Translationally-controlled tumor protein homolog

Overview
NameTranslationally-controlled tumor protein homolog
Smed IDSMED30025427
Uniprot Best hitTranslationally-controlled tumor protein homolog OS=Schistosoma japonicum GN=TCTP PE=2 SV=1 (E=1.65269e-55)
Length (bp)570
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Translationally-controlled tumor protein homolog (SMED30025427) t-SNE clustered cells

Violin plots show distribution of expression levels for Translationally-controlled tumor protein homolog (SMED30025427) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Translationally-controlled tumor protein homolog ( tct-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the embryonic digestive system, blastomere compartment, primitive ectoderm cell, primitive ectoderm, temporary embryonic pharynx and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 143.28 bits (360), Expect = 7.236e-42
Identity = 73/172 (42.44%), Postives = 104/172 (60.47%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DE+ SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 143.28 bits (360), Expect = 9.670e-42
Identity = 73/172 (42.44%), Postives = 104/172 (60.47%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DE+ SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 142.895 bits (359), Expect = 1.812e-41
Identity = 73/172 (42.44%), Postives = 104/172 (60.47%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DE+ SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 127.872 bits (320), Expect = 3.558e-36
Identity = 65/150 (43.33%), Postives = 88/150 (58.67%), Query Frame = 1
Query:   94 IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:   11 IADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 160          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 124.02 bits (310), Expect = 7.469e-35
Identity = 60/130 (46.15%), Postives = 79/130 (60.77%), Query Frame = 1
Query:  151 ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKSI  +L     ER + F +     +  I+ NF  Y+F+ GE+MNPDGM+   +YRED +TPY + FKDGLE EKC
Sbjct:    9 IDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 138          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Celegans
Match: tct-1 (Translationally-controlled tumor protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93573])

HSP 1 Score: 112.464 bits (280), Expect = 2.025e-30
Identity = 69/182 (37.91%), Postives = 105/182 (57.69%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSD-ETAIDIVYSNRLVEMSF--DKKGYTSYIKGYMKSILERLNATNKERAEI--FKSKVGAYVTKIIK--NFDEYRFYCGESM---NPDGMIIPCNYREDQIT--PYFVLFKDGLEEEKC 540
            MLIYKDI   DEL SD+FPM +VDD+VYEF G+++  K G    L G N S E   +DD +D   E  IDIV +++LVEM+   D   + +YIK +MK++++ +   N+++A++  FK K+  +V  ++    F    F+ GE       +G +    YR+   T  P  +L K+ + EEKC
Sbjct:    1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEG-EIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKC 181          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Fly
Match: Tctp (Translationally controlled tumor protein ortholog (H. sapiens) [Source:FlyBase gene name;Acc:FBgn0037874])

HSP 1 Score: 131.724 bits (330), Expect = 8.211e-38
Identity = 77/175 (44.00%), Postives = 110/175 (62.86%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVE-MSF-DKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYRE---DQITPYFVLFKDGLEEEKC 540
            M IYKDI+ GDE+ +DT+ M +VDDV+YE  G+ IT + G    L G NAS E A D+    + E+ +D+V ++RL E  +F DKK YT Y+K YMK +L +L   + ++ +IFK+ +   +  I+  F E +F+ GESM+ DGM+    YRE   D + P  + FK GLEEEKC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLIT-RQGDDIKLEGANASAEEA-DEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSV-PVLMFFKHGLEEEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Fly
Match: Tctp (Translationally controlled tumor protein ortholog (H. sapiens) [Source:FlyBase gene name;Acc:FBgn0037874])

HSP 1 Score: 131.724 bits (330), Expect = 8.211e-38
Identity = 77/175 (44.00%), Postives = 110/175 (62.86%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVE-MSF-DKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYRE---DQITPYFVLFKDGLEEEKC 540
            M IYKDI+ GDE+ +DT+ M +VDDV+YE  G+ IT + G    L G NAS E A D+    + E+ +D+V ++RL E  +F DKK YT Y+K YMK +L +L   + ++ +IFK+ +   +  I+  F E +F+ GESM+ DGM+    YRE   D + P  + FK GLEEEKC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLIT-RQGDDIKLEGANASAEEA-DEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSV-PVLMFFKHGLEEEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:ZFIN;Acc:ZDB-GENE-990603-10])

HSP 1 Score: 147.902 bits (372), Expect = 5.304e-44
Identity = 79/172 (45.93%), Postives = 112/172 (65.12%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYKDI+ GDE+ SD + +   ++ ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK++  +L  +   R + F +   A V KI+ N   ++F+ GESMNPDGMI   ++RED +TPY + FKDGLE EKC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 171          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:ZFIN;Acc:ZDB-GENE-990603-10])

HSP 1 Score: 148.673 bits (374), Expect = 7.641e-44
Identity = 79/172 (45.93%), Postives = 112/172 (65.12%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYKDI+ GDE+ SD + +   ++ ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK++  +L  +   R + F +   A V KI+ N   ++F+ GESMNPDGMI   ++RED +TPY + FKDGLE EKC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 171          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:ZFIN;Acc:ZDB-GENE-990603-10])

HSP 1 Score: 130.568 bits (327), Expect = 2.027e-37
Identity = 68/146 (46.58%), Postives = 94/146 (64.38%), Query Frame = 1
Query:  106 VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK++  +L  +   R + F +   A V KI+ N   ++F+ GESMNPDGMI   ++RED +TPY + FKDGLE EKC
Sbjct:   15 MMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 159          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:ZFIN;Acc:ZDB-GENE-990603-10])

HSP 1 Score: 76.6406 bits (187), Expect = 1.499e-17
Identity = 45/98 (45.92%), Postives = 65/98 (66.33%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDD-VVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKS 318
            M+IYKDI+ GDE+ SD + +   ++ ++ E  G+ IT   G I DAL GGNAS E A D+    +  + +DIV +++L E S+DKK YT+YIK YMK+
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVA-DEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKA 97          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Xenopus
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:Xenbase;Acc:XB-GENE-854747])

HSP 1 Score: 132.109 bits (331), Expect = 4.581e-38
Identity = 71/172 (41.28%), Postives = 102/172 (59.30%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNIT-IKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IYKD V  DE+ SD + +    D + +E  G+ I  ++  I DAL GGNAS E   +D    +  + +DIV +++L E  F K  Y +YIK Y+K +  +L  T+ +R + F   +   V  I+ NF  Y+FY GE MNPDGM+   +YRED +TP+ + FKDGL  EKC
Sbjct:    1 MIIYKDTVTEDEMFSDIYKIAETPDGMCFEVEGKIIQRVEGAIDDALIGGNASAECQEEDIGGATTVSGVDIVINHKLQETGFTKDSYKNYIKDYVKLVKAKLEETDPDRVKPFMKGIQDRVKLILGNFKNYQFYTGERMNPDGMVALLDYREDGVTPFMIFFKDGLISEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Mouse
Match: Tpt1 (tumor protein, translationally-controlled 1 [Source:MGI Symbol;Acc:MGI:104890])

HSP 1 Score: 142.895 bits (359), Expect = 5.257e-42
Identity = 72/172 (41.86%), Postives = 105/172 (61.05%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMT-IVDDVVYEFNGRNITIKNG-ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            M+IY+D+++ DEL SD + +  I D +  E  G+ ++   G I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKS+  +L     ER + F +     +  I+ NF+ Y+F+ GE+MNPDGM+   +YRED +TP+ + FKDGLE EKC
Sbjct:    1 MIIYRDLISHDELFSDIYKIREIADGLCLEVEGKMVSRTEGAIDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Mouse
Match: Tpt1 (tumor protein, translationally-controlled 1 [Source:MGI Symbol;Acc:MGI:104890])

HSP 1 Score: 122.865 bits (307), Expect = 1.040e-34
Identity = 58/130 (44.62%), Postives = 80/130 (61.54%), Query Frame = 1
Query:  151 ISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            I D+L GGNAS E    +    +  T +DIV ++ L E SF K+ Y  YIK YMKS+  +L     ER + F +     +  I+ NF+ Y+F+ GE+MNPDGM+   +YRED +TP+ + FKDGLE EKC
Sbjct:    9 IDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 138          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt
Match: sp|P91800|TCTP_SCHJA (Translationally-controlled tumor protein homolog OS=Schistosoma japonicum GN=TCTP PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.653e-55
Identity = 84/169 (49.70%), Postives = 117/169 (69.23%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            M ++KD ++GDE+ SD+    +++DVVYE +   IT+ NG+   L   N S E  G ++V+DS E  ID+V+++RLV  SFDKK Y +Y+KGY+K+I ERL   N ER  IF+S++  Y+  + KNFD+Y  Y GESMNPDGM+   N+RE+ +TPYFV  KDGL EEK
Sbjct:    1 MRVFKDAISGDEMFSDSHSPQLINDVVYEVDANFITVSNGLDSKLIAANPSGEE-GQEEVSDSTERVIDLVHASRLVSTSFDKKSYRAYLKGYLKAIKERLQKENPERVSIFESRINEYMVNVFKNFDDYEHYIGESMNPDGMVALMNFRENGVTPYFVFLKDGLIEEK 168          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt
Match: sp|Q10344|TCTP_SCHPO (Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=p23fy PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.189e-47
Identity = 85/169 (50.30%), Postives = 112/169 (66.27%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            ML+YKD+++GDEL SD + +  VDD+VYE + + +T+K G  D   G N S E A ++    + ET  ++VYS RL   SFDKK Y SYIKGYMK+I  RL  +N ER  +F+     +V KI+ NF +Y FY GESM+PD M++  NYRED ITPY + FKDGL  EK
Sbjct:    1 MLLYKDVISGDELVSDAYDLKEVDDIVYEADCQMVTVKQG-GDVDIGANPSAEDAEENAEEGT-ETVNNLVYSFRLSPTSFDKKSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGFVKKILANFKDYDFYIGESMDPDAMVVLMNYREDGITPYMIFFKDGLVSEK 167          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt
Match: sp|P0CR82|TCTP_CRYNJ (Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNM01460 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.120e-44
Identity = 79/169 (46.75%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            MLIY+D++ GDE+ SD FP+  + D+ YE +  NI IK G  D   GGN S E A +     + +   ++V+S RL   SFDKK Y +Y+KGYMK+I  +L  +N +R   F+     +  KI+ NF +Y FY GESMNPDGM+   NYRED +TPYF ++KDGL+E K
Sbjct:    1 MLIYQDVLTGDEMISDAFPIKEIGDIAYEVDCANIIIKEG--DVDIGGNPSAEEAAEALEEGAQQVN-NVVHSFRLQSTSFDKKSYLTYLKGYMKAIKSKLQESNPDRVAAFEKGAQDFAKKIVANFKDYEFYIGESMNPDGMVCLLNYREDGVTPYFTMWKDGLKEIK 166          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt
Match: sp|P0CR83|TCTP_CRYNB (Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBM1320 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.120e-44
Identity = 79/169 (46.75%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            MLIY+D++ GDE+ SD FP+  + D+ YE +  NI IK G  D   GGN S E A +     + +   ++V+S RL   SFDKK Y +Y+KGYMK+I  +L  +N +R   F+     +  KI+ NF +Y FY GESMNPDGM+   NYRED +TPYF ++KDGL+E K
Sbjct:    1 MLIYQDVLTGDEMISDAFPIKEIGDIAYEVDCANIIIKEG--DVDIGGNPSAEEAAEALEEGAQQVN-NVVHSFRLQSTSFDKKSYLTYLKGYMKAIKSKLQESNPDRVAAFEKGAQDFAKKIVANFKDYEFYIGESMNPDGMVCLLNYREDGVTPYFTMWKDGLKEIK 166          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt
Match: sp|Q6BP09|TCTP_DEBHA (Translationally-controlled tumor protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2E17468g PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 5.993e-44
Identity = 74/169 (43.79%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            M+I+ D+++GDEL SD + + +VDDVVYE +   + + NG  D   G N S E  G+D + D  ET  ++VYS RL + SFDKK + +Y+KGYMK +   L   N E  E F++    Y  K++ +F ++ FY GESM+PDGM++  NYRED  TPY  ++K G+ E+K
Sbjct:    1 MIIFTDVISGDELLSDAYDVKLVDDVVYEADCAMVNVNNG--DVDIGANPSAEEGGED-LEDGTETVNNVVYSFRLQQTSFDKKSFMTYMKGYMKRVKAHLAEKNPEAIEAFENGAKTYFKKVVSSFGDWDFYTGESMDPDGMVVLLNYREDGTTPYVAIWKHGVSEDK 166          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: tr|A0A0D2X0X0|A0A0D2X0X0_CAPO3 (Translationally-controlled tumor protein OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_001218 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 8.127e-58
Identity = 89/171 (52.05%), Postives = 123/171 (71.93%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAA-GDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            MLI+KD+++GDE+ SD+FP  +VDD+ YE +G+ I++K GI D+L GGNAS E    DD  AD  ++ I++VYS++LVE SFDKK YT+YIKGYMK+I   L     ER ++F   +   V KI+ NFD Y+F+ G SMN DG+++  NYRED +TPYF++FKDG+  EK 
Sbjct:    1 MLIFKDVISGDEVASDSFPHKLVDDLYYEVDGKTISVKEGIDDSLIGGNASAEGEDADDGAADGVKSVINVVYSHQLVETSFDKKSYTAYIKGYMKAIKAHLEKNQPERVDVFTKGMPEIVKKILGNFDNYQFFTGASMNVDGLVVLLNYREDGVTPYFIIFKDGVIPEKV 171          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: tr|A0A1I8J4X7|A0A1I8J4X7_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.498e-54
Identity = 87/181 (48.07%), Postives = 124/181 (68.51%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVT-KIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC*ISVK*I*WN 570
            MLI+KD+++GDEL SD++P   VDD+  E  G+ IT+ N I D + GGNAS E AG+    D  E+ I++VYS++LVE  FDKK Y +Y+KGY+K I ++L   N +R E FK+    +V  +++ NF  ++F+ GE M+PD M++  +YRED +TPYFVLFKDGL EEKC   +  + WN
Sbjct:    1 MLIFKDLISGDELASDSYPYKYVDDIAIEIEGKMITVSNAIDDRMIGGNASAEEAGEG-TDDGTESKINVVYSHQLVETQFDKKSYLAYLKGYLKRIEKKLEENNPDRVEAFKTGAQKFVKERVLANFSNWQFFTGEKMDPDAMVVLMDYREDGMTPYFVLFKDGLIEEKCHTRLASLEWN 180          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: tr|B3GUU6|B3GUU6_SCHJA (Translationally-controlled tumor protein homolog OS=Schistosoma japonicum GN=TCTP PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 2.065e-53
Identity = 84/169 (49.70%), Postives = 117/169 (69.23%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            M ++KD ++GDE+ SD+    +++DVVYE +   IT+ NG+   L   N S E  G ++V+DS E  ID+V+++RLV  SFDKK Y +Y+KGY+K+I ERL   N ER  IF+S++  Y+  + KNFD+Y  Y GESMNPDGM+   N+RE+ +TPYFV  KDGL EEK
Sbjct:    1 MRVFKDAISGDEMFSDSHSPQLINDVVYEVDANFITVSNGLDSKLIAANPSGEE-GQEEVSDSTERVIDLVHASRLVSTSFDKKSYRAYLKGYLKAIKERLQKENPERVSIFESRINEYMVNVFKNFDDYEHYIGESMNPDGMVALMNFRENGVTPYFVFLKDGLIEEK 168          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: tr|C1LA91|C1LA91_SCHJA (Translationally-controlled tumor protein homolog OS=Schistosoma japonicum GN=TCTP PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 9.484e-53
Identity = 83/169 (49.11%), Postives = 117/169 (69.23%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEK 537
            M ++KD ++GDE+ SD+    +++DVVYE +   IT+ NG+   L   N S E  G ++V+DS E  ID+V+++RLV  SFDKK Y +Y+KGY+K+I ERL   N ER  IF+S++  Y+  + KNF++Y  Y GESMNPDGM+   N+RE+ +TPYFV  KDGL EEK
Sbjct:    1 MRVFKDAISGDEMFSDSHSPQLINDVVYEVDANFITVSNGLDSKLIAANPSGEE-GQEEVSDSTERVIDLVHASRLVSTSFDKKSYRAYLKGYLKAIKERLQKENPERVSIFESRINEYMVNVFKNFNDYEHYIGESMNPDGMVALMNFRENGVTPYFVFLKDGLIEEK 168          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: tr|A0A0C7CHK8|A0A0C7CHK8_9FUNG (Putative Translationally-controlled tumor protein OS=Rhizopus microsporus GN=RMATCC62417_16436 PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.193e-52
Identity = 87/170 (51.18%), Postives = 114/170 (67.06%), Query Frame = 1
Query:   31 MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 540
            ML+Y DI++GDEL SD FP+T VDD+ YE + + ITI  G  D   G N S E   D+ V  + +   +++Y++RL E SFDKK Y +YIKGYMK++  +L  TN ER  +F+ KV  +V KI+ NF +Y FY GESMN DGM+   NYRED +TPYF  FKDGL+ EK 
Sbjct:    1 MLLYTDIISGDELFSDAFPITEVDDIAYEVDCKMITINEG--DIDIGANPSAEGGEDEGVESTSKQVNNVIYTSRLTETSFDKKSYMTYIKGYMKAVKTKLQETNPERVAVFEQKVTPFVKKILANFKDYEFYTGESMNVDGMVALLNYREDGVTPYFTFFKDGLKVEKL 168          
The following BLAST results are available for this feature:
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
TPT17.236e-4242.44tumor protein, translationally-controlled 1 [Sourc... [more]
TPT19.670e-4242.44tumor protein, translationally-controlled 1 [Sourc... [more]
TPT11.812e-4142.44tumor protein, translationally-controlled 1 [Sourc... [more]
TPT13.558e-3643.33tumor protein, translationally-controlled 1 [Sourc... [more]
TPT17.469e-3546.15tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 1
Match NameE-valueIdentityDescription
tct-12.025e-3037.91Translationally-controlled tumor protein homolog ... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 2
Match NameE-valueIdentityDescription
Tctp8.211e-3844.00Translationally controlled tumor protein ortholog ... [more]
Tctp8.211e-3844.00Translationally controlled tumor protein ortholog ... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 4
Match NameE-valueIdentityDescription
tpt15.304e-4445.93tumor protein, translationally-controlled 1 [Sourc... [more]
tpt17.641e-4445.93tumor protein, translationally-controlled 1 [Sourc... [more]
tpt12.027e-3746.58tumor protein, translationally-controlled 1 [Sourc... [more]
tpt11.499e-1745.92tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 1
Match NameE-valueIdentityDescription
tpt14.581e-3841.28tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 2
Match NameE-valueIdentityDescription
Tpt15.257e-4241.86tumor protein, translationally-controlled 1 [Sourc... [more]
Tpt11.040e-3444.62tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91800|TCTP_SCHJA1.653e-5549.70Translationally-controlled tumor protein homolog O... [more]
sp|Q10344|TCTP_SCHPO1.189e-4750.30Translationally-controlled tumor protein homolog O... [more]
sp|P0CR82|TCTP_CRYNJ1.120e-4446.75Translationally-controlled tumor protein homolog O... [more]
sp|P0CR83|TCTP_CRYNB1.120e-4446.75Translationally-controlled tumor protein homolog O... [more]
sp|Q6BP09|TCTP_DEBHA5.993e-4443.79Translationally-controlled tumor protein homolog O... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A0D2X0X0|A0A0D2X0X0_CAPO38.127e-5852.05Translationally-controlled tumor protein OS=Capsas... [more]
tr|A0A1I8J4X7|A0A1I8J4X7_9PLAT1.498e-5448.07Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|B3GUU6|B3GUU6_SCHJA2.065e-5349.70Translationally-controlled tumor protein homolog O... [more]
tr|C1LA91|C1LA91_SCHJA9.484e-5349.11Translationally-controlled tumor protein homolog O... [more]
tr|A0A0C7CHK8|A0A0C7CHK8_9FUNG1.193e-5251.18Putative Translationally-controlled tumor protein ... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018105Translationally controlled tumour proteinPRINTSPR01653TCTPROTEINcoord: 9..29
score: 51.53
coord: 55..66
score: 47.62
coord: 68..87
score: 35.18
IPR018105Translationally controlled tumour proteinPFAMPF00838TCTPcoord: 9..174
e-value: 5.2E-61
score: 205.6
IPR011323Mss4/translationally controlled tumour-associated TCTPGENE3DG3DSA:2.170.150.10coord: 9..178
e-value: 4.6E-63
score: 211.9
IPR018103Translationally controlled tumour protein, conserved sitePROSITEPS01003TCTP_2coord: 135..157
IPR011057Mss4-likeSUPERFAMILYSSF51316Mss4-likecoord: 9..178

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR018105Translational_control_tumour_p
IPR011323Mss4/transl-control_tumor
IPR018103Translation_control_tumour_CS
IPR011057Mss4-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000212blastomere compartment
PLANA:0000058embryonic digestive system
PLANA:0000211primitive ectoderm cell
PLANA:0000023temporary embryonic pharynx
PLANA:0004517blastomere
PLANA:0000029primitive ectoderm
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000003Stage 3
PLANA:0000002Stage 2
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025427 ID=SMED30025427|Name=Translationally-controlled tumor protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=570bp
AAGTAATACTTTTATCATTTAATTGAAAAAATGCTCATTTACAAGGATAT
TGTTGCCGGCGATGAGTTGTGCTCTGATACATTCCCAATGACGATTGTCG
ACGATGTCGTTTACGAATTCAACGGAAGAAATATTACTATTAAAAACGGT
ATTTCTGACGCCCTCTTTGGTGGAAATGCTTCAGAGGAAGCTGCTGGCGA
TGATGACGTTGCTGATTCGGACGAGACAGCAATTGACATTGTATACAGCA
ACCGATTAGTCGAAATGAGCTTTGACAAGAAAGGTTACACGAGTTACATC
AAAGGTTACATGAAAAGTATTTTGGAAAGATTGAATGCCACTAATAAAGA
ACGAGCTGAAATCTTCAAATCCAAAGTCGGTGCCTATGTTACAAAAATCA
TCAAAAATTTTGATGAATATCGTTTCTACTGTGGAGAGTCAATGAACCCT
GACGGAATGATCATTCCATGCAATTACAGAGAAGACCAAATTACCCCATA
CTTTGTTCTCTTCAAAGATGGCCTCGAAGAAGAAAAATGCTAGATTTCTG
TTAAATAAATTTAGTGGAAC
back to top

protein sequence of SMED30025427-orf-1

>SMED30025427-orf-1 ID=SMED30025427-orf-1|Name=SMED30025427-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MLIYKDIVAGDELCSDTFPMTIVDDVVYEFNGRNITIKNGISDALFGGNA
SEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILER
LNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYR
EDQITPYFVLFKDGLEEEKC*
back to top
Aliases
The feature 'Translationally-controlled tumor protein homolog' has the following synonyms
Synonym
tct-like