SMED30025466

Overview
NameSMED30025466
Smed IDSMED30025466
Length (bp)1025
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025466 (SMED30025466) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025466 (SMED30025466) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025466 (SMED30025466) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025466 (SMED30025466) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025466

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025466h1SMcG0002445 SmedASXL_001318SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025466 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002407:36668..37692 +5089
Homology
BLAST of SMED30025466 vs. Ensembl Human
Match: MTX2 (metaxin 2 [Source:HGNC Symbol;Acc:HGNC:7506])

HSP 1 Score: 48.9062 bits (115), Expect = 4.629e-6
Identity = 40/168 (23.81%), Postives = 74/168 (44.05%), Query Frame = 1
Query:  247 NVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWMSEGVRQ--TKSNFIKRYTWPLNRILWLIKERAVKNFM-TLSYFKESKQDLVKEFEVLCTHLNNNI-EDTFLFNKSTPHELDLLVYGFI 738
            N E++S  G  P   + +++ S +      ++   +  S   + +Q   +   ++  N ++L            LY QW  E      T + +   Y WPLN IL   K+  VK  M  + + K++   ++++ +  C  L+  +    + FNK  P ELD LV+G +
Sbjct:   62 NAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNNMLL---------TAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQ-PTELDALVFGHL 219          
BLAST of SMED30025466 vs. TrEMBL
Match: A0A068WC77 (Metaxin 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000759400 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 9.354e-17
Identity = 58/229 (25.33%), Postives = 105/229 (45.85%), Query Frame = 1
Query:  163 LPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWMSE-GVRQTKSNFIKRYTWPLNRILWLIKERAVKNFMTLS-YFKESKQDLVKEFEVLCTHLNNNIED-TFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLLLRINVIN 840
            LP ++A      ++FL K I F+   + +    S DG+ PL +I   L SG  +    ++ +N +   N+  +  K L  +   H   I F ++     N+ LY  W+   G R T+  F   Y WPL       +++ +  F+T + +  +   D++K F+  C H++  I D  F+FN+    ++D L+  +         YF     IISK+P + +L   +  ++
Sbjct:   15 LPNDEATTAACLTYFLLKSIPFKVRYLRDAYFASPDGLLPLSNICGNLVSGFMSMVFTLKTFNGK---NEVELDAKVLEMKNTHH---IFFFWVADTLRNLTLYLTWVEPNGERHTRDRFNSMYPWPLGDYYCNRQKKLILKFLTSADWASDGLGDVLKRFDTTCKHISCMITDGPFVFNRKKCGKVDCLIAAYFNTFSTNAKYFAPLTPIISKYPSLTKLATSVRSLH 237          
BLAST of SMED30025466 vs. TrEMBL
Match: A0A3P7LSM5 (Thioredoxin-like_fold domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9794 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.658e-16
Identity = 51/223 (22.87%), Postives = 118/223 (52.91%), Query Frame = 1
Query:  160 NLPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWM-SEGVRQTKSNFIKRYTWPLNRILWLIKERAVKNFM-TLSYFKESKQDLVKEFEVLCTHLNNNIE-DTFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLL 819
            +LP ++A      ++   K I F  ++++N   +S DG+ P+ +I  +L SG  +    I++     +  + N++ K  V + +  + +  F +L     NI LY  W+   G++ TK+   K + WP+  +++  ++ A + +M  + +      ++++EF+ +C+++   +  D F+F+++ P ++D L+  ++ + + Y   F   I ++SK+P + QL+
Sbjct:   17 SLPNDEATTNACKTYLKLKGISFLCQELSNAYTISPDGLLPVLNIHGRLVSGFMSMCLAIKE-----TKKNPNLELKPEVLQTKNCHHVFFF-WLSDALRNIALYFTWVNPSGIQHTKNKLQKAFPWPICNVMFNRQKLAYEKYMGAIGWLSREPGEIIEEFDRVCSNVTKVLTNDHFVFDRTKPGKIDCLLCSYLMMFEKYHVLFSPLISVLSKYPALRQLV 233          
BLAST of SMED30025466 vs. TrEMBL
Match: A0A0R3W2R9 (Thioredoxin-like_fold domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4151 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.694e-16
Identity = 55/225 (24.44%), Postives = 104/225 (46.22%), Query Frame = 1
Query:  163 LPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWM-SEGVRQTKSNFIKRYTWPLNRILWLIKERAVKNFMTLS-YFKESKQDLVKEFEVLCTHLNNNIED-TFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLLLRI 828
            LP ++A       + ++K I F    + N    S DG+ PL +I   L SG  +    ++ ++ ++   D  +  K L  +   H   I F ++   F N+ LY  W+   G R T+ +F   + WPL    +  +++ +  F+T + +  E   D++  F+  C H++  + D  F+FN+    ++D L+  +         YF     IISK+P + +L+  +
Sbjct:   15 LPNDEATTAACLKYLISKSIPFSIRYLKNAYFASPDGLLPLSNICGNLVSGFMSMVFTLKTFSRKS---DVELDSKVLETKNTRH---IFFFWIADVFRNVTLYLTWVEPNGQRHTRGHFNSTHPWPLGDYYFNRQKKLIMRFLTSANWASEDLGDVLNRFDATCKHVSCMLTDGPFVFNRKKAGKVDCLLAAYFNTFSANAKYFAVLAPIISKYPSLTRLVASV 233          
BLAST of SMED30025466 vs. TrEMBL
Match: A0A068Y9U9 (Metaxin 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000759400 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 6.152e-16
Identity = 56/229 (24.45%), Postives = 106/229 (46.29%), Query Frame = 1
Query:  163 LPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWMSE-GVRQTKSNFIKRYTWPLNRILWLIKERAVKNFMTLS-YFKESKQDLVKEFEVLCTHLNNNIED-TFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLLLRINVIN 840
            LP ++A      ++ L K I F+   + +    S DG+ PL +I   L SG  +    ++ +N +   N+  +  K L  +   H   I F ++     N+ LY  W+   G R T+ +F   Y WPL    +  +++ +  F+T + +  +   D++K F+  C H++  + D  F+FN+    ++D L+  +         YF     IISK+P + +L   +  ++
Sbjct:   15 LPNDEATTAACLTYLLLKSIPFKVRYLRDAYFASPDGLLPLSNIRGNLVSGFMSMVFTLKTFNGK---NEVELDAKVLEIKNTHH---IFFFWVADTLRNLTLYLTWVEPNGERHTRDHFNSMYPWPLGDYYFNRQKKLILKFLTSADWASDGLGDILKRFDTTCKHISCMLTDGPFVFNRKKGGKVDCLIAAYFNTFSTNAKYFAPLTPIISKYPSLTKLATSVRSLH 237          
BLAST of SMED30025466 vs. TrEMBL
Match: A0A0X3P3M4 (Metaxin-2 OS=Schistocephalus solidus OX=70667 GN=MTX2 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.095e-15
Identity = 51/231 (22.08%), Postives = 116/231 (50.22%), Query Frame = 1
Query:  136 IIYAERLQNLPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWM-SEGVRQTKSNFIKRYTWPLNRILWLIKERAVKNFM-TLSYFKESKQDLVKEFEVLCTHLNNNIE-DTFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLL 819
            ++ + R  +LP + A      ++   K I     ++ N   VS DG+ P+ +I  +L SG  +    I     + +  + N++ K+ + + +  + +  F +L     NI +Y  W+   G+++TK    K + WP+  I++  ++ A + +M  + +      ++V+EF+ +C+ ++  +  D F+F +  P ++D ++  +    + YP +F   +G++S +P + QL+
Sbjct:    9 LVMSPRAFSLPNDIATTEACRTYLKLKGISVSCRELPNAYAVSPDGLLPVLNIHGRLVSGFMSMCLAI-----KATKKNPNLELKSEILQAKNSHHVFFF-WLSDALRNIAIYFSWVNPSGLQRTKYILQKAFPWPVCNIIFNRQKLAYEKYMEAIGWLSRETGEIVEEFDRVCSKVSKVLTNDHFVFERKKPGKIDCILCSYFVTFEKYPIFFSPLLGVMSNYPALRQLV 233          
BLAST of SMED30025466 vs. Ensembl Nematostella
Match: EDO34336 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN8])

HSP 1 Score: 53.9138 bits (128), Expect = 1.853e-8
Identity = 52/217 (23.96%), Postives = 98/217 (45.16%), Query Frame = 1
Query:  190 TIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWMSEGVR-QTKSNFIKRYTWPLNRILWLIKERAV-KNFMTLSYFKESKQDLVKEFEVLCTHLNNNIEDTFLFNKSTPHELDLLVYGFI-TVLQHY-PNYFETYIGIISKFPKINQLLLRI 828
            ++ +F    Q+ +  + + N E +S  G  PL      L  G ++  S +   N++     Q+ + +   E   +   I L N  +S      LY  W   G + +T   +  ++  PLN IL   K+ A  ++   L++ ++ +  +V+EFE  C  L   +     F +  P E+D L +G I ++L  Y P+  +T + I+ K   +   ++RI
Sbjct:   31 SLIAFLKFCQLPYDLKCVKNAESMSPTGEVPLLRAGKDLVGGPQDIFSLV---NHKGLSVSQDFEARDKAEMKAY---ISLIN--RSILPT-ELYMLWCKPGWQIRTTHQYGSQFPVPLNYILSYRKQWAAHRSLHALNWQRKKEAGVVEEFEKACQALAEKLGTNQYFIQGRPTEVDALAFGHINSILSRYQPD--DTLVAIVHKHRNLEDFVMRI 236          
BLAST of SMED30025466 vs. Planmine SMEST
Match: SMESG000065449.1 (SMESG000065449.1)

HSP 1 Score: 515.383 bits (1326), Expect = 0.000e+0
Identity = 253/254 (99.61%), Postives = 254/254 (100.00%), Query Frame = 1
Query:  121 MSSKVIIYAERLQNLPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWMSEGVRQTKSNFIKRYTWPLNRILWLIKERAVKNFMTLSYFKESKQDLVKEFEVLCTHLNNNIEDTFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLLLRINVINSDILGFWKKHLFNL 882
            MSSKVIIYAERLQNLPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSM+DQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWMSEGVRQTKSNFIKRYTWPLNRILWLIKERAVKNFMTLSYFKESKQDLVKEFEVLCTHLNNNIEDTFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLLLRINVINSDILGFWKKHLFNL
Sbjct:    1 MSSKVIIYAERLQNLPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSNDGIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMSDQNIQGKTLVERIQFHNEIILFNYLKSFFENIYLYEQWMSEGVRQTKSNFIKRYTWPLNRILWLIKERAVKNFMTLSYFKESKQDLVKEFEVLCTHLNNNIEDTFLFNKSTPHELDLLVYGFITVLQHYPNYFETYIGIISKFPKINQLLLRINVINSDILGFWKKHLFNL 254          
The following BLAST results are available for this feature:
BLAST of SMED30025466 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MTX24.629e-623.81metaxin 2 [Source:HGNC Symbol;Acc:HGNC:7506][more]
back to top
BLAST of SMED30025466 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WC779.354e-1725.33Metaxin 2 OS=Echinococcus granulosus OX=6210 GN=Eg... [more]
A0A3P7LSM51.658e-1622.87Thioredoxin-like_fold domain-containing protein OS... [more]
A0A0R3W2R93.694e-1624.44Thioredoxin-like_fold domain-containing protein OS... [more]
A0A068Y9U96.152e-1624.45Metaxin 2 OS=Echinococcus multilocularis OX=6211 G... [more]
A0A0X3P3M41.095e-1522.08Metaxin-2 OS=Schistocephalus solidus OX=70667 GN=M... [more]
back to top
BLAST of SMED30025466 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343361.853e-823.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30025466 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025466 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065449.10.000e+099.61SMESG000065449.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025466 ID=SMED30025466|Name=SMED30025466|organism=Schmidtea mediterranea sexual|type=transcript|length=1025bp
CAATAATGAAAATTTAAATTAAGTGCAATATTAAAATTATTTAGTTTTTA
ATTACGATTTTTGATTACTTTATATTTATAATATTACATCATTCTAATAA
TATTTTTTGCACTGATCTAAATGTCTAGCAAAGTGATTATTTACGCTGAA
AGACTCCAAAATTTACCTTTGGAAAAAGCTCAAATATTTACCATCGCTTC
TTTTTTCCTGGCAAAGCAAATTAAATTTCAATTTGAACAAATTAATAACG
TTGAACATGTATCTAATGATGGAATATATCCTCTATTCAGTATAGATTCG
AAGTTGTATTCTGGAATTGAAAATGCTAAATCATGTATCGAGGATTATAA
TAATCGAACAAGTATGAATGACCAAAACATTCAAGGAAAAACATTAGTAG
AGCGAATTCAATTCCACAATGAAATAATTTTATTTAATTATTTAAAATCT
TTCTTTGAAAATATCTATCTTTATGAACAATGGATGTCAGAAGGTGTTCG
ACAAACAAAATCAAATTTTATCAAGCGTTATACATGGCCTTTAAATAGAA
TATTGTGGTTAATCAAAGAACGAGCTGTTAAAAATTTTATGACATTGAGC
TATTTTAAAGAATCTAAACAAGATTTAGTTAAAGAATTTGAAGTCCTTTG
TACTCATTTAAATAATAACATCGAGGATACATTTCTGTTCAACAAGTCTA
CTCCGCATGAATTGGATTTATTAGTTTATGGATTTATTACAGTATTGCAG
CACTATCCCAATTATTTTGAAACTTACATCGGTATTATCTCAAAATTTCC
GAAAATCAATCAATTACTTTTAAGAATTAACGTCATCAATAGTGATATTC
TAGGATTTTGGAAGAAGCATTTATTTAATTTATAGTTCAATAATTATACA
ATTAAGTTGACTTATTCTTTTTAATGTATTTTATCATACTTATAATTGAT
TTTTCTGGGTTGTCGATTGTGTGCTCGATTTGGGCAATTGATTTGTGGAT
TATCATACATTGTCTATAAACAAAG
back to top

protein sequence of SMED30025466-orf-1

>SMED30025466-orf-1 ID=SMED30025466-orf-1|Name=SMED30025466-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=255bp
MSSKVIIYAERLQNLPLEKAQIFTIASFFLAKQIKFQFEQINNVEHVSND
GIYPLFSIDSKLYSGIENAKSCIEDYNNRTSMNDQNIQGKTLVERIQFHN
EIILFNYLKSFFENIYLYEQWMSEGVRQTKSNFIKRYTWPLNRILWLIKE
RAVKNFMTLSYFKESKQDLVKEFEVLCTHLNNNIEDTFLFNKSTPHELDL
LVYGFITVLQHYPNYFETYIGIISKFPKINQLLLRINVINSDILGFWKKH
LFNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: cellular component
TermDefinition
GO:0005741mitochondrial outer membrane
Vocabulary: biological process
TermDefinition
GO:0006626protein targeting to mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12289:SF38METAXIN-2coord: 13..237
NoneNo IPR availablePANTHERPTHR12289METAXIN RELATEDcoord: 13..237