Cullin-associated NEDD8-dissociated protein 1

Overview
NameCullin-associated NEDD8-dissociated protein 1
Smed IDSMED30025459
Length (bp)3949
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cullin-associated NEDD8-dissociated protein 1 (SMED30025459) t-SNE clustered cells

Violin plots show distribution of expression levels for Cullin-associated NEDD8-dissociated protein 1 (SMED30025459) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cullin-associated NEDD8-dissociated protein 1 (SMED30025459) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cullin-associated NEDD8-dissociated protein 1 (SMED30025459) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025459

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30025459SMESG000042515.1 dd_Smed_v4_6507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30025459SMESG000042515.1 dd_Smed_v4_6507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025459SMESG000042515.1 dd_Smed_v4_6507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Human
Match: CAND1 (cullin associated and neddylation dissociated 1 [Source:HGNC Symbol;Acc:HGNC:30688])

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 433/1246 (34.75%), Postives = 720/1246 (57.78%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + C+LG+NL  S +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLG-SDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Human
Match: CAND2 (cullin associated and neddylation dissociated 2 (putative) [Source:HGNC Symbol;Acc:HGNC:30689])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 418/1283 (32.58%), Postives = 706/1283 (55.03%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTP--LSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINLNE-EIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLS---------------WKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVL----IPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDPLY-----------------SILQTQNTDFD--LKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKS--EFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQE---IFDIKVITTLLLTNIISDHRIDC---ISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQEIAA 3780
            +HIS+L+EKM + DKDFRFMA +DL+S+LQ DS++LD DSERK+ K +LRLLED+N EVQN  VKCL  LV K+KE  V  ++  L   M + + + +  I  IGLKT++++ P   + +G+ + + ++I   L   + Q +   + Q+EA DI+ +++ RLG+ L A+   S+      QL +PRL+VRKRA+   G L +    D F E    ++ +L   +        +++LIQC+G + +Q   R GAH+ ++ P++++  NL++ E+++  LQ FEA + KC  EMG ++  V  + L+ I HDPNY+YD DED +              + ++D + S               WKVRR++AKC+   I + PDL+ DF  +  PVLI RF EREE VK ++F  ++ LL+QT  Q     L   ++   +   L +    +P ++  L++Q K +    RQG F++L E    +P   A+ +  +++  + +L D++ ++ ++ DA+  L  L+ T P   F  H   LL  V+  + DSFY+               A+ +  +Q ++R   PL+                 ++ + + TD D  +KE++I+ M +L   LG+ L    +E  L + ++RL NE+ R+  ++A  L++ +   +++   +   + ++  FL KN R LR+ TL   ++   +    +  S V   +++ LP L+N+SD+ +AQ  +   +   T   +   S  E    ++S +L LL+SPLL    L +    ++ +       +   K+I+  LLT  + +  +D    + ++ + ++A C+A L  +A   ++           +   H S  +  + L+ + L E+G+      ++ +   ++    S  E +++AA+Y+LG++    L  F+P++L QI+  P  QY LLHSLRE + A   D    Y++       IW LL +     EEG R +VAECIGKL L++PS ++P+LR+ +A G       P  R+T++TA+K+ I  + HPID LL +++ EF+  L+DPDL V+RA L   N+ VHNKP ++R           D++L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ SLL++CL ++++  FL+ +E+GL+D+ +I++L + M++++A  CP   L + + LI  +R+   +K K  +V QE EK DE KR+A++ +  + T   + KS    +  + I + P L  +F + Q+ +A
Sbjct:    6 FHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDKNGEVQNLAVKCLGPLVVKVKEYQVETIVDTLCTNM-RSDKEQLRDIAGIGLKTVLSELPPAATGSGLATNVCRKITGQLTSAIAQQEDVAV-QLEALDILSDMLSRLGVPLGAFH-ASLLHCLLPQLSSPRLAVRKRAVGALGHLAAACSTDLFVELADHLLDRLPGPR-VPTSPTAIRTLIQCLGSVGRQAGHRLGAHLDRLVPLVEDFCNLDDDELRESCLQAFEAFLRKCPKEMGPHVPNVTSLCLQYIKHDPNYNYDSDEDEEQ-------------METEDSEFSEQESEDEYSDDDDMSWKVRRAAAKCIAALISSRPDLLPDFHCTLAPVLIRRFKEREENVKADVFTAYIVLLRQT--QPPKGWLEAMEEPTQTGSNLHMLRGQVPLVVKALQRQLKDRSVRARQGCFSLLTELAGVLPGSLAEHMPVLVSGIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYK-------------IAAEALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGHLVGHLGDRLG-DDLEPTLLLLLDRLRNEITRLPAIKALTLVAVSPLQLDLQPILAEALHILASFLRKNQRALRLATLAALDALAQSQGLSLPPSAVQ-AVLAELPALVNESDMHVAQLAV---DFLATVTQAQPASLVEVSGPVLSELLRLLRSPLLPAGVLAAAEGFLQALVGTRPPCVDYAKLIS--LLTAPVYEQAVDGGPGLHKQVFHSLARCVAAL--SAACPQEAASTASRLVCDARSPHSS--TGVKVLAFLSLAEVGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAE------DIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGR------PHTRSTVITAVKFLISDQPHPIDPLLKSFIGEFMESLQDPDLNVRRATLAFFNSAVHNKPSLVR--------DLLDDILPLLYQETKIRRDLIREVEMGPFKHTVDDGLDVRKAAFECMYSLLESCLGQLDICEFLNHVEDGLKDHYDIRMLTFIMVARLATLCPAPVLQRVDRLIEPLRATCTAKVKAGSVKQEFEKQDELKRSAMRAVAALLTIPEVGKSPIMADFSSQIRSNPELAALFESIQKDSA 1225          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Human
Match: CAND2 (cullin associated and neddylation dissociated 2 (putative) [Source:HGNC Symbol;Acc:HGNC:30689])

HSP 1 Score: 457.603 bits (1176), Expect = 4.615e-140
Identity = 336/1122 (29.95%), Postives = 582/1122 (51.87%), Query Frame = 1
Query:  562 LGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINLNE-EIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLS---------------WKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVL----IPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDPLY-----------------SILQTQNTDFD--LKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKS--EFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQE---IFDIKVITTLLLTNIISDHRIDC---ISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQEIAA 3780
            LG+ L A+   S+      QL +PRL+VRKRA+   G L +    D F E    ++ +L   +        +++LIQC+G + +Q   R GAH+ ++ P++++  NL++ E+++  LQ FEA + KC  EMG ++  V  + L+ I HDPNY+YD DED +              + ++D + S               WKVRR++AKC+   I + PDL+ DF  +  PVLI RF EREE VK ++F  ++ LL+QT  Q     L   ++   +   L +    +P ++  L++Q K +    RQG F++L E    +P   A+ +  +++  + +L D++ ++ ++ DA+  L  L+ T P   F  H   LL  V+  + DSFY+               A+ +  +Q ++R   PL+                 ++ + + TD D  +KE++I+ M +L   LG+ L    +E  L + ++RL NE+ R+  ++A  L++ +   +++   +   + ++  FL KN R LR+ TL   ++   +    +  S V   +++ LP L+N+SD+ +AQ  +   +   T   +   S  E    ++S +L LL+SPLL    L +    ++ +       +   K+I+  LLT  + +  +D    + ++ + ++A C+A L  +A   ++           +   H S  +  + L+ + L E+G+      ++ +   ++    S  E +++AA+Y+LG++    L  F+P++L QI+  P  QY LLHSLRE + A   D    Y++       IW LL +     EEG R +VAECIGKL L++PS ++P+LR+ +A G       P  R+T++TA+K+ I  + HPID LL +++                         VHNKP ++R           D++L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ SLL++CL ++++  FL+ +E+GL+D+ +I++L + M++++A  CP   L + + LI  +R+   +K K  +V QE EK DE KR+A++ +  + T   + KS    +  + I + P L  +F + Q+ +A
Sbjct:   72 LGVPLGAFH-ASLLHCLLPQLSSPRLAVRKRAVGALGHLAAACSTDLFVELADHLLDRLPGPR-VPTSPTAIRTLIQCLGSVGRQAGHRLGAHLDRLVPLVEDFCNLDDDELRESCLQAFEAFLRKCPKEMGPHVPNVTSLCLQYIKHDPNYNYDSDEDEEQ-------------METEDSEFSEQESEDEYSDDDDMSWKVRRAAAKCIAALISSRPDLLPDFHCTLAPVLIRRFKEREENVKADVFTAYIVLLRQT--QPPKGWLEAMEEPTQTGSNLHMLRGQVPLVVKALQRQLKDRSVRARQGCFSLLTELAGVLPGSLAEHMPVLVSGIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYK-------------IAAEALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGHLVGHLGDRLG-DDLEPTLLLLLDRLRNEITRLPAIKALTLVAVSPLQLDLQPILAEALHILASFLRKNQRALRLATLAALDALAQSQGLSLPPSAVQ-AVLAELPALVNESDMHVAQLAV---DFLATVTQAQPASLVEVSGPVLSELLRLLRSPLLPAGVLAAAEGFLQALVGTRPPCVDYAKLIS--LLTAPVYEQAVDGGPGLHKQVFHSLARCVAAL--SAACPQEAASTASRLVCDARSPHSS--TGVKVLAFLSLAEVGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAE------DIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGR------PHTRSTVITAVKFLISDQPHPIDPLLKSFIA------------------------VHNKPSLVR--------DLLDDILPLLYQETKIRRDLIREVEMGPFKHTVDDGLDVRKAAFECMYSLLESCLGQLDICEFLNHVEDGLKDHYDIRMLTFIMVARLATLCPAPVLQRVDRLIEPLRATCTAKVKAGSVKQEFEKQDELKRSAMRAVAALLTIPEVGKSPIMADFSSQIRSNPELAALFESIQKDSA 1108          

HSP 2 Score: 93.5893 bits (231), Expect = 2.048e-18
Identity = 44/68 (64.71%), Postives = 56/68 (82.35%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLS 288
            +HIS+L+EKM + DKDFRFMA +DL+S+LQ DS++LD DSERK+ K +LRLLED+N EVQN  VK L 
Sbjct:    6 FHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDKNGEVQNLAVKWLG 73          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Human
Match: CAND1 (cullin associated and neddylation dissociated 1 [Source:HGNC Symbol;Acc:HGNC:30688])

HSP 1 Score: 376.326 bits (965), Expect = 1.136e-113
Identity = 215/618 (34.79%), Postives = 357/618 (57.77%), Query Frame = 1
Query: 1924 INVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            +  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:  166 LTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 757          

HSP 2 Score: 79.337 bits (194), Expect = 3.351e-14
Identity = 60/170 (35.29%), Postives = 98/170 (57.65%), Query Frame = 1
Query:  955 YIEKVVPMLLKLIVHDPNYHYXXXXX---XXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRL------RNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAIL 1437
            ++  ++ + LK + +DPNY+YD++++      A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT    R V+          Q   P   +   +P ++  L KQ K K    RQ  F +L
Sbjct:    1 HVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQT----RPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNML 166          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Human
Match: CAND1 (cullin associated and neddylation dissociated 1 [Source:HGNC Symbol;Acc:HGNC:30688])

HSP 1 Score: 179.489 bits (454), Expect = 6.170e-48
Identity = 127/389 (32.65%), Postives = 216/389 (55.53%), Query Frame = 1
Query:  520 QMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINLNE-EIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYR 1665
            Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+++ E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+
Sbjct:   33 QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYK 416          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Celegans
Match: cand-1 (Cullin-associated NEDD8-dissociated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5ED41])

HSP 1 Score: 461.07 bits (1185), Expect = 2.933e-140
Identity = 364/1304 (27.91%), Postives = 679/1304 (52.07%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVR--KIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITD-TPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQED--LKSLIQCIGVLTKQP-ARTGAHIHQIYPVLQNLINLN-------EEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTA----SQSRSVRLRNSQDIRP----------------SKQILVLIPQMLDK----LRKQNKSKICVIRQG------IFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMN------HIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGN---NLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTLL--LTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSI-DLSQRKYVI---DAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIV-ALAVDENLKYSDL-ASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRD-NSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTN-DNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF*FYNN 3810
            YH+  L++KM+N DKDFRFMA NDL+ DLQ  ++ L+ DS  K+ + +++LL D N EVQN  +KC+  L +  KIK  ++  ++ +LT  +     +    I ++ LK +I +  P + +   + ++K +    ++ +         +++  D++ EV++R G  +P     S+ +   H L++ R ++RK+AI   G L SV   + + E +  ++ +LA         ++  L++L+  +  + +   +R   H  ++ P L   + ++       +++++  +Q  E  + +   E+  + ++V+  L   + +DPNY Y +D++ +  E++++++++E     D   ++WKVRR++AK +E  I ++ + + +  +  GPV+I RF EREETV+ EI   ++ LL Q +       ++V   +   I                  S+  L +I  + D+    LR   KS     + G      + A+++    G+ +     I +V NI    L DK  +A  K   ++ +   ++ N    F +  + L  ++   +++ FY++S E L +    I   ++++        + +L + +  +      +TD +++E++I+ +  L  +  +   N TP+ +E+      ER+  ++  +   RA   + +A   I  S  + ++++ +  ++ K  R LR+  L   E    +          +  ++  +  LI+++DLQI  N    C  +   N     S   + ++  I+ LL SPL+ G  L SL+ L   I   +  +     +LL  +T+ + D+    +SR A+  IASC A +  + +++EK     ++  Q     + SD  S +  +++ LGE+GR + D     + +   D  +  FN  HE LKSAAA +LG +A+  L++++P+IL QI+  P  QY LLH+L+E+IV   + +E+ K +DL  S    IW +L+ N+   E+G R++VAEC+G+L   DP +++PKL+E +   D      P  R++ V+AIKY I  E   +D  L   + +FL  ++D DL V+R  L+ +N+  HNKP ++R+LL         +LL  +Y  T++R ELI+EVEMGPFKH  D+GLDLRKCAFEC+ +LL++C+D+I+++ F   +E GL D N ++KLL Y  L ++A   PG+ L + + +   +++ L  + + +AV QE EKL+E K+A I+ +  +      + ++  F++L N+I +   K++     ++  + QR   Y+ 
Sbjct:    4 YHVGQLVDKMSNPDKDFRFMACNDLMKDLQTGTIALEDDSTAKVIRALIKLLSDSNGEVQNLAIKCIGLLAQPSKIKTHHLEYLVEELTPHVFS-KAEQSRDIHSLTLKAMILNLAPSASSNATTTVVKRMLPKFVDSLSLCAPDDAARVDVLDLIGEVLLRFGDVVPEMHKGSLKVMVDH-LYSFRSAIRKKAITGIGHLASVINGELYDELVQDLLKELAQRSPPSSAAQNVQLRTLVIALSTVARASGSRFSKHTPKVVPFLLQYLQIDPGTESEHDDLREASIQGLEVFLYRNPQEVVAFEKEVIQQLTDALAYDPNYEYGDDDEDEQMEDDEDDDEDEYSDDED---VTWKVRRAAAKAIEAMISSHRESLLNLSQKIGPVVIGRFKEREETVRTEIISVYIALLNQISILVPDLQKAVVAADEDSIETDDIVVIGGTKFSTNYLSRSQLAIIQSLADQKDVLLRTITKSMKKHPKTGPKCIELLSALIRTYPSGLEDSLDDIIPAVSNI----LTDKNASAQGKMTVLSFISNALTLNNPKRFKNLLSPLTTIMTHSISEPFYKVSAEGLAVCCKYIDVLRELSACGGNEEAKKLLVVVEKKF---MANDTDQEVRERAISAISMLLAAFKDVLKNETPAILEK----MTERIGRDMTCLVAFRASTHIVEA-GIIFSSAQLQSILRHVVDYVKKIARSLRMTCLNFVEKLMKHSPAGSIPVEELTCVLGEMSNLISETDLQIT-NQAFCCLTYAFLNFPTCVSLHMQPILDSIIRLLTSPLIQGLALNSLLNLFTAIVKTDFPEKPTFESLLDSVTSPVYDNV--ALSRHAHMAIASCAAVITESTQNLEKSRSLAKKLAQQLQTANMSD--SIRLFAMITLGELGRRVPDTYSPDFPVKPEDLAIKAFNHHHEDLKSAAAQALGALAVGNLNVYLPFILEQIRTQPKKQYLLLHALKEVIVWESSSEESTKSTDLFRSAIVDIWGMLMANAGGNEDGTRSVVAECLGRLCSFDPESLLPKLKESMRSSD------PAIRSSAVSAIKYMINDEKRIVDITLQKQIGDFLAAVRDEDLKVRRVALVVLNSAAHNKPALVRDLL--------PDLLPAVYEETKLRKELIKEVEMGPFKHQVDEGLDLRKCAFECMFTLLESCVDKIDITQFSSVMEVGLSDQNHDVKLLNYLTLQRVANLAPGQVLQRIDRVCEPLKTQLNVRPRGNAVKQEVEKLEELKKAVIRVVYGLKLKLPEVERNPQFLDLYNTIKHT--KELEALANDVLKESQRAVVYDT 1269          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Fly
Match: Cand1 (gene:FBgn0027568 transcript:FBtr0080054)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 400/1265 (31.62%), Postives = 679/1265 (53.68%), Query Frame = 1
Query:   85 YH-ISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINLNE-EIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDE-----------DLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQD--IRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKM--NHIQT-------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEI--FDIKVITTLLLTNIISDH-------------RIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMF 3756
            YH I+ L+EKM + DKDFRFMA NDL+++LQ DS+ LD +SE+K+ + VL+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  N + +  I +IGLKT+I + P S N +   + + I   L   +++ D     ++E+ DI+ +++ R G  L  +   +I  A   QL + R +VRKR I     L+     + ++  I  ++  L    EN      +++ IQC+  + +Q   R   HI +   +L      ++ E+++  LQ  EA + +C   +  +I  ++ + L  I +DPNY+Y+ D+       +            DDE           D+SWKVRR++AKCLE  I T  +L+ DF +S  P LI RF EREE VK +IF  ++ LLK T          +S D    P+  ++  +P ++  ++   + K    RQ  F +L+E    +P      + S++     +LNDK+  +N+K +++  L  L+  +P   F  H   L+ +V+  + D FY+++ E+L +   L+   + +  N  ++       + ++Y      L+  + D ++KE++I  M  +  ++G+ L  +++  CL IF+ERL NE+ R++ ++A  L++ ++  I+++  +  ++  +  FL KN R L++ +L        NY    +++ +   I+ + PPLI+DSDL +AQ ++ L +  + R         +   +  +L L++SPLL GS L   + L + +   ++   D   + + L+  ++  +              +  + ++AY + A CIA L       ++C           +   +    +     ++ +GEIGR  DLS  + +   I+  F +  E +K+AA+++LG +++  L  ++P IL++I+  P  QY LLHSL+E+I +L+V  +   + L      IW+ L ++    EEG RN+VAEC+GKL L++P  ++P+L++ +             R  +V+++K+TI  +  PID LL   + EFL  L+DP+  V+R  L+A N+ VHNKP ++R+LL          LL WLY+ T+V+ ELIREVEMGPFKH  DDGLD+RK AFEC+ +LL+  LDR++V  FLD ++ GL D+ +IK+L Y M +++A  CP K L + +  I  +R     K K ++V QE EK DE KR+A++ +  +S     NK++  ++ + SI   P L K+F
Sbjct:    6 YHQIANLLEKMTSTDKDFRFMATNDLMTELQKDSIILDDESEKKVVRMVLKLLEDKNGEVQNLAVKCLGPLVNKVKEIQVETIVDSLCANMMS-NTEQLRDISSIGLKTVIAELPQSSNSLAPNVCQRITGKLSTAIEKEDVS--VKLESLDILADLLSRFGEFLVPFH-STILKALMPQLASSRQAVRKRTIVALSFLLIQANSNAYNGVIDHLLDGL----ENPPNPAAIRTYIQCLASICRQAGHRLCNHIDRSMLLLSQYSQRDDDELREFCLQACEAFVMRCPDAINPHIPMILELCLNYITYDPNYNYETDDGDTGNAMDT----------EDDEYVDSEEYSDDDDMSWKVRRAAAKCLEVLISTRQELVEDFYRSLSPALIARFKEREENVKSDIFHAYVALLKNTRLTDDVANDHDSMDQVSGPTSLLIEQLPLIVKAIQPLMREKSMKTRQDCFLLLRELLNSLPGALGPYLDSIVPGISYSLNDKSSTSNMKIESLGFLYSLLQGHPPHVFHPHIPLLVPLVVTSVFDPFYKIATEALLVLQQLVKVIRPLEPNAAKSDFDAPSFVGQVYSCTLQKLKVTDVDQEVKERAIACMGQIIANMGDMLQ-NELAVCLPIFMERLKNEVTRLSSVKALTLIAASSLRIDLTPILHDVLPALGTFLRKNHRALKLHSLDLINKIVINYSSNFEANLLQTAIVEI-PPLISDSDLHVAQYSLTLLST-VARRQPQALVGIHEQFLRSVLILVRSPLLQGSALNCTLELFQALVQTQLSGLDYHSLVSKLMAPVLGGNGDVKSRATAGAPSEVVQLHKQAYHSSAKCIAAL------TQQCPQVATPLATKLITDLQKRNDTEIIFCLLTIGEIGRHFDLSSIQVLPQTIIECFGATSEDVKAAASHALGAVSVGSLQTYLPLILHEIEVQPKRQYLLLHSLKEVISSLSVSPS-GLAQLLPSVPSIWDQLFKHCECSEEGSRNVVAECLGKLVLVNPDELLPQLQQALRSESATM------RTVVVSSVKFTISDQPQPIDVLLKQNIGEFLFALRDPEPQVRRVALVAFNSAVHNKPSLVRDLL--------PTLLPWLYSETKVKSELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLEQGLDRVDVMQFLDHVQAGLCDHYDIKMLTYLMTARLAILCPDKVLLRLDQFIQQLRDTCTHKVKANSVKQEYEKQDELKRSALRAVSALSQIPKANKNQQLVDFLKSIKETPELNKIF 1228          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Fly
Match: Cand1 (gene:FBgn0027568 transcript:FBtr0332198)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 400/1265 (31.62%), Postives = 679/1265 (53.68%), Query Frame = 1
Query:   85 YH-ISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINLNE-EIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDE-----------DLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQD--IRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKM--NHIQT-------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEI--FDIKVITTLLLTNIISDH-------------RIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMF 3756
            YH I+ L+EKM + DKDFRFMA NDL+++LQ DS+ LD +SE+K+ + VL+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  N + +  I +IGLKT+I + P S N +   + + I   L   +++ D     ++E+ DI+ +++ R G  L  +   +I  A   QL + R +VRKR I     L+     + ++  I  ++  L    EN      +++ IQC+  + +Q   R   HI +   +L      ++ E+++  LQ  EA + +C   +  +I  ++ + L  I +DPNY+Y+ D+       +            DDE           D+SWKVRR++AKCLE  I T  +L+ DF +S  P LI RF EREE VK +IF  ++ LLK T          +S D    P+  ++  +P ++  ++   + K    RQ  F +L+E    +P      + S++     +LNDK+  +N+K +++  L  L+  +P   F  H   L+ +V+  + D FY+++ E+L +   L+   + +  N  ++       + ++Y      L+  + D ++KE++I  M  +  ++G+ L  +++  CL IF+ERL NE+ R++ ++A  L++ ++  I+++  +  ++  +  FL KN R L++ +L        NY    +++ +   I+ + PPLI+DSDL +AQ ++ L +  + R         +   +  +L L++SPLL GS L   + L + +   ++   D   + + L+  ++  +              +  + ++AY + A CIA L       ++C           +   +    +     ++ +GEIGR  DLS  + +   I+  F +  E +K+AA+++LG +++  L  ++P IL++I+  P  QY LLHSL+E+I +L+V  +   + L      IW+ L ++    EEG RN+VAEC+GKL L++P  ++P+L++ +             R  +V+++K+TI  +  PID LL   + EFL  L+DP+  V+R  L+A N+ VHNKP ++R+LL          LL WLY+ T+V+ ELIREVEMGPFKH  DDGLD+RK AFEC+ +LL+  LDR++V  FLD ++ GL D+ +IK+L Y M +++A  CP K L + +  I  +R     K K ++V QE EK DE KR+A++ +  +S     NK++  ++ + SI   P L K+F
Sbjct:    6 YHQIANLLEKMTSTDKDFRFMATNDLMTELQKDSIILDDESEKKVVRMVLKLLEDKNGEVQNLAVKCLGPLVNKVKEIQVETIVDSLCANMMS-NTEQLRDISSIGLKTVIAELPQSSNSLAPNVCQRITGKLSTAIEKEDVS--VKLESLDILADLLSRFGEFLVPFH-STILKALMPQLASSRQAVRKRTIVALSFLLIQANSNAYNGVIDHLLDGL----ENPPNPAAIRTYIQCLASICRQAGHRLCNHIDRSMLLLSQYSQRDDDELREFCLQACEAFVMRCPDAINPHIPMILELCLNYITYDPNYNYETDDGDTGNAMDT----------EDDEYVDSEEYSDDDDMSWKVRRAAAKCLEVLISTRQELVEDFYRSLSPALIARFKEREENVKSDIFHAYVALLKNTRLTDDVANDHDSMDQVSGPTSLLIEQLPLIVKAIQPLMREKSMKTRQDCFLLLRELLNSLPGALGPYLDSIVPGISYSLNDKSSTSNMKIESLGFLYSLLQGHPPHVFHPHIPLLVPLVVTSVFDPFYKIATEALLVLQQLVKVIRPLEPNAAKSDFDAPSFVGQVYSCTLQKLKVTDVDQEVKERAIACMGQIIANMGDMLQ-NELAVCLPIFMERLKNEVTRLSSVKALTLIAASSLRIDLTPILHDVLPALGTFLRKNHRALKLHSLDLINKIVINYSSNFEANLLQTAIVEI-PPLISDSDLHVAQYSLTLLST-VARRQPQALVGIHEQFLRSVLILVRSPLLQGSALNCTLELFQALVQTQLSGLDYHSLVSKLMAPVLGGNGDVKSRATAGAPSEVVQLHKQAYHSSAKCIAAL------TQQCPQVATPLATKLITDLQKRNDTEIIFCLLTIGEIGRHFDLSSIQVLPQTIIECFGATSEDVKAAASHALGAVSVGSLQTYLPLILHEIEVQPKRQYLLLHSLKEVISSLSVSPS-GLAQLLPSVPSIWDQLFKHCECSEEGSRNVVAECLGKLVLVNPDELLPQLQQALRSESATM------RTVVVSSVKFTISDQPQPIDVLLKQNIGEFLFALRDPEPQVRRVALVAFNSAVHNKPSLVRDLL--------PTLLPWLYSETKVKSELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLEQGLDRVDVMQFLDHVQAGLCDHYDIKMLTYLMTARLAILCPDKVLLRLDQFIQQLRDTCTHKVKANSVKQEYEKQDELKRSALRAVSALSQIPKANKNQQLVDFLKSIKETPELNKIF 1228          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Zebrafish
Match: cand1 (cullin-associated and neddylation-dissociated 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2872])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 425/1255 (33.86%), Postives = 710/1255 (56.57%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTP--LSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLS-------------WKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQ 3768
            YHIS L+EKM + DKDFRFMA NDL+S+LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P   S + + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+     +      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  V+ + LK + +DPNY+YD++++ ++A + D            DED               WKVRR++AKCL+  + T  +++ +F ++  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +  ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   ++  V+  + D FY+++ E+L +T  L+   + ++          I  ++      L+  + D ++KE++I+ M  + C+LG++L  + +   L IF+ERL NE+ R+  ++A  L++ +   IN+   +   + ++  FL KN R L++ TL   +    NY   + +  ++  +++ LPPLIN+SD+ ++Q  I+     L R H D  S+    +++ ++ L++SPLL G  L +++   + + +     +  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  +DLS +  +   I++ F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V      + L  +   +W LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI      ID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML++++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +V + T     KS    E  + I + P L  +F + Q
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMSELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAASVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLCRQGGLLVNFH-PSILSCLLPQLTSPRLAVRKRTIIALGHLVMSCGNLVFVDLIEHLLSELS----RNESMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVPTVISICLKYLTYDPNYNYDDEDEDENAMDADGV----------DEDYQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYRTVSPALIARFKEREENVKADVFHAYLSLLKQTRPAQSWLCDPDAMEQGETPLTMLQSQVSMIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLIPGIIFSLNDKSSSSNLKIDALSCLYVILCNHQPQVFHPHVQAIVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQTDAFDASPYITDLFACTIKRLKAADIDQEVKERAISCMGQIICNLGDSLG-ADLPGTLHIFLERLKNEITRLTTVKALTLIAGSPLKINLRPILGEAVPILASFLRKNQRALKLSTLAALDILVKNYSDSV-TPAMIDAVLAELPPLINESDMHVSQMAISFLTT-LARVHPDSLSKISGSILAELIALVRSPLLQGGALSAMLEFFQALVATGTASLGYMDLLRMLTGPVYAQSAALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHVDLSSQPELKTVILDAFSSASEEVKSAASYALGSISVGNLPEYLPFVLQEISGQPKRQYLLLHSLKEIISSASV------AGLKPYVENVWALLLKHCECTEEGTRNVVAECLGKLTLIDPETLLPRLKGYLLSGSS------YARSSVVTAVKFTISDHPQTIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLARLSSLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVVALLTIPEAEKSPLMSEFQSQISSNPELAAIFDSIQ 1216          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Zebrafish
Match: cand2 (cullin-associated and neddylation-dissociated 2 (putative) [Source:ZFIN;Acc:ZDB-GENE-060503-645])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 429/1251 (34.29%), Postives = 714/1251 (57.07%), Query Frame = 1
Query:   76 NNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGV---ISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQIL-VLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXIT------KAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL--LLTNIISDHRIDCIS--REAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI-INGPLKKMFTTEQ 3768
            N  ++IS L+EKM + DKDFRFMA NDL+ +LQ DS++LD +SERK+   +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  N + +  I ++GLKT+I + P S  G+   +S+  ++I   LI  M   D   + Q+EA DI+ +++ RL   L ++  +SI  +   QL + R++VRKR+I   G L+    P  F++    +MG+L+          ++++ IQC+  +++Q   R G H+ +I P++    N+ ++E+++   Q FEA +S+CS EM  +I  ++ + LK I +DPNY+Y   D+++D    E+ ++E+   +  YSDD+D+SWKVRRSS KCLE  I +  DL+ +   S GP L+ RF EREE VK +IF  F+ LL+QT        L       P+  +L   +P ++  L +Q K K    RQG F++L E    +P    + I +++   + +L DK+ ++N+K DA++ L  L+S++    F  H + +L  V+  + D FY+++ E+L +T  ++       K    +    +  I+      L+  + D ++KE++I  M ++   LG++L  + ++  L+IF+ERL NE+ R+  ++   L++ +   I++   +   I ++  FL KN R L++ T+       TNY    K   ++  I+S +P LI ++D+ I+Q  I L         S + S+    ++  +LNL+ SPLL G  L S++   + + + +  ++     L  L          D +S  +++Y ++A C+A L  ++   ++  G +    Q   +K+       + LS++ LGEIGR ++   +K +   IM  F S  E +KSAA+++LG + +  L  ++P++L +I      QY LLHSL+E+I AL+ +       L  H   IW LL ++    EEG RNIVAEC+GKL L+ PS ++P+L++ ++ G       PL R+T+VTA+K+TI+    PIDSLL   + +FL  L+DPDL V+R  L+ +N+  HNKP +IR LL         +LL  LY  T++R +L+REVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLD +++  FL+ +EEGL+D+ +IK+L + ML++++K CP   + +   L+  +++   +K K  +V QE EK +E +R+A++ +  + +   + KS    +  N I  N  +  +F + Q
Sbjct:    3 NVTFYISNLLEKMTSTDKDFRFMAANDLMMELQKDSIKLDEESERKVVTMLLKLLEDKNGEVQNLAVKCLGPLVGKVKECQVETMVETLCSNMMS-NKEQLRDISSMGLKTVIAELPPSSTGLSLTVSV-CRKITSQLIGAMGMQDDVSI-QLEALDILSDMLSRLSTALVSFH-QSILTSLLAQLMSSRMAVRKRSIIALGHLVPSCSPALFTQLTEHLMGELS----RGPPTANVRTYIQCLATISRQGGHRIGEHLEKIVPMVVKFCNVEDDELREFCFQAFEAFVSRCSKEMSPHIPTIIKLCLKYISYDPNYNYDADDDEDDSMDIEDREDEDQESDDEYSDDDDMSWKVRRSSVKCLEAIISSRRDLLVELYGSVGPTLVSRFKEREENVKTDIFSAFVALLRQT-RHPHGPTLDTESKEEPAVTLLKKQVPTIVKALHRQLKEKSMRCRQGCFSLLTEMANVLPGELGEHIPALIPGIIYSLTDKSSSSNMKIDALSFLNVLLSSHNPEVFHPHISVILTPVIQCVEDPFYKITSEALQVTQQIVKLIRPLEKPVSFDAKPYVKNIFACTSKRLKAADIDQEVKERAIFCMGHILSHLGDHLG-ADLQPTLQIFLERLKNEITRLIAVKTLTLVASSQLKIDLRPILTEGIPVLGSFLRKNQRVLKLNTITVLNVIVTNYSDSFKPP-LIESILSEVPALIQENDMHISQVAINLITCMAKVCPSSL-SKIGGTILPEVLNLVHSPLLQGGALNSILQFFQVLVATKANNMGYSDLLKALRGPFYDSKSADSMSVHKQSYYSVAKCVAAL--SSVCPKEASGLVSNLIQD--VKNPKSSEPVRILSLLCLGEIGRFMNFEGQKELKGVIMEAFGSPSEEVKSAASFALGNICVGNLGEYLPFMLKEIGSQQKRQYLLLHSLKEMISALSAE------SLKPHVENIWALLFKHCECAEEGTRNIVAECLGKLTLVSPSELLPRLKKQLSSGS------PLSRSTVVTAVKFTIVDHPMPIDSLLKGCIGDFLKTLQDPDLNVRRVALVMLNSAAHNKPSLIRGLLT--------SLLPHLYNETQIRKDLVREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLDCLDIFEFLNHVEEGLKDHYDIKMLTFIMLARLSKLCPTAVVQRLERLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLSISEVEKSPAMADFANQIRSNAEMATIFESLQ 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Zebrafish
Match: cand2 (cullin-associated and neddylation-dissociated 2 (putative) [Source:ZFIN;Acc:ZDB-GENE-060503-645])

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 422/1248 (33.81%), Postives = 700/1248 (56.09%), Query Frame = 1
Query:   76 NNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQIL-VLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXIT------KAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL--LLTNIISDHRIDCIS--REAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI-INGPLKKMFTTEQ 3768
            N  ++IS L+EKM + DKDFRFMA NDL+ +LQ DS++LD +SERK+   +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  N + +  I ++GLKT+I + P S  G+  I              +  G    +      +C   VRL   L ++  +SI  +   QL + R++VRKR+I   G L+    P  F++    +MG+L+          ++++ IQC+  +++Q   R G H+ +I P++    N+ ++E+++   Q FEA +S+CS EM  +I  ++ + LK I +DPNY+Y   D+++D    E+ ++E+   +  YSDD+D+SWKVRRSS KCLE  I +  DL+ +   S GP L+ RF EREE VK +IF  F+ LL+QT        L       P+  +L   +P ++  L +Q K K    RQG F++L E    +P    + I +++   + +L DK+ ++N+K DA++ L  L+S++    F  H + +L  V+  + D FY+++ E+L +T  ++       K    +    +  I+      L+  + D ++KE++I  M ++   LG++L  + ++  L+IF+ERL NE+ R+  ++   L++ +   I++   +   I ++  FL KN R L++ T+       TNY    K   ++  I+S +P LI ++D+ I+Q  I L         S + S+    ++  +LNL+ SPLL G  L S++   + + + +  ++     L  L          D +S  +++Y ++A C+A L  ++   ++  G +    Q   +K+       + LS++ LGEIGR ++   +K +   IM  F S  E +KSAA+++LG + +  L  ++P++L +I      QY LLHSL+E+I AL+ +       L  H   IW LL ++    EEG RNIVAEC+GKL L+ PS ++P+L++ ++ G       PL R+T+VTA+K+TI+    PIDSLL   + +FL  L+DPDL V+R  L+ +N+  HNKP +IR LL         +LL  LY  T++R +L+REVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLD +++  FL+ +EEGL+D+ +IK+L + ML++++K CP   + +   L+  +++   +K K  +V QE EK +E +R+A++ +  + +   + KS    +  N I  N  +  +F + Q
Sbjct:    3 NVTFYISNLLEKMTSTDKDFRFMAANDLMMELQKDSIKLDEESERKVVTMLLKLLEDKNGEVQNLAVKCLGPLVGKVKECQVETMVETLCSNMMS-NKEQLRDISSMGLKTVIAELPPSSTGITFIFSYSC------CWSKCLGLAREKFIYVSSLC-FFVRLSTALVSFH-QSILTSLLAQLMSSRMAVRKRSIIALGHLVPSCSPALFTQLTEHLMGELS----RGPPTANVRTYIQCLATISRQGGHRIGEHLEKIVPMVVKFCNVEDDELREFCFQAFEAFVSRCSKEMSPHIPTIIKLCLKYISYDPNYNYDADDDEDDSMDIEDREDEDQESDDEYSDDDDMSWKVRRSSVKCLEAIISSRRDLLVELYGSVGPTLVSRFKEREENVKTDIFSAFVALLRQT-RHPHGPTLDTESKEEPAVTLLKKQVPTIVKALHRQLKEKSMRCRQGCFSLLTEMANVLPGELGEHIPALIPGIIYSLTDKSSSSNMKIDALSFLNVLLSSHNPEVFHPHISVILTPVIQCVEDPFYKITSEALQVTQQIVKLIRPLEKPVSFDAKPYVKNIFACTSKRLKAADIDQEVKERAIFCMGHILSHLGDHLG-ADLQPTLQIFLERLKNEITRLIAVKTLTLVASSQLKIDLRPILTEGIPVLGSFLRKNQRVLKLNTITVLNVIVTNYSDSFKPP-LIESILSEVPALIQENDMHISQVAINLITCMAKVCPSSL-SKIGGTILPEVLNLVHSPLLQGGALNSILQFFQVLVATKANNMGYSDLLKALRGPFYDSKSADSMSVHKQSYYSVAKCVAAL--SSVCPKEASGLVSNLIQD--VKNPKSSEPVRILSLLCLGEIGRFMNFEGQKELKGVIMEAFGSPSEEVKSAASFALGNICVGNLGEYLPFMLKEIGSQQKRQYLLLHSLKEMISALSAE------SLKPHVENIWALLFKHCECAEEGTRNIVAECLGKLTLVSPSELLPRLKKQLSSGS------PLSRSTVVTAVKFTIVDHPMPIDSLLKGCIGDFLKTLQDPDLNVRRVALVMLNSAAHNKPSLIRGLLT--------SLLPHLYNETQIRKDLVREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLDCLDIFEFLNHVEEGLKDHYDIKMLTFIMLARLSKLCPTAVVQRLERLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLSISEVEKSPAMADFANQIRSNAEMATIFESLQ 1209          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Zebrafish
Match: cand2 (cullin-associated and neddylation-dissociated 2 (putative) [Source:ZFIN;Acc:ZDB-GENE-060503-645])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 421/1250 (33.68%), Postives = 690/1250 (55.20%), Query Frame = 1
Query:   76 NNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQIL-VLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXIT------KAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL--LLTNIISDHRIDCIS--REAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYP--MLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI-INGPLKKMFTTEQ 3768
            N  ++IS L+EKM + DKDFRFMA NDL+ +LQ DS++LD +SERK+   +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  N + +  I ++GLKT+I + P S  G+  I              +  G    +      +C   VRL   L ++  +SI  +   QL + R++VRKR+I   G L+    P  F++    +MG+L+          ++++ IQC+  +++Q   R G H+ +I P++    N+ ++E+++   Q FEA +S+CS EM  +I  ++ + LK I +DPNY+Y   D+++D    E+ ++E+   +  YSDD+D+SWKVRRSS KCLE  I +  DL+ +   S GP L+ RF EREE VK +IF  F+ LL+QT        L       P+  +L   +P ++  L +Q K K    RQG F++L E    +P    + I +++   + +L DK+ ++N+K DA++ L  L+S++    F  H + +L  V+  + D FY+++ E+L +T  ++       K    +    +  I+      L+  + D ++KE++I  M ++   LG++L  + ++  L+IF+ERL NE+ R+  ++   L++ +   I++   +   I ++  FL KN R L++ T+       TNY    K   ++  I+S +P LI ++D+ I+Q  I L         S + S+    ++  +LNL+ SPLL G  L S++   + + + +  ++     L  L          D +S  +++Y ++A C+A L  ++   ++  G +    Q   +K+       + LS++ LGEIGR ++   +K +   IM  F S  E +KSAA+++LG + +  L  ++P++L +I      QY LLHSL+E+I AL+ +       L  H   IW LL ++    EEG RNIVAEC+GKL L+ PS ++P+L++ ++ G       PL R+T+VTA+K+TI+    PIDSLL   + +FL  L+DPDL V+R  L+ +N+  HNKP +IR LL         +LL  LY  T++R +L+REVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLD +++  FL+ +EEGL+D+ +IK   +    LS ++K  P      F N          +K K  +V QE EK +E +R+A++ +  + +   + KS    +  N I  N  +  +F + Q
Sbjct:    3 NVTFYISNLLEKMTSTDKDFRFMAANDLMMELQKDSIKLDEESERKVVTMLLKLLEDKNGEVQNLAVKCLGPLVGKVKECQVETMVETLCSNMMS-NKEQLRDISSMGLKTVIAELPPSSTGITFIFSYSC------CWSKCLGLAREKFIYVSSLC-FFVRLSTALVSFH-QSILTSLLAQLMSSRMAVRKRSIIALGHLVPSCSPALFTQLTEHLMGELS----RGPPTANVRTYIQCLATISRQGGHRIGEHLEKIVPMVVKFCNVEDDELREFCFQAFEAFVSRCSKEMSPHIPTIIKLCLKYISYDPNYNYDADDDEDDSMDIEDREDEDQESDDEYSDDDDMSWKVRRSSVKCLEAIISSRRDLLVELYGSVGPTLVSRFKEREENVKTDIFSAFVALLRQT-RHPHGPTLDTESKEEPAVTLLKKQVPTIVKALHRQLKEKSMRCRQGCFSLLTEMANVLPGELGEHIPALIPGIIYSLTDKSSSSNMKIDALSFLNVLLSSHNPEVFHPHISVILTPVIQCVEDPFYKITSEALQVTQQIVKLIRPLEKPVSFDAKPYVKNIFACTSKRLKAADIDQEVKERAIFCMGHILSHLGDHLG-ADLQPTLQIFLERLKNEITRLIAVKTLTLVASSQLKIDLRPILTEGIPVLGSFLRKNQRVLKLNTITVLNVIVTNYSDSFKPP-LIESILSEVPALIQENDMHISQVAINLITCMAKVCPSSL-SKIGGTILPEVLNLVHSPLLQGGALNSILQFFQVLVATKANNMGYSDLLKALRGPFYDSKSADSMSVHKQSYYSVAKCVAAL--SSVCPKEASGLVSNLIQD--VKNPKSSEPVRILSLLCLGEIGRFMNFEGQKELKGVIMEAFGSPSEEVKSAASFALGNICVGNLGEYLPFMLKEIGSQQKRQYLLLHSLKEMISALSAE------SLKPHVENIWALLFKHCECAEEGTRNIVAECLGKLTLVSPSELLPRLKKQLSSGS------PLSRSTVVTAVKFTIVDHPMPIDSLLKGCIGDFLKTLQDPDLNVRRVALVMLNSAAHNKPSLIRGLLT--------SLLPHLYNETQIRKDLVREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLDCLDIFEFLNHVEEGLKDHYDIKFCIFKDVTLSFLSKQQP-----TFCN----------TKVKAGSVKQEFEKQEELRRSAMRAVAALLSISEVEKSPAMADFANQIRSNAEMATIFESLQ 1196          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Zebrafish
Match: cand2 (cullin-associated and neddylation-dissociated 2 (putative) [Source:ZFIN;Acc:ZDB-GENE-060503-645])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 414/1251 (33.09%), Postives = 692/1251 (55.32%), Query Frame = 1
Query:   76 NNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGV---ISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQIL-VLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXIT------KAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL--LLTNIISDHRIDCIS--REAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI-INGPLKKMFTTEQ 3768
            N  ++IS L+EKM + DKDFRFMA NDL+ +LQ DS++LD +SERK+   +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  N + +  I ++GLKT+I + P S  G+   +S+  ++I   LI  M   D   + Q+EA DI+ +++ RL   L ++  +SI  +   QL + R++VRKR+I   G L+    P  F++    +MG+L+          ++++ IQC+  +++Q   R G H+ +I P++    N+ ++E+++   Q FEA +S+CS EM  +I  ++ + LK I +DPNY+Y   D+++D    E+ ++E+   +  YSDD+D+SWKVRRSS KCLE  I +  DL+ +   S GP L+ RF EREE VK +IF  F+ LL+QT        L       P+  +L   +P ++  L +Q K K    RQG F++L E    +P    + I +++   + +L DK+ ++N+K DA++ L  L+S++    F  H + +L  V+  + D FY+++ E+L +T  ++       K    +    +  I+      L+  + D ++KE++I  M ++   LG++L  + ++  L+IF+ERL NE+ R+  ++   L++ +   I++   +   I ++  FL KN R L++ T+       TNY    K   ++  I+S +P LI ++D+ I+Q  I L         S + S+    ++  +LNL+ SPLL G  L S++   + + + +  ++     L  L          D +S  +++Y ++A C+A L  ++   ++  G +    Q   +K+       + LS++ LGEIGR ++   +K +   IM  F S  E +KSAA+++LG + +  L  ++P++L +I      QY LLHSL+E+I AL+ +       L  H   IW LL ++    EEG RNIVAEC+GKL L+ PS ++P+L++ ++ GD                                      FL  L+DPDL V+R  L+ +N+  HNKP +IR LL         +LL  LY  T++R +L+REVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLD +++  FL+ +EEGL+D+ +IK+L + ML++++K CP   + +   L+  +++   +K K  +V QE EK +E +R+A++ +  + +   + KS    +  N I  N  +  +F + Q
Sbjct:   55 NVTFYISNLLEKMTSTDKDFRFMAANDLMMELQKDSIKLDEESERKVVTMLLKLLEDKNGEVQNLAVKCLGPLVGKVKECQVETMVETLCSNMMS-NKEQLRDISSMGLKTVIAELPPSSTGLSLTVSV-CRKITSQLIGAMGMQDDVSI-QLEALDILSDMLSRLSTALVSFH-QSILTSLLAQLMSSRMAVRKRSIIALGHLVPSCSPALFTQLTEHLMGELS----RGPPTANVRTYIQCLATISRQGGHRIGEHLEKIVPMVVKFCNVEDDELREFCFQAFEAFVSRCSKEMSPHIPTIIKLCLKYISYDPNYNYDADDDEDDSMDIEDREDEDQESDDEYSDDDDMSWKVRRSSVKCLEAIISSRRDLLVELYGSVGPTLVSRFKEREENVKTDIFSAFVALLRQT-RHPHGPTLDTESKEEPAVTLLKKQVPTIVKALHRQLKEKSMRCRQGCFSLLTEMANVLPGELGEHIPALIPGIIYSLTDKSSSSNMKIDALSFLNVLLSSHNPEVFHPHISVILTPVIQCVEDPFYKITSEALQVTQQIVKLIRPLEKPVSFDAKPYVKNIFACTSKRLKAADIDQEVKERAIFCMGHILSHLGDHLG-ADLQPTLQIFLERLKNEITRLIAVKTLTLVASSQLKIDLRPILTEGIPVLGSFLRKNQRVLKLNTITVLNVIVTNYSDSFKPP-LIESILSEVPALIQENDMHISQVAINLITCMAKVCPSSL-SKIGGTILPEVLNLVHSPLLQGGALNSILQFFQVLVATKANNMGYSDLLKALRGPFYDSKSADSMSVHKQSYYSVAKCVAAL--SSVCPKEASGLVSNLIQD--VKNPKSSEPVRILSLLCLGEIGRFMNFEGQKELKGVIMEAFGSPSEEVKSAASFALGNICVGNLGEYLPFMLKEIGSQQKRQYLLLHSLKEMISALSAE------SLKPHVENIWALLFKHCECAEEGTRNIVAECLGKLTLVSPSELLPRLKKQLSSGD--------------------------------------FLKTLQDPDLNVRRVALVMLNSAAHNKPSLIRGLLT--------SLLPHLYNETQIRKDLVREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLDCLDIFEFLNHVEEGLKDHYDIKMLTFIMLARLSKLCPTAVVQRLERLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLSISEVEKSPAMADFANQIRSNAEMATIFESLQ 1237          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Xenopus
Match: nodal5 (nodal homolog 5 [Source:Xenbase;Acc:XB-GENE-483267])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 436/1246 (34.99%), Postives = 723/1246 (58.03%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V++ + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + CSLG+NL  S +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ +  L++SPLL G  L +++   + +       +  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW+LLL++S   EEG RN+VAEC+GKL L+DP T++P+L+  +A G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D++L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:   61 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILSCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFIDLIEHLLTELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNIDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGADDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLAEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVSPVVICVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDAAPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICSLGDNLG-SDLPSTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPILGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELNGLVRSPLLQGGALSAMLEFFQALVVTGTVSLGYMDLLRMLTGPVYAQSSALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWSLLLKHSECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLAAGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1272          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Xenopus
Match: nodal5 (nodal homolog 5 [Source:Xenbase;Acc:XB-GENE-483267])

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 436/1246 (34.99%), Postives = 723/1246 (58.03%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V++ + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + CSLG+NL  S +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ +  L++SPLL G  L +++   + +       +  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW+LLL++S   EEG RN+VAEC+GKL L+DP T++P+L+  +A G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D++L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILSCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFIDLIEHLLTELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNIDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGADDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLAEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVSPVVICVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDAAPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICSLGDNLG-SDLPSTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPILGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELNGLVRSPLLQGGALSAMLEFFQALVVTGTVSLGYMDLLRMLTGPVYAQSSALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWSLLLKHSECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLAAGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Xenopus
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:Xenbase;Acc:XB-GENE-5847420])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 428/1248 (34.29%), Postives = 718/1248 (57.53%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQT-ASQSRSVRLR-NSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXIT------KA--KKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTI--SSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIG--RSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI-INGPLKKMFTTEQE 3771
            YHIS+L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  IC+IGLKT+I++ P +  G  + + + ++I   L   + + +   + Q+EA DI+ +++ RLG  L  +   SI      QL +PRL+VRKRAI   G L+     + F+E +  ++G+L    + +      ++ IQC+  ++ Q   R G H+ ++ P++     + ++E+Q+   Q  E+ I +C  E+  ++  V+ + LK I +DPNY+YD +++     E + E+++++    DD+ +SWKVRRS+AKCLE+ I   PDL+++F ++A P LI RF EREE VK +IF  ++TLL+QT ++QS    L  +SQ   P   +   +P ++  L K  + K    RQG FA+L E T  +P C +Q I +++   + +L DK+  +N++ D ++ L  ++S++P   F  H   L+  V+  ++DSFY+++ E+L +   LI       KA  K  + +     +++     LQ  + D ++KE++++ M +L C LG+ L    ++  L+I +ERL NE+ R+  ++   L++ +   I++   +   + ++  FL KN R LR+ TL        NY   +K  G++  ++  LP L+ +SD+ +AQ T+      ++  +     +    ++  +  L+ SPLL G  L S++  ++ +  S         +   L   I S      + ++AY ++A C+A L +     ++    I +F Q +  K+       + L+ + L EIG  RS+   QR+ +   I+  F S  E +KSAA+Y+LGK ++     F+P++L++I   P  QY LL+SL+E + +L  +E   Y +       +W LLL++  + EEG RN+VAEC+GKL L++PS ++P+L + ++ G       P  R+T+VTAIK+TI  +  PIDSLL   + EFL  +KDPD  V+R  L+  N+  HNKP ++R+LLN         +L  LY  T+V+ ELIREVEMGPFKH  DDGLD+RK AFEC+ +LL++CLD+I++  +L+ +++GL+D+ +I++L + +L++++  CP   L + + LI  +RS   +K K  +V QE EK DE KR+A++ +  +     +  S+   E ++ I  N  L  +F   Q+
Sbjct:    6 YHISSLLEKMTSSDKDFRFMATNDLMVELQKDSIKLDEDSERKVVKMLLKLLEDKNGEVQNLAVKCLGPLVGKVKEYQVETIVDTLCSNMLS-DKEQLRDICSIGLKTVISELPAASTGSSLAANVCRKITGQLTGAIGKQEDASV-QLEALDILSDMLGRLGGTLFTFH-PSILSCLLPQLTSPRLAVRKRAILALGHLVHTCNGNLFTELVEHLLGEL----QKNESTSTTRTYIQCVATVSWQAGHRIGPHLERLVPLVVGFCRVEDDELQEQCFQALESFIRRCPKEISSHVPTVMELCLKYIAYDPNYNYDSEDEEAMETESEEEQESDDEYSDDDD-MSWKVRRSAAKCLESLISARPDLLQEFHQTAAPALILRFKEREENVKADIFSAYITLLRQTRSTQSWKQPLDISSQRDTPLGALQNQVPSVMKSLHKLLRDKSAKSRQGCFAVLTELTNAMPGCLSQHIPTLVPGLVFSLTDKSSTSNMRLDTLSFLHVVLSSHPPECFQPHLPALMPSVVTCISDSFYKITSEALLVAQQLIRVIRPLDKALDKASDALPYTKELFNANLKRLQAADIDQEVKERALSCMGHLICHLGDQLG-KDLQPTLQIILERLRNEITRLTAVKVLTLIAGSPLKIDLRPLLKEALPILASFLRKNQRALRLGTLSALGVLVRNYSDCLKP-GMVDPLLGELPALLAESDMHVAQVTVDFLTTLVS-AYPAALPKLGPSILPQLFQLVNSPLLQGGALTSILSFLRALVLSHTPHLGYPELVKQLTGPIYSGG--PALHKQAYHSVAKCVAALASACP--KESNASINQFIQDA--KNTRVGDPVKVLAFLALAEIGCERSLGGQQRE-LKSVILEAFASPSEDVKSAASYALGKASVGGPADFLPFLLHEIGGQPKRQYLLLNSLKEALTSLPSEELKPYQE------DVWKLLLQHCEAAEEGTRNVVAECLGKLILVNPSQLLPRLCKQLSSGS------PHTRSTVVTAIKFTISDQPAPIDSLLQKSIGEFLKTMKDPDPNVRRVALVMFNSAAHNKPSLVRDLLN--------VVLPPLYNETKVKKELIREVEMGPFKHTVDDGLDVRKAAFECMYTLLESCLDQIDIYEYLNHVDDGLKDHYDIRMLTFIILTRLSALCPAAVLQRLDQLIEPLRSTCTTKVKAGSVKQEFEKQDELKRSAMRTVTALLNIPEVENSRAMAEFLSQIRANSELSLLFENVQK 1215          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Xenopus
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:Xenbase;Acc:XB-GENE-5847420])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 429/1248 (34.38%), Postives = 715/1248 (57.29%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTAS-QSRSVRLR-NSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXIT------KA--KKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTI--SSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIG--RSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI-INGPLKKMFTTEQE 3771
            YHIS+L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  IC+IGLKT+I++ P +  G  + + + ++I   L   + + +   + Q+EA DI+ +++ RLG  L  +   SI      QL +PRL+VRKRAI   G L+     + F+E +  ++G+L    + +      ++ IQC+  ++ Q   R G H+ ++ P++     + ++E+Q+   Q  E+ I +C  E+  ++  V+ + LK I +DPNY+YD +++     E + E+  ++    DD+ +SWKVRRS+AKCLE+ I   PDL+++F ++A P LI RF EREE VK +IF  ++TLL+QT S QS    L  +SQ   P   +   +P ++  L K  + K    RQG FA+L E T  +P C +Q I +++   + +L DK+  +N++ D ++ L  ++S++P   F  H   L+  V+  ++DSFY+++ E+L +   LI       KA  K  + +     +++     LQ  + D ++KE++++ M +L C LG+ L    ++  L+I +ERL NE+ R+  ++   L++ +   I++   +   + ++  FL KN R LR+ TL        NY   +K  G++  ++  LP L+ +SD+ +AQ T+      ++  +     +    ++  +  L+ SPLL G  L S++  ++ +  S         +   L   I S      + ++AY ++A C+A L +     ++    I +F Q +  K+       + L+ + L EIG  RS+   QR+ +   I+  F S  E +KSAA+Y+LGK ++     F+P++L++I   P  QY LL+SL+E + +L  +E   Y +       +W LLL++  + EEG RN+VAEC+GKL L++PS ++P+L + ++ G       P  R+T+VTAIK+TI  +  PIDSLL   + EFL  +KDPD  V+R  L+  N+  HNKP ++R+LLN         +L  LY  T+V+ ELIREVEMGPFKH  DDGLD+RK AFEC+ +LL++CLD+I++  +L+ +++GL+D+ +I++L + +L++++  CP   L + + LI  +RS   +K K  +V QE EK DE KR+A++ +  +     +  S+   E ++ I  N  L  +F   Q+
Sbjct:   18 YHISSLLEKMTSSDKDFRFMATNDLMVELQKDSIKLDEDSERKVVKMLLKLLEDKNGEVQNLAVKCLGPLVGKVKEYQVETIVDTLCSNMLS-DKEQLRDICSIGLKTVISELPAASTGSSLAANVCRKITGQLTGAIGKQEDASV-QLEALDILSDMLGRLGGTLFTFH-PSILSCLLPQLTSPRLAVRKRAILALGHLVHTCNGNLFTELVEHLLGEL----QKNESTSTTRTYIQCVATVSWQAGHRIGPHLERLVPLVVGFCRVEDDELQEQCFQALESFIRRCPKEISSHVPTVMELCLKYIAYDPNYNYDSEDEEAMETESEEEQGCDDEYSDDDD-MSWKVRRSAAKCLESLISARPDLLQEFHQTAAPALILRFKEREENVKADIFSAYITLLRQTRSTQSWKQPLDISSQRDTPLGALQNQVPSVMKSLHKLLRDKSAKSRQGCFAVLTELTNAMPGCLSQHIPTLVPGLVFSLTDKSSTSNMRLDTLSFLHVVLSSHPPECFQPHLPALMPSVVTCISDSFYKITSEALLVAQQLIRVIRPLDKALDKASDALPYTKELFNANLKRLQAADIDQEVKERALSCMGHLICHLGDQLG-KDLQPTLQIILERLRNEITRLTAVKVLTLIAGSPLKIDLRPLLKEALPILASFLRKNQRALRLGTLSALGVLVRNYSDCLKP-GMVDPLLGELPALLAESDMHVAQVTVDFLTTLVS-AYPAALPKLGPSILPQLFQLVNSPLLQGGALTSILSFLRALVLSHTPHLGYPELVKQLTGPIYSGG--PALHKQAYHSVAKCVAALASACP--KESNASINQFIQDA--KNTRVGDPVKVLAFLALAEIGCERSLGGQQRE-LKSVILEAFASPSEDVKSAASYALGKASVGGPADFLPFLLHEIGGQPKRQYLLLNSLKEALTSLPSEELKPYQE------DVWKLLLQHCEAAEEGTRNVVAECLGKLILVNPSQLLPRLCKQLSSGS------PHTRSTVVTAIKFTISDQPAPIDSLLQKSIGEFLKTMKDPDPNVRRVALVMFNSAAHNKPSLVRDLLN--------VVLPPLYNETKVKKELIREVEMGPFKHTVDDGLDVRKAAFECMYTLLESCLDQIDIYEYLNHVDDGLKDHYDIRMLTFIILTRLSALCPAAVLQRLDQLIEPLRSTCTTKVKAGSVKQEFEKQDELKRSAMRTVTALLNIPEVENSRAMAEFLSQIRANSELSLLFENVQK 1227          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Xenopus
Match: nodal5 (nodal homolog 5 [Source:Xenbase;Acc:XB-GENE-483267])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 424/1229 (34.50%), Postives = 709/1229 (57.69%), Query Frame = 1
Query:  136 RFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            RFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V++ + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + CSLG+NL  S +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ +  L++SPLL G  L +++   + +       +  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW+LLL++S   EEG RN+VAEC+GKL L+DP T++P+L+  +A G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D++L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    7 RFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILSCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFIDLIEHLLTELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNIDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGADDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLAEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVSPVVICVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDAAPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICSLGDNLG-SDLPSTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPILGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELNGLVRSPLLQGGALSAMLEFFQALVVTGTVSLGYMDLLRMLTGPVYAQSSALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWSLLLKHSECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLAAGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1201          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Mouse
Match: Cand1 (cullin associated and neddylation disassociated 1 [Source:MGI Symbol;Acc:MGI:1261820])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 434/1246 (34.83%), Postives = 722/1246 (57.95%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +LRLLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + C+LG+NL P  +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V      + L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D++L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILRLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALIARFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGDTPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLGP-DLSNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------AGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Mouse
Match: Cand2 (cullin-associated and neddylation-dissociated 2 (putative) [Source:MGI Symbol;Acc:MGI:1914338])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 412/1261 (32.67%), Postives = 695/1261 (55.11%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGV-ISI-LIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINLNE-EIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNY-HYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRL--RNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDP--------LYSILQTQNTDFD--LKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILN---------LLKSPLLHGST--LQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQEIAA 3780
            ++IS+L+EKM + DKDFRFMA +DL+S+LQ DS++LD DSERK+ + +LRLLED++ EVQN  VKCL  LV K+KE  V N++  L   M + + + +  I  IGLKT++++ P +  G  ++I + ++I   L   + Q +   + Q+EA DI+ +++ RLG  L  +   S+      QL +PRL+VRKR +   G L +    D F E    ++ +L   +        +++LIQC+G + +Q   R GAH+ ++ P+++   NL++ E+++  LQ FEA + KC  EM  ++  V  + L+ + HDPNY H  +DE+    E+ +  E   E  YSDD+D+SWKVRR++AKC+   I + PDL+ DF  +  P LI RF EREE VK +IF  ++ LL+ T      +      +Q  R    +   +P ++  L++Q K +    RQG F +  E    +P   A+ +  +++  + +L D + ++ ++ DA+  L  L+ T P   F  H   LL  V+  + D FY+++ E+L +   L+     ++      R+ DP          ++ + + TD D  +KE++I+ + +L   LG+ L    +E  L + ++RL NE+ R+  ++A  L++ +   +++   +   + ++  FL KN R LR+ TL   ++   +    +    V   +++ LP L++++D+ +AQ    L   FLT       S     +  P+L          LL + +L  +   LQ+LV         E  ++  + T  + N + D     + ++ + ++A C+A L  +A   ++  G        +   H S  +  + L+ + L E+G+      ++ +   ++    S  E +++AAAY+LG++    L  F+P++L QI+  P  QY LLH+LRE + A A  +NLK      +   +W LL +   SPEEG R +VAECIGKL  ++P  ++P+ R+ +A G       P  R+T++TA+K+ I  + H ID LL +++ EF+  L+DPDL V+RA L   N+ VHNKP ++R           D++L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ SLL++CL ++++  FL+ +E+GL+D+ +I++L + ML+++A  CP   L + + LI  +R+   +K K  +V QE EK +E KR+A++ +  + TN  + KS    +    I + P L  +F + Q+  A
Sbjct:    6 FYISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVRTLLRLLEDRSGEVQNLAVKCLGPLVGKVKEYQVENIVDTLCANM-RSDKEQLRDIAGIGLKTVLSELPPAATGSGLAINVCRKITGQLTSAIAQQEDVAV-QLEALDILSDMLSRLGAPLGTFH-ASLLHCLLPQLSSPRLAVRKRTVVALGHLAAACSTDLFVELADHLVDRLPGPR-APASPAAIRTLIQCLGSVGRQAGHRLGAHLDRLVPMVEEFCNLDDDELRESCLQAFEAFLRKCPKEMDPHVPNVTSLCLQYMKHDPNYDHDSDDEEQMETEDSEFSEQESEDEYSDDDDMSWKVRRAAAKCMAALISSRPDLLPDFHCTLAPALIRRFKEREENVKADIFGAYIMLLRHTRPPKGWLEAVEEPTQTGRNLNMLRAQVPLVIKALQRQLKDRNVRTRQGCFNLFTELAGVLPGSLAEHMAVLVSGIVFSLADYSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPTLLPPVMACVADPFYKVAAEALLVLQELVRTLWPLDRP----RLLDPEPYVGEMSTATLARLRATDLDQEVKERAISCVGHLVGHLGDRLG-DDLEPTLMLLLDRLRNEITRLPAVKALTLVAMSPLRLDLQPILAEALPILASFLRKNQRALRLATLAALDALAQSQGLGLPPPAVR-TVLTELPALVSENDMHVAQ----LAVDFLTTVTQTQPSSLV-EVSGPVLGELLQLLHSPLLPAGVLAATEGFLQALVGTRPPCV--EYSELISLLTAPVYNQVGDGGPG-LHKQVFHSLARCVAAL--SAACPQEAAGTASRLVCDAKSPHSS--TGVKVLAFLSLAEVGQVAGPGPQRELKTVLLEALGSPSEDVRAAAAYALGRVGAGNLPDFLPFLLAQIEAQPRRQYLLLHALREALGA-AQPDNLK-----PYVEDVWALLFQRCESPEEGTRCVVAECIGKLVFVNPPYLLPRFRKQLAAGQ------PYTRSTVITAVKFLISDQPHSIDPLLKSFIAEFMESLQDPDLNVRRATLTFFNSAVHNKPSLVR--------DLLDDILPLLYQETKIRRDLIREVEMGPFKHTVDDGLDVRKAAFECMYSLLESCLGQLDMCEFLNHVEDGLKDHYDIRMLTFIMLARLATLCPAPVLQRVDRLIEPLRATCTAKVKAGSVKQELEKQEELKRSAMRAVAALLTNPEVRKSPTVADFSAQIRSNPELTTLFESIQKDTA 1224          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Mouse
Match: Cand1 (cullin associated and neddylation disassociated 1 [Source:MGI Symbol;Acc:MGI:1261820])

HSP 1 Score: 132.88 bits (333), Expect = 4.222e-34
Identity = 87/225 (38.67%), Postives = 131/225 (58.22%), Query Frame = 1
Query:  136 RFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGV 804
            RFMA NDL+++LQ DS++LD DSERK+ K +LRLLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  
Sbjct:   30 RFMATNDLMTELQKDSIKLDDDSERKVVKMILRLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAA 247          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. UniProt/SwissProt
Match: sp|Q5R6L5|CAND1_PONAB (Cullin-associated NEDD8-dissociated protein 1 OS=Pongo abelii OX=9601 GN=CAND1 PE=2 SV=1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 429/1246 (34.43%), Postives = 719/1246 (57.70%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFL---YSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM +  KDFRFMA NDL+++LQ DS++LD DSERK+ K +L+L ED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F   I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+YD++++ ++A + D  +D+++     YSDD D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LND++ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D D+KE++I+ M  + C+LG+NL  S +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSGKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLQEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVGLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDGDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDESSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDVFTCTIKRLKAADIDQDVKERAISCMGQIICNLGDNLG-SDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. UniProt/SwissProt
Match: sp|Q6ZQ38|CAND1_MOUSE (Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus OX=10090 GN=Cand1 PE=1 SV=2)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 434/1246 (34.83%), Postives = 722/1246 (57.95%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +LRLLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + C+LG+NL P  +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V      + L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D++L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILRLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALIARFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGDTPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLGP-DLSNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------AGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. UniProt/SwissProt
Match: sp|P97536|CAND1_RAT (Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1)

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 433/1246 (34.75%), Postives = 721/1246 (57.87%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + C+LG+NL P  +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D++L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLGP-DLSNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. UniProt/SwissProt
Match: sp|Q86VP6|CAND1_HUMAN (Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 433/1246 (34.75%), Postives = 720/1246 (57.78%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + C+LG+NL  S +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLG-SDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. UniProt/SwissProt
Match: sp|A7MBJ5|CAND1_BOVIN (Cullin-associated NEDD8-dissociated protein 1 OS=Bos taurus OX=9913 GN=CAND1 PE=2 SV=1)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 433/1246 (34.75%), Postives = 720/1246 (57.78%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHY---XXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQE 3771
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P + +G  + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+   +ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+Y   DEDE+   A+  D+++   +  YSDD+D+SWKVRR++AKCL+  + T  +++ +F K+  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++   +      I  ++      L+  + D ++KE++I+ M  + C+LG+NL  S +   L+IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + ++ ++  ++  LPPLI++SD+ ++Q  I+     L + +    S+    +++ ++ L++SPLL G  L +++   + +      ++  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  IDLS +  +   I+  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V        L  +   IW LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI     PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I + P L  +F + Q+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLSRQGGLLVNFH-PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELS---KND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLG-SDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSL-TAAMIDAVLDELPPLISESDMHVSQMAISFLTT-LAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASV------VGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSS------YARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQK 1217          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. TrEMBL
Match: M4AY56 (TIP120 domain-containing protein OS=Xiphophorus maculatus OX=8083 PE=4 SV=2)

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 436/1249 (34.91%), Postives = 724/1249 (57.97%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG----VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLF--------NPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXX-XXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLL-VELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDP------LYSI----LQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDI---KVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCS-----SYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI 3729
            YHIS+L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSERK+   +LRLLED+N EVQN  VKCL+ LV K+KEP V  V+ D+    +  + + +  I ++GLK +I + PLS +G     +  + K+I   LI  + + +   + Q+EA DI+C++   LG     + LKSIF+   + LF        + R++VRKR+I   G L+    P  FS+    ++ +LA   +  L    +++ IQC+  +++Q   R G H+ ++ P++    ++ ++E+++   Q FEA I +C  EM  ++  V  + LK +  DPNY+YD++E+ + + + +   ++  +  YSDD+D+SWKVRRS+ KCLE  I T  DL+  F  S  P L+ RF EREE VK ++F  F TLL+QT   S             S   L+ +P ++  L KQ K K    RQG F +L E    VP    + I  ++   + +L DK+ ++ ++ DA++   V LIS +P A F  H   LL  +L  + D+FY+++ E+L +T  LI   +      T L  +DP      ++S+    L+  + D ++KE++I+ M ++ C LG+ L  ++++  L IF++RL NE+ R+  ++   L+S +   I+++  +P  + ++  FL KN R L++ TL C  +  T++   IK +  +  ++S +PPL+++SD+ ++Q +I L         S + ++    ++S +  L+ SPLL G  L +++  ++ +   +  ++   +++ +L+     S    D + R++Y ++A C+A L  ++ S ++  G +     TSLI+   D S     S + LS++ LGE+GRS  L+  K V   I+  F+S +E +K+AA+ +LG MA+  L+ F+P++L +I   P  QY LLHSL+E+I A         S L+ H   IW LL ++  S EEG RN+VAEC+GKL  ++P+ ++P+L++ +  G       PL R+T+VTA+K+TI+    PIDSLL + + +FL  L+D D+ V+R  L+  N+  HNKP +++ LL          +L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CL+ ++V  FLD +EEGL+D+ +I++L + ML+++   CP   L + + L+  +++   +K K  +V QE EK +E +R+A++ +  +     + +S    E  N I
Sbjct:    6 YHISSLLEKMTSTDKDFRFMATNDLMLELQKDSIKLDEDSERKVVNMLLRLLEDKNGEVQNLAVKCLAPLVSKVKEPQV-EVMVDILCTNMTSDKEQLRDISSMGLKAVIAELPLSASGEGWLAVPSVCKKITSQLIGALGKQEDVSV-QLEALDILCDM---LGSHFEGFILKSIFLCLFYCLFFTFIIQLTSSRMAVRKRSILALGQLVPCCSPALFSQLTEHLLKELAKNPQTSL----MRTYIQCLAAVSRQGGHRVGEHLEKLIPMVVKFTSVEDDELREYCFQAFEAFIRRCPKEMSPHVATVTKLCLKFMTFDPNYNYDDNEEDEDSMDIEDGADEESDDEYSDDDDMSWKVRRSAIKCLEALICTRRDLLLSFYSSICPALLARFKEREENVKADVFAAFSTLLRQTRGGS-------------SHHSLITVPVIVKALHKQLKEKSLKSRQGCFCLLTELAYTVPGALEEHIPVLIPGIVFSLTDKSTSSTMRIDALSFFHVLLISHHPQA-FQPHMQTLLPAILTCVEDTFYKITSEALLVTQQLIKVMRPQGQTTTSLG-FDPKPFIQEVFSVTMKRLKATDIDQEVKERAISCMGHMVCHLGD-LLGTELQGVLGIFLDRLKNEITRLTAVKTLTLISASPLKIDMTSILPEALSVLGSFLRKNQRTLKLSTLACLTALVTHHAASIKPAA-LEPVLSEIPPLVDESDMHVSQVSITLLTCMAKACPSSL-AKISSSVLSGVFKLVHSPLLQGGALLAILDFLQALVVSKAINLGYSQLLKSLMEPFQSSKSSADVLHRQSYHSVARCVAAL--SSASPKEMAGTV-----TSLIQQVCDSSFHSPESARVLSLLCLGEVGRSGGLAGSKEVQGVILEAFSSTNEEIKTAASCALGGMAVGSLNEFLPFMLKEISAQPRRQYLLLHSLKEVISACPA------SSLSPHVESIWALLFQHCESQEEGTRNLVAECLGKLTFVNPAQLLPRLKQQLKAGS------PLTRSTVVTAVKFTIVDHPAPIDSLLKDSIGDFLKTLQDSDINVRRVALVMFNSAAHNKPSLVQGLLG--------TILPHLYKETQIRKDLIREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLEGLDVLQFLDHVEEGLKDHYDIRMLTFLMLARLVSLCPAGVLQRLDRLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLAVPEVERSPSMAEFANQI 1200          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. TrEMBL
Match: A0A3B5MBN1 (TIP120 domain-containing protein OS=Xiphophorus couchianus OX=32473 PE=4 SV=1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 437/1250 (34.96%), Postives = 727/1250 (58.16%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGV--ISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFI---ACQH-----QLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXX-XXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQ--------ILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLL-VELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDP------LYSI----LQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDI---KVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI 3729
            YHIS+L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSERK+   +LRLLED+N EVQN  VKCL+ LV K+KEP V  V+ D+    +  + + +  I ++GLK +I + PLS +G+   + + K+I   LI  + + +   + Q+EA DI+C++   LG     + LKSIF+   +C       QL + R++VRKR+I   G L+    P  FS+    ++ +LA   +  L    +++ IQC+  +++Q   R G H+ ++ P++    ++ ++E+++   Q FEA I +C  EM  ++  V  + LK +  DPNY+YD++E+ + + + +   ++  +  YSDD+D+SWKVRRS+ KCLE  I T  DL+  F  S  P L+ RF EREE VK ++F  F TLL+QT   S    L     I  S +        I V +P ++  L KQ K K    RQG F +L E    VP    + I  ++   + +L DK+ ++ ++ DA++   V LIS +P A F  H   LL  +L  + D+FY+++ E+L +T  LI   +      T L  +DP      ++S+    L+  + D ++KE++I+ M ++ C LG+ L  ++++  L IF++RL NE+ R+  ++   L+S +   I+++  +P  + ++  FL KN R L++ TL C  +  T++   IK +  +  ++S +PPL+++SD+ ++Q +I L         S + ++    ++S +  L+ SPLL G  L +++  ++ +   +  ++   +++ +L+     S    D + R++Y ++A C+A L  ++ S ++  G +    Q   +K+ S   S + LS++ LGE+GRS  L+  K V   I+  F+S +E +K+AA+ +LG MA+  L+ F+P++L +I   P  QY LLHSL+E+I A         S L+ H   IW LL ++  S EEG RN+VAEC+GKL  ++P+ ++P+L++ +  G       PL R+T+VTA+K+TI+    PIDSLL + + +FL  L+D D+ V+R  L+  N+  HNKP +++ LL          +L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CL+ ++V  FLD +EEGL+D+ +I++L + ML+++   CP   L + + L+  +++   +K K  +V QE EK +E +R+A++ +  +     + +S    E  N I
Sbjct:    6 YHISSLLEKMTSTDKDFRFMATNDLMLELQKDSIKLDEDSERKVVNMLLRLLEDKNGEVQNLAVKCLAPLVSKVKEPQV-EVMVDILCTNMTSDKEQLRDISSMGLKAVIAELPLSASGLSLTASVCKKITSQLIGALGKQEDVSV-QLEALDILCDM---LGSHFEGFILKSIFLCLFSCLFFTFIIQLTSSRMAVRKRSILALGQLVPCCSPALFSQLTEHLLKELAKNPQTSL----MRTYIQCLAAVSRQGGHRVGEHLEKLIPMVVKFTSVEDDELREYCFQAFEAFIRRCPKEMSPHVATVTKLCLKFMTFDPNYNYDDNEEDEDSMDIEDGADEESDDEYSDDDDMSWKVRRSAIKCLEALICTRRDLLLSFYSSICPALLARFKEREENVKADVFAAFSTLLRQTRGGSSHHSL-----ITASSEYSCLICVFISVQVPVIVKALHKQLKEKSLKSRQGCFCLLTELAYTVPGALEEHIPVLIPGIVFSLTDKSTSSTMRIDALSFFHVLLISHHPQA-FQPHMQTLLPAILTCVEDTFYKITSEALLVTQQLIKVMRPQGQTTTSLG-FDPKPFIQEVFSVTMKRLKATDIDQEVKERAISCMGHMVCHLGD-LLGTELQGVLGIFLDRLKNEITRLTAVKTLTLISASPLKIDMTSILPEALSVLGSFLRKNQRTLKLSTLACLTALVTHHAASIKPAA-LEPVLSEIPPLVDESDMHVSQVSITLLTCMAKTCPSSL-AKISSSVLSGVFKLVHSPLLQGGALLAILDFLQALVVSKSINLGYSQLLKSLMEPFQSSKSSADVLHRQSYRSVARCVAAL--SSASPKEMPGTVTSLIQQ--VKNSSSPESARVLSLLCLGEVGRSGGLAGSKEVQGVILEAFSSTNEEIKTAASCALGGMAVGSLNEFLPFMLKEISAQPRRQYLLLHSLKEVISACPA------SSLSPHVESIWALLFQHCESQEEGTRNLVAECLGKLTFVNPAQLLPRLKQQLKAGS------PLTRSTVVTAVKFTIVDHPAPIDSLLKDSIGDFLKTLQDSDINVRRVALVMFNSAAHNKPSLVQGLLG--------TILPHLYKETQIRKDLIREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLEGLDVLQFLDHVEEGLKDHYDIRMLTFLMLARLVSLCPAGVLQRLDRLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLAVPEVERSPSMAEFANQI 1212          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. TrEMBL
Match: A0A3B5PX04 (TIP120 domain-containing protein OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 431/1242 (34.70%), Postives = 723/1242 (58.21%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGV--ISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXX-XXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSR-------SVRLRNSQDIRPSKQILVL-IPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLL-VELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDP------LYSI----LQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDI---KVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI 3729
            YHIS+L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSERK+   +LRLLED+N EVQN  VKCL+ LV K+KEP V  V+ D+    +  + + +  I ++GLK +I + PLS +G+   + + K+I   LI  + + +   + Q+EA DI+C+++ RLG  L  +    +         + R++VRKR+I   G L+    P  FS+    ++ +LA   +  L    +++ IQC+  +++Q   R G H+ ++ P++    ++ ++E+++   Q FEA I +C  EM  ++  V  + LK +  DPNY+YD++E+ + + + +   ++  +  YSDD+D+SWKVRRS+ KCLE  I T  DL+  F  S  P L+ RF EREE VK ++F  F TLL+QT   S        S     SQ+  P+  +L   +P ++  L KQ K K    RQG F +L E    VP    + I  ++   + +L DK+ ++ ++ DA++   V LIS +P A F  H   LL  +L  + D+FY+++ E+L +T  LI   +      T L  +DP      ++S+    L+  + D ++KE++I+ M ++ C LG+ L  ++++  L IF++RL NE+ R+  ++   L+S +   I+++  +P  + ++  FL KN R L++ TL C  +  T++   IK +  +  ++S +PPL+++SD+ ++Q +I L         S + ++    ++S +  L+ SPLL G  L +++  ++ +   +  ++   +++ +L+     S    D + R++Y ++A C+A L  ++ S ++  G +    Q   +K+ S   S + LS++ LGE+GRS  L+  K V   I+  F+S +E +K+AA+ +LG MA+  L+ F+P++L +I   P  QY LLHSL+E+I A         S L+ H   IW LL ++  S EEG RN+VAEC+GKL  ++P+ ++P+L++ +  G       PL R+T+VTA+K+TI+    PIDSLL + + +FL  L+D D+ V+R  L+  N+  HNKP +++ LL          +L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CL+ ++V  FLD +EEGL+D+ +I++L + ML+++   CP   L + + L+  +++   +K K  +V QE EK +E +R+A++ +  +     + +S    E  N I
Sbjct:    6 YHISSLLEKMTSTDKDFRFMATNDLMLELQKDSIKLDEDSERKVVNMLLRLLEDKNGEVQNLAVKCLAPLVSKVKEPQV-EVMVDILCTNMTSDKEQLRDISSMGLKAVIAELPLSASGLSLTASVCKKITSQLIGALGKQEDVSV-QLEALDILCDMLGRLGGALVGFHSSLLSSLLPQLTSS-RMAVRKRSILALGQLVPCCSPALFSQLTEHLLKELAKNPQTSL----MRTYIQCLAAVSRQGGHRVGEHLEKLIPMVVKFTSVEDDELREYCFQAFEAFIRRCPKEMSPHVATVTKLCLKFMTFDPNYNYDDNEEDEDSMDIEDGADEESDDEYSDDDDMSWKVRRSAIKCLEALICTRRDLLLSFYSSICPALLARFKEREENVKADVFAAFSTLLRQTRGGSSHHSLITASSEPGKSQEEEPAVPLLKKEVPVIVKALHKQLKEKSLKSRQGCFCLLTELAYTVPGALEEHIPVLIPGIVFSLTDKSTSSTMRIDALSFFHVLLISHHPQA-FQPHMQTLLPAILTCVEDTFYKITSEALLVTQQLIKVMRPQGQTTTSLG-FDPKPFIQEVFSVTMKRLKATDIDQEVKERAISCMGHMVCHLGD-LLGTELQGVLGIFLDRLKNEITRLTAVKTLTLISASPLKIDMTSILPEALSVLGSFLRKNQRTLKLSTLACLTALVTHHAASIKPAA-LEPVLSEIPPLVDESDMHVSQVSITLLTCMAKACPSSL-AKISSSVLSGVFKLVHSPLLQGGALLAILDFLQALVVSKAINLGYSQLLKSLMEPFQSSKSSADVLHRQSYHSVARCVAAL--SSASPKEMAGTVTSLIQQ--VKNSSSPESARVLSLLCLGEVGRSGGLAGSKEVQGVILEAFSSTNEEIKTAASCALGGMAVGSLNEFLPFMLKEISAQPRRQYLLLHSLKEVISACPA------SSLSPHVESIWALLFQHCESQEEGTRNLVAECLGKLTFVNPAQLLPRLKQQLKAGS------PLTRSTVVTAVKFTIVDHPAPIDSLLKDSIGDFLKTLQDSDINVRRVALVMFNSAAHNKPSLVQGLLG--------TILPHLYKETQIRKDLIREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLEGLDVLQFLDHVEEGLKDHYDIRMLTFLMLARLVSLCPAGVLQRLDRLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLAVPEVERSPSMAEFANQI 1211          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. TrEMBL
Match: A0A2C9JF10 (TIP120 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106055560 PE=4 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 446/1250 (35.68%), Postives = 721/1250 (57.68%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINLNE-EIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDED--LSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIR----PSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXIT------KAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVML-EIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDC--ISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQEIA 3777
            YHI+ L+EKM + DK FRFMA NDL+++LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+IT+ P S   + + + K+I   L   + + +   + Q+EA DI+ +++ R G  L ++ + +I  A   QL +PRL+VRKRAI   G L+       F+E I +++ +L      +      ++ IQC+G +++Q   R G ++ ++ P++      ++ E+ +  LQ FE+ + +C  E+  +I  ++ + LK + HDPNY+YD+DED +   +   EED+EE      +D  +SWKVRRS+AKCLE  + T  D++ +F K+  P LI RF EREE VK +IF  ++ LLKQT    R V +    +      P   +   +P ++  + +Q K K    RQG F++L E  + +P    Q + S+M     +L DK  ++N+K D ++ L  L+S +    F  H   L+  ++  + D FY+++ E+L +T  L+       +    ++I  +  +Y      L+  + D ++KE++I  M  +  +LG+ L  +++++CL IF+ERL NE+ R+  ++A  L++++   I+I   +     ++  FL KN R L++ TL+C +    NY   +  +G ML +++  +PPLIN++DL I+Q T+ L    ++R+H    S     ++  IL L++SPLL G  L +++   + + +  +  +     L +L   + D R+    I R+AY +IA C+A L T    +E     + +F   S IK+          S++ LGEIG++IDLS    + + I+  F+S +E +KSAA+Y+LG +++  L  F+P++L +I+  P  QY LLHSL+EII   +  +      L S+   IW +L  N   PEEG RN+V+EC+GKL L+DP  ++  L++ +          PL R+T+VTAIK+TI  +  PID LL   + +FL  L+D DL V+R  L+  N+  HNKP +IR+LL        + +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L Y ML +++  CP   L + + L+  IR+   +K K  +V QE EK +E KR+A++ +V +    + +KS    + M  I   P L  M+ T Q+ A
Sbjct:    6 YHIANLLEKMTSTDKYFRFMATNDLMAELQKDSIKLDDDSERKVVKMLLKLLEDKNGEVQNLAVKCLGPLVSKVKEFQVETIVDTLCSNMLS-DKEQLRDISSIGLKTVITELPPSSTTLAASICKKITTRLTNAIAKQEDVPV-QLEALDILGDLLSRFGGLLISFHI-TIKQALLPQLSSPRLAVRKRAIIAIGHLVMSCSTSLFNELIEYLLTELT----KNSSTSTTRTYIQCVGAISRQAGGRFGEYLDKMVPLIVRFCKTDDDELTEFCLQAFESFVRRCPKEVSNFIPDIIAICLKYVCHDPNYNYDDDEDEEMDTDVQEEEDDEETEDEYSDDDDMSWKVRRSAAKCLEAVVSTRHDMLPEFYKTVSPALIARFKEREENVKSDIFHAYIALLKQT----RPVIIAGVDNTEAQEGPLNMLRAQVPDIVRAVHRQLKEKSIKTRQGCFSLLTELVLVLPGALDQHLTSLMPGIQYSLGDKNTSSNMKIDTLSFLNTLLSNHSHVVFHPHIKALVPPIVNAVGDPFYKITSEALLVTQQLVKVLRPLDQKSNFDYIPYVKSLYACTVKRLKAADIDQEVKERAIACMGQIVANLGDCLL-AELKECLPIFLERLKNEITRLTTVKALTLIAQSPLAIDIRFILEEGFPILASFLRKNQRALKLSTLQCLDVVVKNYGGAV--NGYMLADVMKEMPPLINENDLHISQLTLNLLTS-ISRSHKQSISNIQTEILPQILILVQSPLLQGGALNAVLEFFRALIALSLPKLGFRDLLQMLILPVYDTRLTSGPIHRQAYHSIARCVAAL-TEMSPIE-ASNVVAQF--VSDIKNPKSTEHIVLFSLLALGEIGKNIDLSSHGDIQNVILECFSSPNEEVKSAASYALGNVSVGNLPKFLPFVLQEIENQPKRQYLLLHSLKEIINCESSSQT-GLEILKSYVKTIWTMLFHNCECPEEGTRNVVSECMGKLTLVDPRNLIGSLQQHLNDAS------PLARSTVVTAIKFTISDQPQPIDPLLKTCIGDFLRTLQDEDLTVRRVALVTFNSAAHNKPSLIRDLL--------ETVLPHLYNETKVRKELIREVEMGPFKHTLDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTYLMLVRLSHLCPSAVLQRLDRLVEPIRATCTTKVKAHSVKQEYEKQEELKRSALRAVVALLNIADADKSPQMNDFMTHIKATPELAAMYETIQKDA 1221          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. TrEMBL
Match: A0A3B3VP65 (TIP120 domain-containing protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 434/1242 (34.94%), Postives = 716/1242 (57.65%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG---VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKS--------IFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXX-XXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLL-VELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT---------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDI---KVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI 3729
            YHIS+L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSERK+   +LRLLED+N EVQN  VKCL+ LV K+KEP V  V+ D+    +  + + +  I ++GLK +I + PLS +G   + + + K+I   LI  + + +   + Q+EA DI+ ++   LG     + LKS        +FI    QL N R++VRKR+I   G L++   P  FS+    ++ +LA   +  L     ++ IQC+  +++Q   R G H+ ++ P++    ++ ++E+++   Q FEA I KC  EM  ++  V  + LK +  DPNY+YD++E+ + + + +   ++  +  YSDD+D+SWKVRRS+ KCLE  I T  DL+  F  S  P L+ RF EREE VK ++F  F TLL+QT   S    L              ++P ++  L KQ K K    RQG F +L E    VP    + I  +M   + +L DK+ ++ ++ DA++   V LIS +P A F  H   LL  VL  + D+FY+++ E+L +T  LI   +      T         I +++      L+  + D ++KE++I+ M ++ C LG++L  ++++  L IF++RL NE+ R+  ++   L+S +   I+++  +P  + ++  FL KN R L++ TL C  +  T++   IK +  +  ++S +PPL+++SD+ ++Q +I L         S + ++    ++S +  L+ SPLL G  L +++  ++ +   +  ++   +++ +L+     +    D + R++Y ++A C+A L  ++ S ++  G +    Q    ++ S   S Q LS++ LGE+GRS  L   K V   I+  F+S +E +K+AA+ +LG MA+  L+ F+P++L +I   P  QY LLHSL+E+I A         S L+ H   IW LL ++  S EEG RN+VAEC+GKL L++P+ ++P+L++ +  G       PL R+T+VTA+K+TI+    PIDSLL + + +FL  L+D D+ V+R  L+  N+  HNKP +I+ LL          +L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CL+ ++V  FLD +EEGL+D+ +IK+L + ML+++   CP   L + + L+  +++   +K K  +V QE EK +E +R+A++ +  +     + +S    E  N I
Sbjct:    6 YHISSLLEKMTSTDKDFRFMATNDLMLELQKDSIKLDEDSERKVVNMLLRLLEDKNGEVQNLAVKCLAPLVSKVKEPQV-EVMVDILCTNMTSDKEQLRDISSMGLKAVIAELPLSASGEGCLTASVCKKITSQLIGALGKQEDVSV-QLEALDILSDM---LGSHFEGFILKSTYLHLFSCLFITFIVQLTNSRMAVRKRSILALGQLVACCSPALFSQLTEHLLKELAKNPQTSLT----RTYIQCLATVSRQGGHRVGEHLEKLIPMVVKFTSVEDDELREYCFQAFEAFIRKCPKEMSPHVATVTKLCLKFMTFDPNYNYDDNEEDEDSMDIEDGADEESDDEYSDDDDMSWKVRRSAIKCLEALISTRRDLLLSFYSSICPALLARFKEREENVKADVFAAFSTLLRQTRGGSSHHSL--------------IVPVIVKALHKQLKEKSLKSRQGCFCLLTEVAYTVPGALEEHIPVLMPGIVFSLTDKSTSSTMRIDALSFFHVLLISHHPQA-FQPHMQMLLPAVLTCVEDTFYKITSEALLVTQQLIKVMRPQGQTTTSSGFDPKPFIQKVFSVTMKRLKATDIDQEVKERAISCMGHMVCHLGDHLG-TELQGVLGIFLDRLKNEITRLTAVKTLTLISASPLKIDMTAILPEALSVLGSFLRKNQRVLKLSTLACLTALVTHHAASIKPAA-LEPVLSEIPPLVDESDMHVSQVSITLLTCMAKACPSSL-AKISSSVLSGVFKLIHSPLLQGGALLAILDFLQALVVSKATNLGYSQLLKSLMEPFQSTKSSADDLHRQSYHSVARCVAAL--SSASPKETPGTVASLIQ----QNSSSPESAQVLSLLCLGEVGRSGSLGGSKEVQGVILEAFSSTNEEIKTAASCALGGMAVGSLNEFLPFMLKEISAQPRRQYLLLHSLKEVISACPA------SSLSPHVESIWALLFQHCESQEEGTRNLVAECLGKLTLVNPAQLLPRLKQQLKAGS------PLTRSTVVTAVKFTIVDHPAPIDSLLKDSIGDFLKTLQDSDINVRRVALVMFNSATHNKPSLIKGLLG--------TILPHLYKETQIRKDLIREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLEGLDVLQFLDHVEEGLKDHYDIKMLTFLMLARLVSLCPAAVLQRLDRLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLAVPEVERSPSMTEFANQI 1194          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Cavefish
Match: cand2 (cullin-associated NEDD8-dissociated protein 1 [Source:NCBI gene;Acc:103033844])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 439/1267 (34.65%), Postives = 711/1267 (56.12%), Query Frame = 1
Query:   76 NNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENG--VISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXX---XXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDPL---------------------YSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLE-IISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLV------VLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI-INGPLKKMFTTEQ 3768
            N  Y+IS L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSERK+   +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I ++GLKT+I + P +  G  + + + K+I   LI  M + D   + Q+EA DI+ +++ RLG  L ++  +SI  +   QL +PR++VRKRAI   G L+    P  F++    +MG++           + ++ IQC+  + +Q   R G H+ +I P++    ++ ++E+++   Q FEA + +C  EM  +I  V+ + LK I HDPNY+YD     E+       D+EE   +  YSDD+D+SWKVRRSS KCLE  I +  DL+ +   S  P L+ RF EREE VK +IF  F+ L++QT     S     +++      +   +P ++  L KQ K K    RQG F+IL E    +P    + I +++   + +L DK+ ++N+K DA+  L  L+S +    F  H   +L  V+  + D FY+++             ++ +   Q I RI  PL                        L+  + D ++KE++I+ M  +   LG+ L    ++  L+IF+ERL NE+ R+  ++   L++ ++  I++   +   I ++  FL KN R L++ TL       TNY   +K +  M+E ++S LP LI ++D+ I+Q  I L         S +  +    ++  +L+L+ SPLL G  L S+V      VL K  ++     +K +T     +   D     + R++Y ++A C+A L ++    ++  G +  F Q   +K++    S + LS + LGE+GRS +L   K +   IM  F+S +E +KSAA+ +LG + +  L+ ++P++L +I   P  QY LLHSL+E+I AL+ +E+LK      H   IW LL +N    EEG RN+VAEC+GKL L++P+ ++P+L++ ++ G        L R+T+VTA+K+TI+    PIDSLL + + +FL  ++DPDL V+R  L+  N+  HNKP +IR LL         ++L  LY  T++R ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLD +++  FL+ +EEGL+D+ +I++L + ML+++A  CP   + + + L+  +R+   +K K  +V QE EK +E +R+A++ +  + +  ++ KS    +  N I  N  +  +F + Q
Sbjct:    3 NITYYISNLLEKMTSTDKDFRFMATNDLMMELQKDSIKLDEDSERKVVTMLLKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETMVDTLCSNMVS-DKEQLRDISSMGLKTVIAELPPASAGLCLTANVCKKITSQLIGAMGKQDDVPV-QLEALDILSDMLGRLGSTLVSFH-QSILTSLLPQLTSPRMAVRKRAIIALGHLVPSCSPALFTQLTEHLMGEMT----RGGATANTRTYIQCLTTVIRQGGHRVGEHLEKIIPLVVKFCSVEDDELRENCFQAFEAFVRRCPKEMSPHIPTVIKLCLKYITHDPNYNYDAEDDQEESMDIGSGDDEETESDDEYSDDDDMSWKVRRSSVKCLEAVISSRRDLLVELYGSVCPTLVSRFKEREENVKSDIFLAFVALVRQTKPPHGSALDPGAKEDPAVTLLKKQVPTVIKALHKQLKEKSMKSRQGCFSILTEMANVLPGALGEHIPNLIPGIVYSLTDKSTSSNMKIDALAFLHVLLSGHTPEVFQPHIKIILPPVITCVEDPFYKIT-------------SEALQVTQQICRIMRPLEKRSSSSFDAKPYVKEVFGSTLKRLKASDIDQEVKERAISCMGYIVSHLGDQLG-GDLQPTLQIFLERLKNEITRLTAVKTLSLIAGSSLKIDLRSILTEGIPILGSFLRKNQRALKLNTLTALNIIVTNYSDCLKPA--MIESVLSELPALIQENDMHISQMAIGLLTCMAKVCPSSL-GKIGAAILPEVLHLVHSPLLQGGALSSIVEFFHALVLTKASNTGYSDLMKALTGPFYKSKSPDSL--SVHRQSYYSVAKCVAALSSSCP--KEASGTVGNFIQE--VKNQKTSESVRILSFLCLGEVGRSTNLGGHKELKTVIMEAFSSPNEEVKSAASCALGNICVGNLEEYLPFLLKEIGAQPKRQYLLLHSLKEVISALS-EESLK-----PHVENIWTLLFKNCECGEEGTRNVVAECLGKLTLVNPALLLPRLKKQLSSGSS------LARSTVVTAVKFTIVDHPVPIDSLLKDSIGDFLKTIQDPDLNVRRVALVMFNSAAHNKPGLIRGLLT--------SVLPKLYNETQIRKELIREVEMGPFKHTVDDGLDVRKAAFECMYTLLDSCLDGLDIFEFLNHVEEGLKDHYDIRMLTFIMLARLASLCPSAVVQRLDRLVEPLRATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLSISDVEKSPVMADFANQIRTNAEMATIFESVQ 1219          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Cavefish
Match: cand1 (cullin associated and neddylation dissociated 1 [Source:NCBI gene;Acc:103043871])

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 426/1255 (33.94%), Postives = 712/1255 (56.73%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTP--LSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLS-------------WKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQT------ILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGP-LKKMFTTEQ 3768
            YHIS L+EKM + DKDFRFMA NDL+S+LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P   S + + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L+    ND      ++ IQCI  +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+YD++++ ++A + D            DED               WKVRR++AKCL+  + T  +++ +F ++  P LI RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA++ L  ++  +    F  H   L+  V+  + D FY+++ E+L +T  L+   + ++          I  ++      L+  + D ++KE++I+ M  + C+LG++L  + +   L IF+ERL NE+ R+  ++A  L++ +   I++   +   + ++  FL KN R L++ TL   +    NY   + +  ++  +++ LPPLI++SD+ ++Q  I+     L R H D  S+    +++ ++ L++SPLL G  L +++   + + +     +  +  L +LT  +         +++Y +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  +DLS +  +   I++ F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+EII + +V      + L  +   +W LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI      ID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML++++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +V + T     KS    E  + I + P L  +F + Q
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMSELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAASVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLCRQGGLLVNFH-PSILNCLLPQLTSPRLAVRKRTIIALGHLVMSCGNLVFVDLIEHLLSELS---RND-SMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNIDDDELREYCIQAFESFVRRCPKEVYPHVPTIINICLKYLTYDPNYNYDDEDEDENAMDADGV----------DEDYQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYRTVSPALIARFKEREENVKADVFHAYLSLLKQTRPAQSWLCDPDAMEQGETPLTMLQSQVPMIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHQPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQTDAFDASPYITDLFACTIKRLKAADIDQEVKERAISCMGQIICNLGDSLG-TDLPGTLHIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPILGEAVPILASFLRKNQRALKLSTLAALDILVKNYSDSV-TPAMIDAVLAELPPLISESDMHVSQMAISFLTT-LARVHPDSLSKISGSILAELIALVRSPLLQGGALSAMLEFFQALVATGTASLGYMDLLRMLTGPVYAQSAALTHKQSYYSIAKCVAAL-TRACPKEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHVDLSGQPELKTVILDAFSSASEEVKSAASYALGSISVGNLPEYLPFVLQEISGQPKRQYLLLHSLKEIISSASV------AGLKPYVESVWALLLKHCECTEEGTRNVVAECLGKLTLIDPETLLPRLKGYLLSGSS------YARSSVVTAVKFTISDHPQAIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLL--------DTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLARLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVVALLTIPEAEKSPLMSEFQSQISSNPELAAIFDSIQ 1216          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Sea Lamprey
Match: cand1 (cullin-associated and neddylation-dissociated 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2872])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 434/1269 (34.20%), Postives = 728/1269 (57.37%), Query Frame = 1
Query:   58 MTSTSFNNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLR---QMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXX--XXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVR--LRNSQDIRPSKQILVL----IPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILR--IYDPLYSI----------LQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLE-IISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKT-ISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIING-PLKKMFTTEQEIAA 3780
            MTS S    YHIS L+EKM + DKDFRFMA NDL+S+LQ DS++LD DSERK+ K +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I++ P + +GV S L   + K +   +  + G       Q+EA DIM +++ RLG  L ++  +SI      QL +PRL+VRKRAI   G L+ V     F+E    ++ +LA     +      ++ IQCI  +++Q   R G H+ +I P++     + ++E+++  +Q FE+ + +C  E+  ++  ++ + LK + +DPNY+YDE  +  M+S   ++ E+   E  YSDD+D+SWKVRR++AKCL+  + T  +++ +F ++  P LI RF EREE VK +IF  FL+LLKQT    R V+  L +   +  S   L +    +P ++  L KQ K K    RQG F +L E    +P   A  + +++   + +L+DK+ ++N+K D +  +  L+  +P   F  H   L+  V+  + D FY+++ E+L +T  L+   + ++ +   ++  ++DP   I          L+  + D ++KE++I  M  + C+LG+ L  +++   L IF+ERL NE+ R+  ++A  L++ +    ++   +   + ++  FL KN R L++ TL   ++   +Y   +  +  M+E ++  LPPLI++ D+ ++Q  +      L R +  V ++    +++ +L L++SPLL G  L +++   +  ++++      +    LLT  +       + ++A+ +IA C+A L       ++      +F Q   +++     + + L+++ LGEIGR +DLS ++ +   ++  F+S  E +KSAA+Y+LG +++  L  ++P++L +I   P  QY LLHSL+E+I +  V      + L  +   IW LL ++    EEG RN+VAEC+GKL L+DP+T++P+L+  +             R+T+VTA+K+TI  +   +DSLL + + +FL  L+D DL V+R  L+  N+  HNKP +IR+LL        D +L  LY  T+VR ELIREVEMGPFKH  DDGLD+RK AFEC+ +LLD CLDR+++  FL+ +E+GL+D+ +IK+L + ML +++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +  + T     KS    E  + I +   L  +F + Q+ AA
Sbjct:    1 MTSVS----YHISNLLEKMTSSDKDFRFMATNDLMSELQKDSIKLDDDSERKVVKMLLKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCSNMLS-DKEQLRDISSIGLKTVISELPPASSGVGSSLAANVCKKITGRLTSAIGKQEDVPVQLEALDIMGDMLSRLGGLLVSFH-QSILACLLPQLTSPRLAVRKRAIIALGHLVMVCSHGLFAELTEHLLAELA----RNESTSTTRTYIQCIAAISRQAGHRVGEHLEKITPLIVKFCKVEDDELREYCIQAFESFVRRCPKEVSPHVPVIIELCLKYLTYDPNYNYDEDDENAMESEGADEEEDQESEDEYSDDDDMSWKVRRAAAKCLDAVLSTRHEMLPEFYRTVSPALIARFKEREENVKADIFHAFLSLLKQT----RPVQGWLNDPDAMDQSDTPLTMLQNQVPNIVKALHKQLKEKSVKTRQGCFNLLTELVNVLPGALADHVPALVPGIVFSLSDKSSSSNMKIDTLAFVHTLLCHHPPEVFHPHVKVLVPAVVGCVGDPFYKITSEALLVTQQLVKVIRPLDPLTRPVKAPVFDPKPYIRDIFTCTQKRLKAADIDQEVKERAIACMGQIICNLGDGLG-AELAATLHIFLERLKNEITRLTTVKALTLVASSPLRPDLRPVLAEGVPILASFLRKNQRALKLATLSALDALIRHYSDSL--TAPMVEAVLQELPPLISEGDMHVSQLAVGFLTT-LARVYPAVLTKVSGAVLNQVLGLVRSPLLQGGALSAVLDFFQALVATRTTSLGYLELLRLLTGPVYAQSTPALHKQAFHSIAKCVAALTVACPQKQEGASVTAQFVQD--VRNPKSSDAVRLLALLALGEIGRHLDLSAQRDLKTVLLEAFSSPSEEVKSAASYALGNVSVGNLQQYLPFVLQEIGSQPKRQYLLLHSLKEVISSAQV------ASLKPYVEDIWALLFKHCECAEEGTRNVVAECLGKLTLIDPATLLPRLKGYLTSASAH------ARSTVVTAVKFTISDQPQAVDSLLKSCIGDFLKTLEDQDLNVRRVSLVTFNSAAHNKPSLIRDLL--------DCILPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDTCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTNKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSSQELTAIFESIQKDAA 1229          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Nematostella
Match: EDO33776 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR99])

HSP 1 Score: 427.943 bits (1099), Expect = 9.516e-132
Identity = 301/947 (31.78%), Postives = 527/947 (55.65%), Query Frame = 1
Query:   79 NPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIA-CQ----------HQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNL--INLNEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYX-XXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQT---ASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXI-------TKAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKS---SGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNH---SDVKSEFYRHLMSPILNLLKSPLLHG--STLQSLVVLMKTISSQEIFDI---KVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREI 2811
            +PYHI++L++KM + DKDFRFMA NDL+++LQ DS++LD DSERK+ + +L+LLED+N EVQN  VKCL  LV K+KE +V  ++  L   M+  + + +  I +IGLKT+I + P + + + + + + I   L   + +S    + Q+EA DI+ +++ R G      +  + +I  CQ          + +  P  S  ++ +A   +LI+      F E +  ++ +L    + +      ++ IQCIG + +Q   R G H+ +I P++     +N ++E+++  +Q FE+ + +C  E+  YI K++ + L+ I +DPNY+Y  E++     + ++++ED ++  YSDD+D+SWKVRR++AKCL   + +  +L+ +  K+  P LI RF EREE VK +IF  ++TLL+QT   A Q+ +  +   +D  P   +   IP ++  L +Q + K    RQG F +L E    +P   ++ I +++     +L+DK+  +N+K D +  L  ++S +    F  H   LL  V+  + D FY+++ E+L +T  L+       T   K N+   +  IY      L+  + D ++KE++I+ M  + C+ G+ L  +++  CL IF++RL NE+ R+  ++A+ L++ +   I++S  +   + ++  FL KN R L++ TL       T+Y  ++ S   SGV+ E+    PPLIN+  L+I    +   N +   N+   S   S F    +  I+ L+KSPLL G    L +++ L+  + +  I  +    +   L+L        +  I ++AY +IA C+A L T +  VE  E  +  F +   I+      S +  S++ LGEIG+ +DLS  K +  AI++ F+S  E +KSAA+++LGK+A   L +++P++L +I+ +P  QY LLHSL+E+
Sbjct:    4 SPYHIASLLDKMTSSDKDFRFMATNDLMAELQKDSIKLDDDSERKVVQMLLKLLEDKNGEVQNLAVKCLGPLVSKVKEYHVETIVDTLCSNMLS-DKEQLRDISSIGLKTVIGELPPASSSLAANICRRITGRLTNAIAKSTDVSV-QLEALDILGDLLSRFGG-----EYGTCYITFCQIIETHSDCFTYMVRTPAFS--RQQLASIHTLITPANAGLFVELMDHLLNEL----QLNTSHSTTRTFIQCIGAICRQAGHRVGEHLERIIPLIVQFSKVNNDDELREYCIQAFESFVCRCPKEVTSYIPKIIDICLEFICYDPNYNYGDENDVEMETDMDEDDEDEDDDEYSDDDDMSWKVRRAAAKCLAAVLGSRHELLSEMYKNVAPALIARFKEREENVKADIFSAYITLLRQTRPVAGQADADAM--DEDGGPLALLQCQIPNVVKALHRQLREKSVKTRQGCFHLLSELVSVLPGALSEHISAIVPGVQFSLSDKSSTSNMKIDTLAFLGSILSQHSPQVFHPHVQVLLPPVVQAVGDPFYKITSEALLVTQQLVKVIRPLGTVCVKFNYKPYVGDIYSCTLMRLKAADIDQEVKERAISCMGQILCTFGDELQ-AELPVCLPIFLDRLRNEITRLTTVKAYTLVAGSPLRIDLSPILSDSMPILASFLRKNQRALKLSTLTALNVLMTSYVSLLSSDDISGVLAEV----PPLINEMYLRIKCVFLRRTNKWSFSNYILISQAASTF----LPAIMVLVKSPLLQGKCGALNAMLTLITELVNSGIKGMTFSSLFEMLVLPIYAPQPGVQMIHKQAYYSIAKCVAAL-TMSCPVEG-EAVVNRFVKD--IQSSKVTDSVRLFSLLSLGEIGKHVDLSNHKDLAAAILDCFSSPSEEIKSAASFALGKIAAGNLQLYLPFLLKEIEASPKKQYLLLHSLKEV 922          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Medaka
Match: cand1 (cullin associated and neddylation dissociated 1 [Source:NCBI gene;Acc:101160035])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 431/1263 (34.13%), Postives = 719/1263 (56.93%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTP--LSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLS-------------WKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDPLYSI----------LQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLE-IISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAA 3780
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ + +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P   S + + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L     ND      ++ IQC   +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  V+ + L+ + +DPNY++D++++ D+A + +           +DED               WKVRR++AKCL+  + T  +++ +F +S  P L+ RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA+  L  ++ T+P   F  H   L+  V+  + D FY+++ E+L +T  LI   + +++       +DP   I          L+  + D ++KE++I+ M  + C+LG+ L P+++   L IF+ERL NE+ R+  ++A  +++ +   I++   +P  I ++  FL KN R L++ TL   +    NY   +  + VM++ +++ LPPLI++SD+ ++Q  ++  +     + S +       ++  ++ L++SPLL G  L +++   + + +     +  +  L +LT  +         ++AY +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  +DLS +  +   I++ F+S  E +KSAA+Y+LG +A+  L  ++P++L +I  +   QY LLHSL+EII + +V      S L  +   +W+LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI  +  PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IRELL        D+ L+ LY  T+VR ELIREVEMGPFKH  DDGLDLRK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+L + ML++++  CP   L + + L+  +R+   +K K ++V QE EK DE KR+A++ +V + T     KS    E  + I         ++ QE+AA
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVRMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAASVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLCRQGGLLVNFH-PSILSCLLPQLTSPRLAVRKRTIMALGHLVMSCGNLVFIDLIEHLLTELG---RND-NMSTTRTYIQCTAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVPTVISICLRYLTYDPNYNFDDEDEDDNAMDAE----------QNDEDYQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYRSVSPALVSRFKEREENVKADVFHAYLSLLKQTRPAQSWLTDPDAMEQGETPLTMLQSQVPMIVKALHKQLKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLIPGIIFSLNDKSSSSNLKIDALACLHVIMVTHPAHAFHAHVPALVPPVVACVGDPFYKITSEALLVTQQLIKVIRPLDNQPEGSDSFDPSPYINDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDRL-PAELPGTLLIFLERLKNEITRLTTVKALTMIAGSPLKIDLRPILPDAIPILASFLRKNQRALKLCTLAALDILLRNYSSAV--TPVMVDAVLAELPPLISESDMHVSQMALSFLSTLAVTHPSSLGQLTGGSILPQLIALVRSPLLQGGALAAMLDFYQALVATNTPGLGYMDLLRMLTGPVYSQSAALPHKQAYCSIAKCVAAL-TRACPAEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHVDLSGQPELKTVILDAFSSSSEEVKSAASYALGSIAVGNLPEYLPFVLQEISSS-KRQYLLLHSLKEIISSASV------SGLKPYVESVWSLLLKHCECQEEGTRNVVAECLGKLTLIDPETLLPRLKGYLLSGSS------YARSSVVTAVKFTISDQPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRELL--------DSTLTHLYNETKVRKELIREVEMGPFKHTVDDGLDLRKAAFECMYTLLDSCLDRLDIFTFLNHVEDGLKDHYDIKMLTFLMLARLSSLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVVALLTIPEAEKSPLMSEFQSQI---------SSNQELAA 1214          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Medaka
Match: cand2 (cullin-associated NEDD8-dissociated protein 1-like [Source:NCBI gene;Acc:101161115])

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 421/1247 (33.76%), Postives = 710/1247 (56.94%), Query Frame = 1
Query:   76 NNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVI--SILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDED--LSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS----QDIRPSKQILVL----IPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDP------LYSI----LQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTI---SSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAK--SVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSI 3729
            N  YHIS L+EKM + DKDFRFMA NDL+ +LQ DS++LD DSER++   +L+LLED+N EVQN  VKCL+ LV K+KEP V  ++  L   M+  + + +  I ++GLK +IT+ PLS +G+   + + K I   LI  + + +   L Q+EA DI+ +++ RL   L      S+  +   QL +PR++VRKR+I   G L+    P  FS+    +M +LA      +     ++ IQC+  ++++   R G H+ ++ P++    ++ ++E+++   Q FEA I +C  EM  ++  V  +  K + +DPNY+YD  E+ +    +  + D+EE      +D  +SWKVRRS+ KCLE  I T  DL+  F  +  P L+ RF EREE V+ ++F  F TLL+Q+   S    L  +      +R  + ++ L    +P ++  L +Q K K    RQG F +L E    VP    + I +++   L +L DK+ ++N+K DA+  L  L+ ++P   F  H   LL  VL  + D+FY++  E+L +T  L+   +      T  R +DP      ++S+    L+  + D ++KE++I+ M +L C LG++L  ++++  L IF+ERL NE+ R++ +R   L++ ++  I++S  +   + ++  FL KN R L++ TL C  +  T++   IK +  +  +++ LPPL+++SD+  +Q +IAL    +++      ++    ++  I  L+ SPLL G  L +++  ++++    +  +   +++  L+            + R++Y + A C+A L++ +   S     G I++      +K+     S + L+++ LGE+GRS  L   K V   I+  F+S  E +K+AA+ +LG MA+  L  ++P++L +I   P  QY LLHSL+++I A           L+ H   IW+LL ++    EEG RN+VAEC+GKL L+DP+ ++P+L++ +  G       P+ R T+VTA+K+TI+    PID+LL + + +FL  L+D D+ V+R  L+  N+  HNKP +IR LL         ++L  LY  T++R +LIREVEMGPFKH  DDGLD+RK AFEC+ +LLD+CLD ++V  FLD +EEGL+D+ +I++L + ML+++A   P   L + + L+  +++   +K K  +V QE EK +E +R+A++ +  +     + +S    +  N I
Sbjct:    3 NVSYHISNLLEKMTSTDKDFRFMATNDLMLELQKDSIKLDEDSERRVVAMLLKLLEDKNGEVQNLAVKCLAPLVSKVKEPQVEAMVESLCSNMMS-DKEQLRDISSMGLKAVITELPLSSSGLTLTASVSKMITSQLIGALGKQEDVAL-QLEALDILSDMLGRLSGAL-VSFHGSLLSSLLPQLTSPRMAVRKRSIMALGHLVPCCSPALFSQLTEHLMTELAKGPPTSVA----RTYIQCLATISREGGHRVGEHLQKVIPMVVKFTSVEDDELREHCFQAFEAFIRRCPKEMSPHVATVTQLCFKFMTYDPNYNYDGSEEEEDESMDVEDGDDEESDDEYSDDDDMSWKVRRSAVKCLEALISTRLDLLLSFYSTICPALLARFKEREENVRADVFAAFSTLLRQSRVGSSHPGLIATDAVRSGVREEEPVVTLLKKQVPGIVKVLHRQLKDKSIKSRQGCFGLLSELAHTVPGALEEHIPALVPGILFSLTDKSASSNMKIDALCFLHVLLISHPPQAFQPHMQVLLPAVLACVEDTFYKIMSEALLVTQQLLRVMRPQGQTSTPGR-FDPKPFIREVFSVTMKRLKATDIDQEVKERAISCMGHLVCHLGDHLG-AELQGVLAIFLERLKNEITRLSAVRTLSLIAASSLKIDLSSILDETLSVLASFLRKNQRALKLSTLACLTALVTHHAASIKPAA-LEAMLNELPPLVDESDMHTSQVSIALLTC-MSKACPSSLAKISSSVLPGIFRLIHSPLLQGGALAAILDFLQSLVLSKASSLGYGQLMKALMEPFQNPPPESSALHRQSYISAARCVAALVSASPKDSPATVAGLIQQ------VKNPGSPESARVLALLSLGEVGRSGSLGGCKEVQGVILEAFSSTSEEVKTAASCALGGMAVGSLSDYLPFVLKEISAQPRRQYLLLHSLKDVISASPA------CSLSPHVESIWSLLFQHCECQEEGSRNLVAECLGKLTLVDPAVLLPRLKQQLRAGS------PVVRGTVVTAVKFTIVDHPAPIDALLRDCMGDFLKSLQDDDITVRRVALVMFNSAAHNKPSLIRGLLG--------SVLPHLYRETQIRKDLIREVEMGPFKHRVDDGLDVRKAAFECMYTLLDSCLDGLDVLQFLDHVEEGLKDHYDIRMLTFLMLARLASLSPAAVLQRLDRLVEPLKATCTTKVKAGSVKQEFEKQEELRRSAMRAVAALLAVPEVERSPIMADFANQI 1212          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Medaka
Match: cand1 (cullin associated and neddylation dissociated 1 [Source:NCBI gene;Acc:101160035])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 401/1165 (34.42%), Postives = 667/1165 (57.25%), Query Frame = 1
Query:   85 YHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTP--LSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPA-RTGAHIHQIYPVLQNLINL-NEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLS-------------WKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNS--QDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDPLYSI----------LQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLE-IISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTL-LLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKL 3486
            YHIS L+EKM + DKDFRFMA NDL+++LQ DS++LD DSERK+ + +L+LLED+N EVQN  VKCL  LV K+KE  V  ++  L   M+  + + +  I +IGLKT+I + P   S + + + + K+I   L   + + +   + Q+EA DIM +++ R G  L  +   SI      QL +PRL+VRKR I   G L+   G   F + I  ++ +L     ND      ++ IQC   +++Q   R G ++ +I P++    N+ ++E+++  +Q FE+ + +C  E+  ++  V+ + L+ + +DPNY++D++++ D+A + +           +DED               WKVRR++AKCL+  + T  +++ +F +S  P L+ RF EREE VK ++F  +L+LLKQT      +   ++  Q   P   +   +P ++  L KQ K K    RQ  F +L E    +P    Q I  ++   + +LNDK+ ++NLK DA+  L  ++ T+P   F  H   L+  V+  + D FY+++ E+L +T  LI   + +++       +DP   I          L+  + D ++KE++I+ M  + C+LG+ L P+++   L IF+ERL NE+ R+  ++A  +++ +   I++   +P  I ++  FL KN R L++ TL   +    NY   +  + VM++ +++ LPPLI++SD+ ++Q  ++  +     + S +       ++  ++ L++SPLL G  L +++   + + +     +  +  L +LT  +         ++AY +IA C+A L T A   E     + +F Q   +K+     S + L+++ LGE+G  +DLS +  +   I++ F+S  E +KSAA+Y+LG +A+  L  ++P++L +I  +   QY LLHSL+EII + +V      S L  +   +W+LLL++    EEG RN+VAEC+GKL L+DP T++P+L+  +  G          R+++VTA+K+TI  +  PID LL N + +FL  L+DPDL V+R  L+  N+  HNKP +IRELL        D+ L+ LY  T+VR ELIREVEMGPFKH  DDGLDLRK AFEC+ +LLD+CLDR+++  FL+ +E+GL+D+ +IK+
Sbjct:    6 YHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVRMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLS-DKEQLRDISSIGLKTVIGELPPASSGSALAASVCKKITGRLTSAIAKQEDVSV-QLEALDIMADMLCRQGGLLVNFH-PSILSCLLPQLTSPRLAVRKRTIMALGHLVMSCGNLVFIDLIEHLLTELG---RND-NMSTTRTYIQCTAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVPTVISICLRYLTYDPNYNFDDEDEDDNAMDAE----------QNDEDYQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYRSVSPALVSRFKEREENVKADVFHAYLSLLKQTRPAQSWLTDPDAMEQGETPLTMLQSQVPMIVKALHKQLKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLIPGIIFSLNDKSSSSNLKIDALACLHVIMVTHPAHAFHAHVPALVPPVVACVGDPFYKITSEALLVTQQLIKVIRPLDNQPEGSDSFDPSPYINDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDRL-PAELPGTLLIFLERLKNEITRLTTVKALTMIAGSPLKIDLRPILPDAIPILASFLRKNQRALKLCTLAALDILLRNYSSAV--TPVMVDAVLAELPPLISESDMHVSQMALSFLSTLAVTHPSSLGQLTGGSILPQLIALVRSPLLQGGALAAMLDFYQALVATNTPGLGYMDLLRMLTGPVYSQSAALPHKQAYCSIAKCVAAL-TRACPAEG-PAVVGQFIQD--VKNSRSTDSIRLLALLSLGEVGHHVDLSGQPELKTVILDAFSSSSEEVKSAASYALGSIAVGNLPEYLPFVLQEISSS-KRQYLLLHSLKEIISSASV------SGLKPYVESVWSLLLKHCECQEEGTRNVVAECLGKLTLIDPETLLPRLKGYLLSGSS------YARSSVVTAVKFTISDQPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRELL--------DSTLTHLYNETKVRKELIREVEMGPFKHTVDDGLDLRKAAFECMYTLLDSCLDRLDIFTFLNHVEDGLKDHYDIKV 1125          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Planmine SMEST
Match: SMESG000042515.1 (SMESG000042515.1)

HSP 1 Score: 2424.82 bits (6283), Expect = 0.000e+0
Identity = 1228/1228 (100.00%), Postives = 1228/1228 (100.00%), Query Frame = 1
Query:  112 MNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF 3795
            MNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYDEDEDMDSAEEEDNEEDNEEFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRLSLESLDLTLLLITKAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF
Sbjct:    1 MNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYDEDEDMDSAEEEDNEEDNEEFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRLSLESLDLTLLLITKAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF 1228          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Planmine SMEST
Match: SMESG000042515.1 (SMESG000042515.1)

HSP 1 Score: 2420.19 bits (6271), Expect = 0.000e+0
Identity = 1228/1229 (99.92%), Postives = 1228/1229 (99.92%), Query Frame = 1
Query:  112 MNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYXXXXXXXXXXXXXXXXXXXXFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRXXXXXXXXXXXXITKAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYE-QVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF 3795
            MNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYDEDEDMDSAEEEDNEEDNEEFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRLSLESLDLTLLLITKAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYE QVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF
Sbjct:    1 MNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGLYIEKVVPMLLKLIVHDPNYHYDEDEDMDSAEEEDNEEDNEEFLYSDDEDLSWKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQCFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKICVIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAVNLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRLSLESLDLTLLLITKAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNLTPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIKMMTPFLLKNDRQLRIETLKCFESFWTNYEEQVIKSSGVMLEIISVLPPLINDSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGSTLQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASCIAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRSIDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQIQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNSPEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIVTAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHNKPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDGLDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLSKIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIKFLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF 1229          
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Planmine SMEST
Match: SMESG000049002.1 (SMESG000049002.1)

HSP 1 Score: 429.869 bits (1104), Expect = 7.714e-141
Identity = 224/281 (79.72%), Postives = 232/281 (82.56%), Query Frame = 1
Query:  112 MNNLDKDFRFMAINDLISDLQNDSLRLDSDSERKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMIQLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDGGGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRAIACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVLTKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGL 954
            MNNLDKD  FM INDLIS+LQNDSLRLD+++ERKLTKEVLRLLE QNLEVQNQT KCLSYLVR+IKEPNVVNVIRDLTI M Q NNDNMC ICAIGLK IITDT LSENGVI ILIKEIPKPLIE MDQ DGG LRQMEAFDIM EV                     HQLFN RLSVR+RAIACFGSL SVTG D FSEFISFIMGKLAYLKEN LKQEDLKSLIQCIGVLTKQP RT  H+HQIY VLQNLINLNEEIQDL L+TFE LISKCSSEM L
Sbjct:    1 MNNLDKDLIFMVINDLISNLQNDSLRLDNNNERKLTKEVLRLLEYQNLEVQNQTAKCLSYLVRRIKEPNVVNVIRDLTINMTQFNNDNMCEICAIGLKIIITDTILSENGVIFILIKEIPKPLIEFMDQPDGGELRQMEAFDIMGEV--------------------NHQLFNSRLSVRERAIACFGSLNSVTGSDSFSEFISFIMGKLAYLKENYLKQEDLKSLIQCIGVLTKQPVRTEVHVHQIYFVLQNLINLNEEIQDLFLKTFEPLISKCSSEMFL 261          
The following BLAST results are available for this feature:
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAND10.000e+034.75cullin associated and neddylation dissociated 1 [S... [more]
CAND20.000e+032.58cullin associated and neddylation dissociated 2 (p... [more]
CAND24.615e-14029.95cullin associated and neddylation dissociated 2 (p... [more]
CAND11.136e-11334.79cullin associated and neddylation dissociated 1 [S... [more]
CAND16.170e-4832.65cullin associated and neddylation dissociated 1 [S... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cand-12.933e-14027.91Cullin-associated NEDD8-dissociated protein 1 [So... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cand10.000e+031.62gene:FBgn0027568 transcript:FBtr0080054[more]
Cand10.000e+031.62gene:FBgn0027568 transcript:FBtr0332198[more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cand10.000e+033.86cullin-associated and neddylation-dissociated 1 [S... [more]
cand20.000e+034.29cullin-associated and neddylation-dissociated 2 (p... [more]
cand20.000e+033.81cullin-associated and neddylation-dissociated 2 (p... [more]
cand20.000e+033.68cullin-associated and neddylation-dissociated 2 (p... [more]
cand20.000e+033.09cullin-associated and neddylation-dissociated 2 (p... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nodal50.000e+034.99nodal homolog 5 [Source:Xenbase;Acc:XB-GENE-483267... [more]
nodal50.000e+034.99nodal homolog 5 [Source:Xenbase;Acc:XB-GENE-483267... [more]
tmed70.000e+034.29transmembrane p24 trafficking protein 7 [Source:Xe... [more]
tmed70.000e+034.38transmembrane p24 trafficking protein 7 [Source:Xe... [more]
nodal50.000e+034.50nodal homolog 5 [Source:Xenbase;Acc:XB-GENE-483267... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cand10.000e+034.83cullin associated and neddylation disassociated 1 ... [more]
Cand20.000e+032.67cullin-associated and neddylation-dissociated 2 (p... [more]
Cand14.222e-3438.67cullin associated and neddylation disassociated 1 ... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R6L5|CAND1_PONAB0.000e+034.43Cullin-associated NEDD8-dissociated protein 1 OS=P... [more]
sp|Q6ZQ38|CAND1_MOUSE0.000e+034.83Cullin-associated NEDD8-dissociated protein 1 OS=M... [more]
sp|P97536|CAND1_RAT0.000e+034.75Cullin-associated NEDD8-dissociated protein 1 OS=R... [more]
sp|Q86VP6|CAND1_HUMAN0.000e+034.75Cullin-associated NEDD8-dissociated protein 1 OS=H... [more]
sp|A7MBJ5|CAND1_BOVIN0.000e+034.75Cullin-associated NEDD8-dissociated protein 1 OS=B... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M4AY560.000e+034.91TIP120 domain-containing protein OS=Xiphophorus ma... [more]
A0A3B5MBN10.000e+034.96TIP120 domain-containing protein OS=Xiphophorus co... [more]
A0A3B5PX040.000e+034.70TIP120 domain-containing protein OS=Xiphophorus ma... [more]
A0A2C9JF100.000e+035.68TIP120 domain-containing protein OS=Biomphalaria g... [more]
A0A3B3VP650.000e+034.94TIP120 domain-containing protein OS=Poecilia latip... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cand20.000e+034.65cullin-associated NEDD8-dissociated protein 1 [Sou... [more]
cand10.000e+033.94cullin associated and neddylation dissociated 1 [S... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cand10.000e+034.20cullin-associated and neddylation-dissociated 1 [S... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO337769.516e-13231.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cand10.000e+034.13cullin associated and neddylation dissociated 1 [S... [more]
cand20.000e+033.76cullin-associated NEDD8-dissociated protein 1-like... [more]
cand10.000e+034.42cullin associated and neddylation dissociated 1 [S... [more]
back to top
BLAST of Cullin-associated NEDD8-dissociated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042515.10.000e+0100.00SMESG000042515.1[more]
SMESG000042515.10.000e+099.92SMESG000042515.1[more]
SMESG000049002.17.714e-14179.72SMESG000049002.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025459 ID=SMED30025459|Name=Cullin-associated NEDD8-dissociated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3949bp
CTTTGCGAAAATTTGAAAATTTTGACACCATTGAAACACCATTGAAAATA
TTTTACAATGACATCTACGTCTTTTAATAATCCTTATCATATTTCAACAT
TAATCGAAAAAATGAACAATTTGGATAAAGATTTTCGATTTATGGCTATA
AATGATCTAATTTCGGATTTGCAAAATGATTCTCTAAGATTGGACAGTGA
TAGTGAAAGAAAGTTAACTAAAGAAGTTCTACGACTTTTAGAAGATCAAA
ATTTAGAAGTACAAAATCAAACTGTCAAATGTTTATCGTATTTAGTTCGC
AAAATCAAAGAACCGAATGTTGTAAATGTAATTCGAGATTTAACTATAAA
AATGATTCAGTTAAATAATGATAATATGTGCGGAATTTGTGCAATAGGTC
TTAAAACAATTATTACCGATACTCCATTATCGGAAAATGGCGTAATATCT
ATATTAATAAAAGAAATACCAAAGCCATTAATTGAATTGATGGATCAATC
TGATGGTGGTGGATTACGACAAATGGAAGCTTTTGACATTATGTGCGAAG
TCATTGTTAGATTAGGTATGCGATTACCTGCATATGATTTAAAATCTATA
TTCATTGCTTGTCAGCATCAATTGTTTAATCCAAGACTGTCAGTTAGAAA
AAGAGCTATAGCCTGTTTTGGTTCTTTAATTAGTGTTACTGGACCGGATT
TTTTCAGTGAATTTATATCTTTCATCATGGGGAAATTGGCTTATCTCAAA
GAAAATGATCTAAAGCAAGAAGATTTGAAGTCTTTAATTCAATGTATTGG
TGTTCTCACAAAACAACCTGCTAGAACAGGAGCTCATATACATCAAATAT
ATCCGGTTTTGCAGAATTTGATAAATCTGAACGAAGAAATACAAGATCTA
GTTCTTCAGACCTTTGAAGCACTGATAAGTAAATGTAGTTCTGAAATGGG
ATTATATATTGAAAAAGTGGTCCCCATGCTGCTCAAATTAATTGTACATG
ATCCAAATTATCATTACGATGAAGATGAAGATATGGATTCAGCAGAAGAG
GAAGATAATGAAGAAGACAATGAAGAATTTTTGTACAGTGATGATGAAGA
TTTGTCGTGGAAAGTTCGAAGATCATCAGCTAAATGCTTGGAAACTTGTA
TATTGACATATCCAGATTTAATAAGAGATTTCATCAAATCAGCAGGGCCT
GTATTGATCGAGAGATTCAATGAACGAGAAGAAACCGTGAAACGTGAAAT
ATTTCAATGTTTCCTGACATTATTAAAACAAACTGCTAGTCAGTCACGAT
CAGTGAGATTGCGAAATTCTCAAGATATAAGACCTTCAAAACAAATTCTT
GTTTTGATTCCTCAAATGCTCGATAAATTACGCAAGCAAAACAAATCGAA
AATTTGCGTTATCAGACAAGGAATATTTGCGATATTAAAAGAAGCAACAA
TCGGTGTGCCAAATTGCTTCGCTCAGTCAATAGGAAGTGTAATGAATATT
GCTCTAACTACTCTCAACGATAAAACAGTGAATGCCAATTTAAAATTCGA
TGCCGTTAATTTACTTGTCGAATTGATTTCTACAAATCCAGATGCTGATT
TTTCTGATCATTTTAATAAACTATTGGAAGTGGTTCTAGTATTCATGAAC
GATTCTTTCTATCGCCTGTCTTTGGAATCTTTAGATCTTACATTATTATT
GATTACAAAAGCGAAAAAAATGAATCATATTCAAACGATTTTAAGAATTT
ATGATCCACTTTATTCAATCCTTCAAACTCAAAACACAGATTTCGATTTA
AAAGAAAAGTCAATAAACACAATGTGTAATCTTTGTTGCTCATTGGGAAA
TAATTTAACCCCTAGCCAAATTGAACAATGTTTACGAATATTTATTGAAC
GTTTGAATAACGAATTAATCAGAATCAATGTTCTTCGGGCATTTATATTA
TTATCAAAAGCGACCGATACAATCAATATTTCTCATTATATACCGACATT
GATTAAAATGATGACACCATTTCTGTTGAAAAACGATCGACAGTTGCGAA
TCGAAACATTAAAGTGTTTCGAATCATTCTGGACAAATTATGAACAAGTA
ATCAAATCGTCTGGTGTGATGCTGGAAATCATCTCTGTTCTACCTCCGCT
GATTAATGATTCCGATTTACAAATTGCTCAAAACACTATTGCGTTATGTA
ACATGTTTCTCACCAGAAATCACTCTGATGTCAAGTCAGAATTCTATCGG
CATTTAATGTCACCAATATTGAATCTATTGAAATCGCCTTTGTTGCACGG
ATCCACTCTGCAGTCATTAGTAGTTCTCATGAAGACAATCAGCAGCCAGG
AAATATTTGATATTAAAGTTATAACGACTCTGTTGTTGACAAATATCATA
AGTGATCATCGTATTGATTGTATCAGCAGAGAAGCATATCCTAATATAGC
CAGTTGCATTGCAGAATTAATTACGAATGCTAAATCTGTTGAGAAATGTG
AAGGATATATCGAAGAATTTTATCAAACTTCATTGATTAAACATAAATCA
GACTGCTCAAGCTATCAATATCTTTCAATAATGATTCTTGGTGAAATAGG
TAGATCGATTGATTTATCTCAGCGAAAATACGTGATTGACGCCATAATGA
ATGTATTCAATTCGGGACACGAAACATTAAAATCGGCAGCTGCATATAGC
CTTGGTAAGATGGCGCTCTGCAGATTAGACATATTTATTCCATACATTCT
CAATCAAATACAGCAAAATCCAAATTACCAATACTTCCTATTGCACTCTT
TACGCGAAATTATTGTCGCATTGGCTGTCGATGAAAATTTGAAATATTCT
GATCTAGCCAGTCATTTTAATATCATTTGGAATTTGCTCCTGGAAAATAG
CAATTCTCCCGAGGAAGGTATTCGTAATATTGTTGCCGAATGCATTGGAA
AGTTAGCTTTAATGGATCCATCTACTATCGTACCAAAGCTAAGAGAGATT
GTTGCTGGTGGAGATGGAAAATATTTGGGATTTCCATTGTGTAGAGCAAC
AATTGTTACAGCAATCAAATACACTATTATCTCGGAAATGCATCCTATTG
ATTCTTTACTAAGCAACTATGTGAATGAGTTCCTTATCTGTCTTAAAGAT
CCAGATTTAGGAGTCCAAAGAGCTGGATTAATAGCAATGAATACTATTGT
CCACAACAAACCAGAAATAATTAGAGAGTTGCTTAATCCAGCAGCAGATA
TTAATAGTGATAATCTACTGAGCTGGCTTTATGCTTCTACAAGAGTGCGG
CCGGAGTTAATAAGGGAAGTTGAAATGGGCCCATTTAAACATCTCGAAGA
CGATGGGCTCGATTTGAGAAAATGTGCATTTGAGTGCATTTCAAGTCTGT
TAGATAATTGCTTGGATAGGATCAATGTTTCCATATTTCTCGATCGCATT
GAAGAAGGTTTACGAGATAATAGTGAAATTAAACTTTTATGTTATCCAAT
GCTGTCAAAAATTGCTAAGCATTGCCCAGGAAAATTTCTTGACAAATTCA
ATAATTTAATTCCCGCAATTCGCTCCTTGTTAATATCTAAATCCAAGCAA
GATGCTGTGATGCAGGAACAAGAAAAACTGGATGAACAAAAGCGAGCGGC
AATAAAATTCTTAGTCTATATTTCAACCAATGATAATCTAAACAAATCAA
AACCCTTCATAGAGCTAATGAATTCCATTATTAATGGGCCACTGAAGAAA
ATGTTTACAACCGAGCAAGAAATTGCTGCTCAAAAACAAAGATTTTGATT
TTACAACAATGTCCACGTGTACAATTTTTACCCTTTGATTTTCATATTTT
ATAATGATTGTAAGAGTTTGCAAGGCTTGAATATCGAATCAAGGATGTAT
CAAATTGGAGTTCAATGTGTTTAATAATTAAAATGATATTAGTCTCGAA
back to top

protein sequence of SMED30025459-orf-1

>SMED30025459-orf-1 ID=SMED30025459-orf-1|Name=SMED30025459-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1247bp
MTSTSFNNPYHISTLIEKMNNLDKDFRFMAINDLISDLQNDSLRLDSDSE
RKLTKEVLRLLEDQNLEVQNQTVKCLSYLVRKIKEPNVVNVIRDLTIKMI
QLNNDNMCGICAIGLKTIITDTPLSENGVISILIKEIPKPLIELMDQSDG
GGLRQMEAFDIMCEVIVRLGMRLPAYDLKSIFIACQHQLFNPRLSVRKRA
IACFGSLISVTGPDFFSEFISFIMGKLAYLKENDLKQEDLKSLIQCIGVL
TKQPARTGAHIHQIYPVLQNLINLNEEIQDLVLQTFEALISKCSSEMGLY
IEKVVPMLLKLIVHDPNYHYDEDEDMDSAEEEDNEEDNEEFLYSDDEDLS
WKVRRSSAKCLETCILTYPDLIRDFIKSAGPVLIERFNEREETVKREIFQ
CFLTLLKQTASQSRSVRLRNSQDIRPSKQILVLIPQMLDKLRKQNKSKIC
VIRQGIFAILKEATIGVPNCFAQSIGSVMNIALTTLNDKTVNANLKFDAV
NLLVELISTNPDADFSDHFNKLLEVVLVFMNDSFYRLSLESLDLTLLLIT
KAKKMNHIQTILRIYDPLYSILQTQNTDFDLKEKSINTMCNLCCSLGNNL
TPSQIEQCLRIFIERLNNELIRINVLRAFILLSKATDTINISHYIPTLIK
MMTPFLLKNDRQLRIETLKCFESFWTNYEQVIKSSGVMLEIISVLPPLIN
DSDLQIAQNTIALCNMFLTRNHSDVKSEFYRHLMSPILNLLKSPLLHGST
LQSLVVLMKTISSQEIFDIKVITTLLLTNIISDHRIDCISREAYPNIASC
IAELITNAKSVEKCEGYIEEFYQTSLIKHKSDCSSYQYLSIMILGEIGRS
IDLSQRKYVIDAIMNVFNSGHETLKSAAAYSLGKMALCRLDIFIPYILNQ
IQQNPNYQYFLLHSLREIIVALAVDENLKYSDLASHFNIIWNLLLENSNS
PEEGIRNIVAECIGKLALMDPSTIVPKLREIVAGGDGKYLGFPLCRATIV
TAIKYTIISEMHPIDSLLSNYVNEFLICLKDPDLGVQRAGLIAMNTIVHN
KPEIIRELLNPAADINSDNLLSWLYASTRVRPELIREVEMGPFKHLEDDG
LDLRKCAFECISSLLDNCLDRINVSIFLDRIEEGLRDNSEIKLLCYPMLS
KIAKHCPGKFLDKFNNLIPAIRSLLISKSKQDAVMQEQEKLDEQKRAAIK
FLVYISTNDNLNKSKPFIELMNSIINGPLKKMFTTEQEIAAQKQRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR039852CAND1/CAND2
IPR011989ARM-like
IPR013932TATA-bd_TIP120
IPR016024ARM-type_fold
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0005515protein binding
GO:0017025TBP-class protein binding
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0016020membrane
GO:0031461cullin-RING ubiquitin ligase complex
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0010265SCF complex assembly
GO:0016567protein ubiquitination
GO:0030154cell differentiation
GO:0043086negative regulation of catalytic activity
GO:0045893positive regulation of transcription, DNA-templated
GO:0045899positive regulation of RNA polymerase II transcriptional preinitiation complex assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013932TATA-binding protein interacting (TIP20)PFAMPF08623TIP120coord: 1067..1210
e-value: 5.6E-47
score: 159.6
IPR039852Cullin-associated NEDD8-dissociated protein 1/2PANTHERPTHR12696TIP120coord: 9..1226
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 10..1224