=Pomacea canaliculata OX... [more]
K1QDN10.000e+054.69Heat shock protein 75 kDa, mitochondrial (Fragment... [more]
G7Y4A30.000e+052.18TNF receptor-associated protein 1 OS=Clonorchis si... [more]
A0A3R7FDC40.000e+053.43Heat shock protein 75 kDa OS=Clonorchis sinensis O... [more]
A0A074ZNT90.000e+051.08Hsp90 protein OS=Opisthorchis viverrini OX=6198 GN... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trap10.000e+049.77TNF receptor associated protein 1 [Source:NCBI gen... [more]
hsp90b13.509e-9331.17heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90aa1.21.283e-4828.09Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90aa1.21.425e-4828.09Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90aa1.21.563e-4826.70Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hsp90b17.416e-6027.55heat shock protein 90, beta (grp94), member 1 [Sou... [more]
ENSPMAT00000003399.12.355e-4927.85pep scaffold:Pmarinus_7.0:GL479675:6143:15195:1 ge... [more]
hsp90ab17.163e-1740.00heat shock protein 90, alpha (cytosolic), class A ... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HSP821.352e-5128.81Hsp90 chaperone; redundant in function with Hsc82p... [more]
HSC821.742e-5128.81Cytoplasmic chaperone of the Hsp90 family; plays a... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO456660.000e+045.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HSP906.713e-5029.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453441.702e-4444.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trap10.000e+051.64TNF receptor associated protein 1 [Source:NCBI gen... [more]
hsp90b16.720e-9531.56heat shock protein 90 beta family member 1 [Source... [more]
hsp90ab18.184e-5127.91heat shock protein 90 alpha family class B member ... [more]
hsp90ab16.208e-4827.67heat shock protein 90 alpha family class B member ... [more]
hsp90aa1.22.869e-4727.12heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
back to top
BLAST of Heat shock protein 75 kDa, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016949.10.000e+0100.00SMESG000016949.1[more]
SMESG000025598.13.635e-9129.48SMESG000025598.1[more]
SMESG000041107.12.822e-9031.25SMESG000041107.1[more]
SMESG000054819.11.486e-8830.97SMESG000054819.1[more]
SMESG000068132.14.548e-8829.97SMESG000068132.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025467 ID=SMED30025467|Name=Heat shock protein 75 kDa, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=2124bp
CGTTTTATATAAAATTGAATGATGTTCAGAATTATACAAAGATCACTTAT
TAACAGATCTGTAATAAAATTTGGATTGGCTAACGCAATAAAACCTAGAG
TTCTCACTGTTTGTTCGAAGACATTTTCATCAGAAGCTGCAGTAAATTCT
GAAGACATACATTGTATTATAAAGGACAGTGAAAAAATAATAGGAAATTT
AGAAGCTCAAGAATTTAAAGCTGAAACAAGAAAATTACTTGACATTGTAG
CAAAATCTCTTTATTCAGACAAAGAAGTATTTATTCGAGAGTTAGTTTCA
AACGCTAGCGATGCTCTGGAAAAATTGCGTTATTTACGAACGACAGGATT
ACAACTTGGTGATGAAAATTTAAAACCATTTGAAATTCACATCAAGACAG
ATGAAAGCAAAAATCTTTTTATAATCCAGGATACAGGAATTGGAATGACT
AAGGAGGAAATGATAAAAAATCTAGGTACAATTGCTCGTTCTGGAAGCTC
TGAATTTCTTGATAAAGTAAAAAATGAAGATGCGAAATTAGATTCGATAA
TAGGAAAGTTTGGTGTTGGTTTTTACTCCAGTTTTATGGTTGCCGATAAA
GTCGAAGTTTTTTCTCGATCTCATAGGTCAAATGATGGATTTTATTGGCA
ATCTAGTGGCACAAGTGGTTCGTATGAAATTAGCGAGGCTGATGAAGTTG
AGCATGGAACAAAGATTATTTTGCATTTAAAATCCGACTGTAAAGAATTT
TCCGATGAACGAAACATTGAAAAAATTATAAATAAATATAGTAATTATGT
CGGTAGCTCTATTTACCTTAATGGGAAAAAAATATCAATGATGCAGCCAT
TATGGTTGAAAAGTCCAAATAATGTTACTGAAATGGAACACGTGGAATTT
TATAAATATATTACTGGAAATACCTATGATAGTCCAAGATATGTTATAAA
TTTCAGGATTGATGTTCCACTCGATATAAAATCGTTATTCTACATTCCTT
CAAGAAAACCGACGCTTTATGAAATCAGCCGGGAAAGTGACGCGGGAGTT
TCTCTCTACAGCCGGAAAGTCATGATAATGAGTCGGACCCAGAAATTGTT
ACCGAATTGGTTGCGGTTTCTCAAAGGTGTCGTTGAGAGTGACGACATTC
CATTGAATTTGAGCCGGGAGCTGTTGCAAGACAGCGCATTGATCAGCAAA
ATAAATCGAGTTTTGACTGGCAGGGTTATCAAGTATTTGCACGATCAGGC
GAAACGCGACGCTGAGAAATACATTCAATTCCACAATGATTTTGGGCTCT
ATCTTAAGGAGGGAATTGTCAACAGCACTGATCAGTCGGAGAAGGAAAAC
ATCTGCAAATTGTTGAGATTTGAATCCAGCAAATTGCCGGCAGGGAAACA
TACCAGCTTCCAAGAATATTCCGAACGAATGAAGGCAGGGTCACGGAAAA
TATTTTTTTTCTCCGCTCCAACCCGAGAAATAGCCGAGCATAGTCCGTAT
TTGGAAGCGATTAAGGAAAAGGATATTGAGGTGCTGTATCTATTGGAGCC
TTACGATGAGATGGTAATGATGCAATTGGGCTCGTTCGAGGGCAAGGATT
TGTGTTCGATAGAAACGGAACACAGTGAAGATGCATCGAATGTCAACATA
ATCGATTGCACAAATGAGCAATCGATAACACAGGAACAAGCAGAAGAATT
AACCGGGTGGATTGAGAAGCAGATGAAACCAAAAGTTGCCAATGTGAAAA
TCACTCAGCGATTGACAACTCACCCGTGTTTGATGTCGGTGAAGAATATG
GGCGCAGTTAGGCATTTCATTAAGACATCATTGATCGATAAAACGGAGGA
AGAAAAGTTTATGTTGATGAGTGCAACAATGGAATTGAATCCGACTCATT
CATTGGTAAAGAAATTGGTGGAATTACATAAGACCGATGAGGAACTTGCA
AAAATGCTCATTAATCAACTTCATCAAAACGCGCTCGTTCAAGCCGGGCT
CGTTACGGATTCTCGGGCGTCGATTGGGAATTTGAATGAGCTCCTTACTA
AAGCTTTCGAAAAGATTTAAGAACTAATAATAAATGCATTGTTTTCTTTT
TTCTTTAATTATAATAGATATATT
back to top

protein sequence of SMED30025467-orf-1

>SMED30025467-orf-1 ID=SMED30025467-orf-1|Name=SMED30025467-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=684bp
MMFRIIQRSLINRSVIKFGLANAIKPRVLTVCSKTFSSEAAVNSEDIHCI
IKDSEKIIGNLEAQEFKAETRKLLDIVAKSLYSDKEVFIRELVSNASDAL
EKLRYLRTTGLQLGDENLKPFEIHIKTDESKNLFIIQDTGIGMTKEEMIK
NLGTIARSGSSEFLDKVKNEDAKLDSIIGKFGVGFYSSFMVADKVEVFSR
SHRSNDGFYWQSSGTSGSYEISEADEVEHGTKIILHLKSDCKEFSDERNI
EKIINKYSNYVGSSIYLNGKKISMMQPLWLKSPNNVTEMEHVEFYKYITG
NTYDSPRYVINFRIDVPLDIKSLFYIPSRKPTLYEISRESDAGVSLYSRK
VMIMSRTQKLLPNWLRFLKGVVESDDIPLNLSRELLQDSALISKINRVLT
GRVIKYLHDQAKRDAEKYIQFHNDFGLYLKEGIVNSTDQSEKENICKLLR
FESSKLPAGKHTSFQEYSERMKAGSRKIFFFSAPTREIAEHSPYLEAIKE
KDIEVLYLLEPYDEMVMMQLGSFEGKDLCSIETEHSEDASNVNIIDCTNE
QSITQEQAEELTGWIEKQMKPKVANVKITQRLTTHPCLMSVKNMGAVRHF
IKTSLIDKTEEEKFMLMSATMELNPTHSLVKKLVELHKTDEELAKMLINQ
LHQNALVQAGLVTDSRASIGNLNELLTKAFEKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036890HATPase_C_sf
IPR037196HSP90_C
IPR020575Hsp90_N
IPR001404Hsp90_fam
IPR003594HATPase_C
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
Vocabulary: biological process
TermDefinition
GO:0006950response to stress
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020575Heat shock protein Hsp90, N-terminalPRINTSPR00775HEATSHOCK90coord: 177..199
score: 66.42
coord: 246..264
score: 30.93
coord: 82..104
score: 70.1
coord: 132..149
score: 49.06
coord: 150..167
score: 55.9
coord: 61..81
score: 34.29
coord: 228..245
score: 46.84
NoneNo IPR availablePFAMPF13589HATPase_c_3coord: 85..205
e-value: 1.9E-10
score: 40.7
NoneNo IPR availableGENE3DG3DSA:3.30.230.80coord: 276..448
e-value: 8.0E-60
score: 203.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.11260coord: 449..542
e-value: 9.3E-31
score: 107.7
NoneNo IPR availablePANTHERPTHR11528:SF44HEAT SHOCK PROTEIN 75 KDA, MITOCHONDRIALcoord: 31..680
NoneNo IPR availableCDDcd16927HATPase_Hsp90-likecoord: 70..260
e-value: 2.18246E-90
score: 277.48
IPR036890Histidine kinase/HSP90-like ATPase superfamilyGENE3DG3DSA:3.30.565.10coord: 49..275
e-value: 3.0E-72
score: 244.7
IPR036890Histidine kinase/HSP90-like ATPase superfamilySUPERFAMILYSSF55874ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinasecoord: 61..271
IPR001404Heat shock protein Hsp90 familyPFAMPF00183HSP90coord: 270..677
e-value: 4.0E-96
score: 323.0
IPR001404Heat shock protein Hsp90 familyPIRSFPIRSF002583HSP90_HTPGcoord: 31..682
e-value: 4.3E-203
score: 674.4
IPR001404Heat shock protein Hsp90 familyPANTHERPTHR11528HEAT SHOCK PROTEIN 90 FAMILY MEMBERcoord: 31..680
IPR037196HSP90, C-terminal domainGENE3DG3DSA:1.20.120.790coord: 545..682
e-value: 3.5E-40
score: 139.1
IPR037196HSP90, C-terminal domainSUPERFAMILYSSF110942HSP90 C-terminal domaincoord: 559..676
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 274..532