Translationally controlled tumor protein

Overview
NameTranslationally controlled tumor protein
Smed IDSMED30025427
Uniprot Best hitTranslationally-controlled tumor protein homolog OS=Schistosoma japonicum OX=6182 GN=TCTP PE=2 SV=1 (E=7.06289e-57)
Length (bp)570
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Translationally controlled tumor protein (SMED30025427) t-SNE clustered cells

Violin plots show distribution of expression levels for Translationally controlled tumor protein (SMED30025427) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Translationally controlled tumor protein ( tct-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the embryonic digestive system, embryonic pharynx, primitive ectoderm cell, primitive ectoderm and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30025427

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
embryonic pharynxSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
primitive ectodermSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
primitive ectodermSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30025427SMESG000013566.1 SMED30025427smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Translationally controlled tumor protein vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 143.28 bits (360), Expect = 4.854e-43
Identity = 73/172 (42.44%), Postives = 104/172 (60.47%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DE+ SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 143.28 bits (360), Expect = 6.683e-43
Identity = 73/172 (42.44%), Postives = 104/172 (60.47%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DE+ SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 142.895 bits (359), Expect = 1.282e-42
Identity = 73/172 (42.44%), Postives = 104/172 (60.47%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DE+ SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 127.872 bits (320), Expect = 2.853e-37
Identity = 65/150 (43.33%), Postives = 88/150 (58.67%), Query Frame = 1
Query:   94 IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:   11 IADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 160          
BLAST of Translationally controlled tumor protein vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 124.02 bits (310), Expect = 6.060e-36
Identity = 60/130 (46.15%), Postives = 79/130 (60.77%), Query Frame = 1
Query:  151 ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    9 IDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 138          
BLAST of Translationally controlled tumor protein vs. Ensembl Celegans
Match: tct-1 (Translationally-controlled tumor protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93573])

HSP 1 Score: 112.464 bits (280), Expect = 2.239e-31
Identity = 69/182 (37.91%), Postives = 105/182 (57.69%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSD-ETAIDIVYSNRLVEMSF--DKKGYTSYIKGYMKSILERLNATNKERAEI--FKSKVGAYVTKIIK--NFDEYRFYCGESM---NPDGMIIPCNYREDQIT--PYFVLFKDGLEEEKC 540
            MLIYKDI   DEL SD+FPM +VDD+VYEF G+++  K G    L G N S E   +DD +D   E  IDIV +++LVEM+   D   + +YIK +MK++++ +   N+++A++  FK K+  +V  ++    F    F+ GE       +G +    YR+   T  P  +L K+ + EEKC
Sbjct:    1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEG-EIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKC 181          
BLAST of Translationally controlled tumor protein vs. Ensembl Fly
Match: Tctp (gene:FBgn0037874 transcript:FBtr0347181)

HSP 1 Score: 131.724 bits (330), Expect = 5.892e-39
Identity = 77/175 (44.00%), Postives = 110/175 (62.86%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVE-MSF-DKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYRE---DQITPYFVLFKDGLEEEKC 540
            M IYKDI+ GDE+ +DT+ M +VDDV+YE  G+ IT + G    L G NAS E A D+    + E+ +D+V ++RL E  +F DKK YT Y+K YMK +L +L   + ++ +IFK+ +   +  I+  F E +F+ GESM+ DGM+    YRE   D + P  + FK GLEEEKC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLIT-RQGDDIKLEGANASAEEA-DEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSV-PVLMFFKHGLEEEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Fly
Match: Tctp (gene:FBgn0037874 transcript:FBtr0082344)

HSP 1 Score: 131.724 bits (330), Expect = 5.892e-39
Identity = 77/175 (44.00%), Postives = 110/175 (62.86%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVE-MSF-DKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYRE---DQITPYFVLFKDGLEEEKC 540
            M IYKDI+ GDE+ +DT+ M +VDDV+YE  G+ IT + G    L G NAS E A D+    + E+ +D+V ++RL E  +F DKK YT Y+K YMK +L +L   + ++ +IFK+ +   +  I+  F E +F+ GESM+ DGM+    YRE   D + P  + FK GLEEEKC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLIT-RQGDDIKLEGANASAEEA-DEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSV-PVLMFFKHGLEEEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 147.902 bits (372), Expect = 3.628e-45
Identity = 79/172 (45.93%), Postives = 112/172 (65.12%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYKDI+ GDE+ SD + +   ++ ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK++  +L  +   R + F +   A V KI+ N   ++F+ GESMNPDGMI   ++RED +TPY + FKDGLE EKC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 171          
BLAST of Translationally controlled tumor protein vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 130.568 bits (327), Expect = 1.692e-38
Identity = 68/146 (46.58%), Postives = 94/146 (64.38%), Query Frame = 1
Query:  106 VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK++  +L  +   R + F +   A V KI+ N   ++F+ GESMNPDGMI   ++RED +TPY + FKDGLE EKC
Sbjct:   15 MMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 159          
BLAST of Translationally controlled tumor protein vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 76.6406 bits (187), Expect = 4.133e-18
Identity = 45/98 (45.92%), Postives = 65/98 (66.33%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKS 318
            M+IYKDI+ GDE+ SD + +   ++ ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK+
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKA 97          
BLAST of Translationally controlled tumor protein vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 76.6406 bits (187), Expect = 4.133e-18
Identity = 45/98 (45.92%), Postives = 65/98 (66.33%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKS 318
            M+IYKDI+ GDE+ SD + +   ++ ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK+
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKA 97          
BLAST of Translationally controlled tumor protein vs. Ensembl Xenopus
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:493436])

HSP 1 Score: 132.109 bits (331), Expect = 1.022e-38
Identity = 71/172 (41.28%), Postives = 102/172 (59.30%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNIT-IKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYKD V  DE+ SD + +    D + +E  G+ I  ++  I DAL GGNAS E   +D    +  + +DIV +++L E  F K  Y +YIK Y+K +  +L  T+ +R + F   +   V  I+ NF  Y+FY GE MNPDGM+   +YRED +TP+ + FKDGL  EKC
Sbjct:    1 MIIYKDTVTEDEMFSDIYKIAETPDGMCFEVEGKIIQRVEGAIDDALIGGNASAECQEEDIGGATTVSGVDIVINHKLQETGFTKDSYKNYIKDYVKLVKAKLEETDPDRVKPFMKGIQDRVKLILGNFKNYQFYTGERMNPDGMVALLDYREDGVTPFMIFFKDGLISEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Xenopus
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:493436])

HSP 1 Score: 77.0258 bits (188), Expect = 8.224e-18
Identity = 47/133 (35.34%), Postives = 73/133 (54.89%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNIT-IKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYR 423
            M+IYKD V  DE+ SD + +    D + +E  G+ I  ++  I DAL GGNAS E   +D    +  + +DIV +++L E  F K  Y +YIK Y+K +  +L  T+ +R + F   +   V  I+ NF  Y+
Sbjct:    1 MIIYKDTVTEDEMFSDIYKIAETPDGMCFEVEGKIIQRVEGAIDDALIGGNASAECQEEDIGGATTVSGVDIVINHKLQETGFTKDSYKNYIKDYVKLVKAKLEETDPDRVKPFMKGIQDRVKLILGNFKNYQ 133          
BLAST of Translationally controlled tumor protein vs. Ensembl Mouse
Match: Tpt1 (tumor protein, translationally-controlled 1 [Source:MGI Symbol;Acc:MGI:104890])

HSP 1 Score: 142.895 bits (359), Expect = 3.675e-43
Identity = 72/172 (41.86%), Postives = 105/172 (61.05%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DEL SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKS+  +L     ER + F +     +  I+ NF+ Y+F+ GE+MNPDGM+   +YRED +TP+ + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDELFSDIYKIREIADGLCLEVEGKMVSRTEGAIDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Mouse
Match: Tpt1 (tumor protein, translationally-controlled 1 [Source:MGI Symbol;Acc:MGI:104890])

HSP 1 Score: 122.865 bits (307), Expect = 8.895e-36
Identity = 58/130 (44.62%), Postives = 80/130 (61.54%), Query Frame = 1
Query:  151 ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKS+  +L     ER + F +     +  I+ NF+ Y+F+ GE+MNPDGM+   +YRED +TP+ + FKDGLE EKC
Sbjct:    9 IDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 138          
BLAST of Translationally controlled tumor protein vs. UniProt
Match: sp|P91800|TCTP_SCHJA (Translationally-controlled tumor protein homolog OS=Schistosoma japonicum OX=6182 GN=TCTP PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 7.063e-57
Identity = 84/169 (49.70%), Postives = 117/169 (69.23%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            M ++KD ++GDE+ SD+    +++DVVYE +   IT+ NG+   L   N S E  G ++V+DS E  ID+V+++RLV  SFDKK Y +Y+KGY+K+I ERL   N ER  IF+S++  Y+  + KNFD+Y  Y GESMNPDGM+   N+RE+ +TPYFV  KDGL EEK
Sbjct:    1 MRVFKDAISGDEMFSDSHSPQLINDVVYEVDANFITVSNGLDSKLIAANPSGEE-GQEEVSDSTERVIDLVHASRLVSTSFDKKSYRAYLKGYLKAIKERLQKENPERVSIFESRINEYMVNVFKNFDDYEHYIGESMNPDGMVALMNFRENGVTPYFVFLKDGLIEEK 168          
BLAST of Translationally controlled tumor protein vs. UniProt
Match: sp|Q10344|TCTP_SCHPO (Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=p23fy PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 6.139e-49
Identity = 85/169 (50.30%), Postives = 112/169 (66.27%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            ML+YKD+++GDEL SD + +  VDD+VYE + + +T+K G  D   G N S E A ++    + ET  ++VYS RL   SFDKK Y SYIKGYMK+I  RL  +N ER  +F+     +V KI+ NF +Y FY GESM+PD M++  NYRED ITPY + FKDGL  EK
Sbjct:    1 MLLYKDVISGDELVSDAYDLKEVDDIVYEADCQMVTVKQG-GDVDIGANPSAEDAEENAEEGT-ETVNNLVYSFRLSPTSFDKKSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGFVKKILANFKDYDFYIGESMDPDAMVVLMNYREDGITPYMIFFKDGLVSEK 167          
BLAST of Translationally controlled tumor protein vs. UniProt
Match: sp|D0MQ50|TCTP_ALTAL (Translationally-controlled tumor protein homolog OS=Alternaria alternata OX=5599 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 9.578e-49
Identity = 86/172 (50.00%), Postives = 111/172 (64.53%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEI--FKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            MLIYKDI+ GDE+ SD++ +  +D VVYE +   IT+     D   G NAS E   ++   DS ET ID+VYS RL E  FDKKGY +Y+KGYMK++ + L     + A I  F++K   Y  KII NF +Y F+ GESMNPDGMI+  NYRED +TPY  ++K GLEE K 
Sbjct:    1 MLIYKDILTGDEIISDSYNLKEIDGVVYEADCTKITVGGESFDT--GANASAEEQ-EEGAEDSAETKIDVVYSFRLNETGFDKKGYLTYLKGYMKAVKDGLKKKGADEATIKDFETKASGYAKKIISNFKDYEFFTGESMNPDGMIVLLNYREDGVTPYVTVWKHGLEEMKV 169          
BLAST of Translationally controlled tumor protein vs. UniProt
Match: sp|P0CR82|TCTP_CRYNJ (Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNM01460 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 6.268e-46
Identity = 79/169 (46.75%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            MLIY+D++ GDE+ SD FP+  + D+ YE +  NI IK G  D   GGN S E A +     + +   ++V+S RL   SFDKK Y +Y+KGYMK+I  +L  +N +R   F+     +  KI+ NF +Y FY GESMNPDGM+   NYRED +TPYF ++KDGL+E K
Sbjct:    1 MLIYQDVLTGDEMISDAFPIKEIGDIAYEVDCANIIIKEG--DVDIGGNPSAEEAAEALEEGAQQVN-NVVHSFRLQSTSFDKKSYLTYLKGYMKAIKSKLQESNPDRVAAFEKGAQDFAKKIVANFKDYEFYIGESMNPDGMVCLLNYREDGVTPYFTMWKDGLKEIK 166          
BLAST of Translationally controlled tumor protein vs. UniProt
Match: sp|P0CR83|TCTP_CRYNB (Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CNBM1320 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 6.268e-46
Identity = 79/169 (46.75%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            MLIY+D++ GDE+ SD FP+  + D+ YE +  NI IK G  D   GGN S E A +     + +   ++V+S RL   SFDKK Y +Y+KGYMK+I  +L  +N +R   F+     +  KI+ NF +Y FY GESMNPDGM+   NYRED +TPYF ++KDGL+E K
Sbjct:    1 MLIYQDVLTGDEMISDAFPIKEIGDIAYEVDCANIIIKEG--DVDIGGNPSAEEAAEALEEGAQQVN-NVVHSFRLQSTSFDKKSYLTYLKGYMKAIKSKLQESNPDRVAAFEKGAQDFAKKIVANFKDYEFYIGESMNPDGMVCLLNYREDGVTPYFTMWKDGLKEIK 166          
BLAST of Translationally controlled tumor protein vs. TrEMBL
Match: gnl|BL_ORD_ID|24196466 (tr|A0A0D2X0X0|A0A0D2X0X0_CAPO3 Translationally-controlled tumor protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_001218 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 7.521e-59
Identity = 89/171 (52.05%), Postives = 123/171 (71.93%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAA-GDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            MLI+KD+++GDE+ SD+FP  +VDD+ YE +G+ I++K GI D+L GGNAS E    DD  AD  ++ I++VYS++LVE SFDKK YT+YIKGYMK+I   L     ER ++F   +   V KI+ NFD Y+F+ G SMN DG+++  NYRED +TPYF++FKDG+  EK 
Sbjct:    1 MLIFKDVISGDEVASDSFPHKLVDDLYYEVDGKTISVKEGIDDSLIGGNASAEGEDADDGAADGVKSVINVVYSHQLVETSFDKKSYTAYIKGYMKAIKAHLEKNQPERVDVFTKGMPEIVKKILGNFDNYQFFTGASMNVDGLVVLLNYREDGVTPYFIIFKDGVIPEKV 171          
BLAST of Translationally controlled tumor protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18327102 (tr|A0A1I8J4X7|A0A1I8J4X7_9PLAT TCTP domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.541e-55
Identity = 87/181 (48.07%), Postives = 124/181 (68.51%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVT-KIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC*ISVK*I*WN 570
            MLI+KD+++GDEL SD++P   VDD+  E  G+ IT+ N I D + GGNAS E AG+    D  E+ I++VYS++LVE  FDKK Y +Y+KGY+K I ++L   N +R E FK+    +V  +++ NF  ++F+ GE M+PD M++  +YRED +TPYFVLFKDGL EEKC   +  + WN
Sbjct:    1 MLIFKDLISGDELASDSYPYKYVDDIAIEIEGKMITVSNAIDDRMIGGNASAEEAGEG-TDDGTESKINVVYSHQLVETQFDKKSYLAYLKGYLKRIEKKLEENNPDRVEAFKTGAQKFVKERVLANFSNWQFFTGEKMDPDAMVVLMDYREDGMTPYFVLFKDGLIEEKCHTRLASLEWN 180          
BLAST of Translationally controlled tumor protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17585303 (tr|A0A3M7SXZ0|A0A3M7SXZ0_BRAPC Translationally-controlled tumor-like isoform 1 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_007089 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.772e-55
Identity = 85/170 (50.00%), Postives = 121/170 (71.18%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDE-TAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            ML+YKD+++GDEL SD++P+ +VDD+ YE +G+N++  N I +AL GGN + EA  +D+  DS   T I++V + +LVE  FDK  +  ++K YMK + E +   N +R + FKS +  +  +++KN DEYRFY GE M+PDGM+I   YREDQITPYF+ FKDGLEEEK
Sbjct:    1 MLVYKDVISGDELFSDSYPIKLVDDLYYEVDGKNVSYSNDIDEALIGGNKAAEAGEEDEGVDSSAVTGINVVINGKLVETGFDKATFKDWLKTYMKKLSEIVAKNNPDRLDKFKSGMQKFAAQVLKNLDEYRFYTGERMDPDGMVILSGYREDQITPYFIFFKDGLEEEK 170          
BLAST of Translationally controlled tumor protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18310012 (tr|A0A267GJW3|A0A267GJW3_9PLAT TCTP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024683g3 PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 6.943e-55
Identity = 85/171 (49.71%), Postives = 120/171 (70.18%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVT-KIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            MLI+KD+++GDEL SD++P   VDD+  E  G+ IT+ N I D + GGNAS E AG +   D  E+ I++VYS++LVE  FDKK Y +Y+KGY+K I ++L   N +R E FK+    +V  +++ NF  ++F+ GE M+PD M++  +YRED +TPYFVLFKDGL EEKC
Sbjct:    1 MLIFKDLISGDELASDSYPYKYVDDIAIEIEGKMITVSNAIDDRMIGGNASAEEAG-EGTDDGTESKINVVYSHQLVETQFDKKSYLAYLKGYLKRIEKKLEENNPDRVEAFKTGAQKFVKERVLANFSNWQFFTGEKMDPDAMVVLMDYREDGMTPYFVLFKDGLIEEKC 170          
BLAST of Translationally controlled tumor protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15510716 (tr|A0A1X0R2P9|A0A1X0R2P9_RHIZD Translationally controlled tumor-associated OS=Rhizopus microsporus var. microsporus OX=86635 GN=BCV72DRAFT_292077 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.008e-54
Identity = 88/170 (51.76%), Postives = 115/170 (67.65%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            ML+Y DI++GDEL SD FP+T VDD+ YE + + ITI  G  D   G N S E   D+ V ++ +   +++Y++RL E SFDKK Y  YIKGYMK++  +L  TN ER  +F+ KV  +V KI+ NF +Y FY GESMNPDGM+   NYRED +TPYF  FKDGL+ EK 
Sbjct:    1 MLLYTDIISGDELFSDAFPITEVDDIAYEVDCKMITINEG--DIDIGANPSAEGGEDEGVENTAQQVNNVIYTSRLTETSFDKKSYMVYIKGYMKAVKNKLQETNPERVAVFEQKVTPFVKKILANFKDYEFYTGESMNPDGMVALLNYREDGVTPYFTFFKDGLKIEKL 168          
BLAST of Translationally controlled tumor protein vs. Ensembl Cavefish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 144.05 bits (362), Expect = 2.405e-43
Identity = 77/172 (44.77%), Postives = 112/172 (65.12%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYKDI+ GDE+ SD + +   ++ ++ E  G+ I+   G I DAL GGNAS E   D+    +  + +DIV +++L E S+DKK YT+YIK YMK++  +L  T+ +R + F +   A V KI+ N   ++F+ GESMNPDG I   ++RED +TPY + FKDGLE EKC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMIEVEGKMISRAEGDIDDALIGGNASAEVQ-DEGCDSTTVSGVDIVLNHKLTETSYDKKSYTAYIKDYMKAVKAKLQETSPDRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGTIGLLDFREDGVTPYMLFFKDGLEIEKC 171          
BLAST of Translationally controlled tumor protein vs. Ensembl Cavefish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 129.028 bits (323), Expect = 2.194e-37
Identity = 71/167 (42.51%), Postives = 105/167 (62.87%), Query Frame = 1
Query:   46 DIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            +I   DE+ SD + +   ++ ++ E  G+ I+   G I DAL GGNAS E   D+    +  + +DIV +++L E S+DKK YT+YIK YMK++  +L  T+ +R + F +   A V KI+ N   ++F+ GESMNPDG I   ++RED +TPY + FKDGLE EKC
Sbjct:   41 EIHQRDEMFSDIYKIKESENGMMIEVEGKMISRAEGDIDDALIGGNASAEVQ-DEGCDSTTVSGVDIVLNHKLTETSYDKKSYTAYIKDYMKAVKAKLQETSPDRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGTIGLLDFREDGVTPYMLFFKDGLEIEKC 206          
BLAST of Translationally controlled tumor protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009867.1 (pep scaffold:Pmarinus_7.0:GL478379:189408:194610:-1 gene:ENSPMAG00000008896.1 transcript:ENSPMAT00000009867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 4.933e-47
Identity = 77/172 (44.77%), Postives = 108/172 (62.79%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNIT-IKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYKDI+ GDE+ SD + +    D   +E  G  ++ ++  I DA+FGGNAS E    D    S  + +DIV +++L E SF K+ Y +YIK YMK+I E L   + E+ E F +     V  ++K F +++F+ GESMNPDGM+   N+RED ITPY + FKDGLE EKC
Sbjct:    1 MIIYKDILTGDEMFSDIYKIKETADGACFEVEGTMVSRVEGDIDDAVFGGNASAEGGEFDSSESSTVSGVDIVLNHKLQETSFSKEKYIAYIKAYMKTIKENLMEKHPEKVEPFMTAAAKKVKDVLKQFKDFQFFTGESMNPDGMVALLNFREDGITPYMLFFKDGLEIEKC 172          
BLAST of Translationally controlled tumor protein vs. Ensembl Yeast
Match: TMA19 (Protein that associates with ribosomes; homolog of translationally controlled tumor protein; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and relocates to the mitochondrial outer surface upon oxidative stress [Source:SGD;Acc:S000001539])

HSP 1 Score: 143.665 bits (361), Expect = 2.042e-44
Identity = 73/169 (43.20%), Postives = 106/169 (62.72%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            M+IYKDI + DEL SD +   +VDDV+YE +   + +  G  +   G N S E  GDDDV +  E   ++V+S RL + +FDKK + +YIKGYMK++  +L  TN E    F+     YV K+I +F ++ F+ GESM+PD M++  NYRED  TP+  ++K G+ EEK
Sbjct:    1 MIIYKDIFSNDELLSDAYDAKLVDDVIYEADCAMVNV--GGDNIDIGANPSAEG-GDDDVEEGAEMVNNVVHSFRLQQTAFDKKSFLTYIKGYMKAVKAKLQETNPEEVPKFEKGAQTYVKKVIGSFKDWEFFTGESMDPDAMVVMLNYREDGTTPFVAIWKHGIVEEK 166          
BLAST of Translationally controlled tumor protein vs. Ensembl Nematostella
Match: EDO32702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUA9])

HSP 1 Score: 54.299 bits (129), Expect = 8.376e-10
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  142 KNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDK-KGYTSYIKGYMKSILERLNATNKERAEI--FKSKVGAYVTKIIKNFDEYRFY 429
            K GI + L GGN S E A DD V D   T  ++V +NRLVE+ +   K   +  K Y+K + E +        E+  F+     Y+  I KNF EY+F+
Sbjct:    1 KQGIDENLIGGNKSAEDACDD-VEDGCTTGCNVVMANRLVEIPYKTFKELLAEFKPYIKKVKEHMKEEGCPDEEVKGFEKAAMDYILSIKKNFKEYQFF 98          
BLAST of Translationally controlled tumor protein vs. Ensembl Medaka
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:100304446])

HSP 1 Score: 148.673 bits (374), Expect = 1.692e-45
Identity = 77/170 (45.29%), Postives = 107/170 (62.94%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYK +++GDE+ SD + +   + + YE  G+ +T   G  DAL G NAS E A + +   S  + +DIV ++ L E  FDKKGY +YIK YMKSI  +L  +N +R E F ++    V  ++ N   Y+FY GESMNP+G +   +YRED ITPY + FKDGLE EKC
Sbjct:    1 MIIYKCVISGDEMFSDIYKIKETE-IFYEVEGKTVTRTEGFDDALIGANASAEEATETN-ESSTVSGVDIVLNHNLQETGFDKKGYLTYIKDYMKSIKAKLQESNPDRVEKFMAEAQVAVKGVVGNIKNYQFYTGESMNPEGTVGLLDYREDGITPYMLFFKDGLEIEKC 168          
BLAST of Translationally controlled tumor protein vs. Planmine SMEST
Match: SMESG000013566.1 (SMESG000013566.1)

HSP 1 Score: 327.791 bits (839), Expect = 8.714e-116
Identity = 164/173 (94.80%), Postives = 166/173 (95.95%), Query Frame = 1
Query:   25 EKMLIYKDI-VAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            E +L   DI +  DELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC
Sbjct:   36 EIILCNPDIDMRSDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 208          
BLAST of Translationally controlled tumor protein vs. Planmine SMEST
Match: SMESG000023212.1 (SMESG000023212.1)

HSP 1 Score: 233.032 bits (593), Expect = 6.744e-79
Identity = 110/170 (64.71%), Postives = 135/170 (79.41%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            MLIYKDI++ DE+ SD++PM ++DD+VYEFNG+NITIKNGI D   GGN S E  GDDD ++S ET IDIVY+NRLVEMS+ KK YT+YIK YMK IL+ L   N  R  +FK+    Y+T+I+KNF EY+FY GESMNPD M+I CNYREDQITPYF++FKDG+ EEKC
Sbjct:    1 MLIYKDIISDDEISSDSYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEG-GDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVNVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 169          
The following BLAST results are available for this feature:
BLAST of Translationally controlled tumor protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPT14.854e-4342.44tumor protein, translationally-controlled 1 [Sourc... [more]
TPT16.683e-4342.44tumor protein, translationally-controlled 1 [Sourc... [more]
TPT11.282e-4242.44tumor protein, translationally-controlled 1 [Sourc... [more]
TPT12.853e-3743.33tumor protein, translationally-controlled 1 [Sourc... [more]
TPT16.060e-3646.15tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tct-12.239e-3137.91Translationally-controlled tumor protein homolog ... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tctp5.892e-3944.00gene:FBgn0037874 transcript:FBtr0347181[more]
Tctp5.892e-3944.00gene:FBgn0037874 transcript:FBtr0082344[more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tpt13.628e-4545.93tumor protein, translationally-controlled 1 [Sourc... [more]
tpt11.692e-3846.58tumor protein, translationally-controlled 1 [Sourc... [more]
tpt14.133e-1845.92tumor protein, translationally-controlled 1 [Sourc... [more]
tpt14.133e-1845.92tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tpt11.022e-3841.28tumor protein, translationally-controlled 1 [Sourc... [more]
tpt18.224e-1835.34tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tpt13.675e-4341.86tumor protein, translationally-controlled 1 [Sourc... [more]
Tpt18.895e-3644.62tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally controlled tumor protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91800|TCTP_SCHJA7.063e-5749.70Translationally-controlled tumor protein homolog O... [more]
sp|Q10344|TCTP_SCHPO6.139e-4950.30Translationally-controlled tumor protein homolog O... [more]
sp|D0MQ50|TCTP_ALTAL9.578e-4950.00Translationally-controlled tumor protein homolog O... [more]
sp|P0CR82|TCTP_CRYNJ6.268e-4646.75Translationally-controlled tumor protein homolog O... [more]
sp|P0CR83|TCTP_CRYNB6.268e-4646.75Translationally-controlled tumor protein homolog O... [more]
back to top
BLAST of Translationally controlled tumor protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|241964667.521e-5952.05tr|A0A0D2X0X0|A0A0D2X0X0_CAPO3 Translationally-con... [more]
gnl|BL_ORD_ID|183271021.541e-5548.07tr|A0A1I8J4X7|A0A1I8J4X7_9PLAT TCTP domain-contain... [more]
gnl|BL_ORD_ID|175853031.772e-5550.00tr|A0A3M7SXZ0|A0A3M7SXZ0_BRAPC Translationally-con... [more]
gnl|BL_ORD_ID|183100126.943e-5549.71tr|A0A267GJW3|A0A267GJW3_9PLAT TCTP domain-contain... [more]
gnl|BL_ORD_ID|155107161.008e-5451.76tr|A0A1X0R2P9|A0A1X0R2P9_RHIZD Translationally con... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tpt12.405e-4344.77tumor protein, translationally-controlled 1 [Sourc... [more]
tpt12.194e-3742.51tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009867.14.933e-4744.77pep scaffold:Pmarinus_7.0:GL478379:189408:194610:-... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TMA192.042e-4443.20Protein that associates with ribosomes; homolog of... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327028.376e-1036.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpt11.692e-4545.29tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally controlled tumor protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000013566.18.714e-11694.80SMESG000013566.1[more]
SMESG000023212.16.744e-7964.71SMESG000023212.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025427 ID=SMED30025427|Name=Translationally controlled tumor protein|organism=Schmidtea mediterranea sexual|type=transcript|length=570bp
AAGTAATACTTTTATCATTTAATTGAAAAAATGCTCATTTACAAGGATAT
TGTTGCCGGCGATGAGTTGTGCTCTGATACATTCCCAATGACGATTGTCG
ACGATGTCGTTTACGAATTCAACGGAAGAAATATTACTATTAAAAACGGT
ATTTCTGACGCCCTCTTTGGTGGAAATGCTTCAGAGGAAGCTGCTGGCGA
TGATGACGTTGCTGATTCGGACGAGACAGCAATTGACATTGTATACAGCA
ACCGATTAGTCGAAATGAGCTTTGACAAGAAAGGTTACACGAGTTACATC
AAAGGTTACATGAAAAGTATTTTGGAAAGATTGAATGCCACTAATAAAGA
ACGAGCTGAAATCTTCAAATCCAAAGTCGGTGCCTATGTTACAAAAATCA
TCAAAAATTTTGATGAATATCGTTTCTACTGTGGAGAGTCAATGAACCCT
GACGGAATGATCATTCCATGCAATTACAGAGAAGACCAAATTACCCCATA
CTTTGTTCTCTTCAAAGATGGCCTCGAAGAAGAAAAATGCTAGATTTCTG
TTAAATAAATTTAGTGGAAC
back to top

protein sequence of SMED30025427-orf-1

>SMED30025427-orf-1 ID=SMED30025427-orf-1|Name=SMED30025427-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNA
SEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILER
LNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYR
EDQITPYFVLFKDGLEEEKC*
back to top
Aliases
The feature 'Translationally controlled tumor protein' has the following synonyms
Synonym
tct-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0002181cytoplasmic translation
GO:0007026negative regulation of microtubule depolymerization
GO:0010507negative regulation of autophagy
GO:0034599cellular response to oxidative stress
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005829cytosol
GO:0010494cytoplasmic stress granule
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023embryonic pharynx
PLANA:0004517blastomere
PLANA:0000211primitive ectoderm cell
PLANA:0000058embryonic digestive system
PLANA:0000029primitive ectoderm
Vocabulary: INTERPRO
TermDefinition
IPR034737TCTP
IPR018105Translational_control_tumour_p
IPR011323Mss4/transl-control_tumour
IPR018103Translation_control_tumour_CS
IPR011057Mss4-like_sf
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000003Stage 3
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018105Translationally controlled tumour proteinPRINTSPR01653TCTPROTEINcoord: 60..79
score: 35.18
coord: 1..20
score: 51.19
coord: 47..58
score: 47.62
IPR018105Translationally controlled tumour proteinPFAMPF00838TCTPcoord: 1..166
e-value: 9.9E-61
score: 204.9
IPR018105Translationally controlled tumour proteinPANTHERPTHR11991TRANSLATIONALLY CONTROLLED TUMOR PROTEIN-RELATEDcoord: 1..170
IPR011323Mss4/translationally controlled tumour-associated TCTPGENE3DG3DSA:2.170.150.10coord: 1..170
e-value: 1.1E-66
score: 226.1
NoneNo IPR availablePANTHERPTHR11991:SF0TRANSLATIONALLY-CONTROLLED TUMOR PROTEINcoord: 1..170
IPR018103Translationally controlled tumour protein, conserved sitePROSITEPS01003TCTP_2coord: 127..149
IPR034737Translationally controlled tumour protein (TCTP) domainPROSITEPS51797TCTP_3coord: 1..170
score: 64.759
IPR011057Mss4-like superfamilySUPERFAMILYSSF51316Mss4-likecoord: 1..170