exonuclease 1-like

Overview
Nameexonuclease 1-like
Smed IDSMED30025421
Length (bp)1631
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of exonuclease 1-like (SMED30025421) t-SNE clustered cells

Violin plots show distribution of expression levels for exonuclease 1-like (SMED30025421) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of exonuclease 1-like (SMED30025421) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for exonuclease 1-like (SMED30025421) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025421

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025421SMESG000064333.1 SmedASXL_015035SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30025421SMESG000064333.1 dd_Smed_v4_14547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025421SMESG000064333.1 dd_Smed_v4_14547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025421SMESG000064333.1 dd_Smed_v4_14547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025421SMESG000064333.1 dd_Smed_v4_14547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025421SMESG000064333.1 dd_Smed_v4_14547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30025421SMESG000064333.1 dd_Smed_v6_14547_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30025421SMESG000064333.1 dd_Smed_v4_14547_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025421SMESG000064333.1 SmWIOct06_014984GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025421SMESG000064333.1 SmWIOct06_011183GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025421SMESG000064333.1 SMED_11569_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025421SMESG000064333.1 SMED_11569_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of exonuclease 1-like vs. Ensembl Human
Match: EXO1 (exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511])

HSP 1 Score: 285.034 bits (728), Expect = 3.191e-86
Identity = 156/347 (44.96%), Postives = 223/347 (64.27%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ I +   KG VVAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  + IK ILVFDG  LP+K  VE  R++ R++   KG + + E K SEA+ECF + + I+H +A K+IK   S GV C+VAPYEADAQLAYL K  IV  IITEDSDLL FG  KV+ K+D  G  N +EI+     +   L + ++  KFRYMCI+SGCDY   L GIGL  A K+L+      +   + +I  Y K  I + +D IN  + A+ TF YQ+VFDP+  + +PLN Y  +V+P  LS+AGQ +++  +  Q+A+G +D +  E I +Y  D
Sbjct:    1 MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFG--NGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDD-SIALQIALGNKDINTFEQIDDYNPD 344          
BLAST of exonuclease 1-like vs. Ensembl Human
Match: EXO1 (exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511])

HSP 1 Score: 284.648 bits (727), Expect = 8.740e-86
Identity = 156/347 (44.96%), Postives = 223/347 (64.27%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ I +   KG VVAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  + IK ILVFDG  LP+K  VE  R++ R++   KG + + E K SEA+ECF + + I+H +A K+IK   S GV C+VAPYEADAQLAYL K  IV  IITEDSDLL FG  KV+ K+D  G  N +EI+     +   L + ++  KFRYMCI+SGCDY   L GIGL  A K+L+      +   + +I  Y K  I + +D IN  + A+ TF YQ+VFDP+  + +PLN Y  +V+P  LS+AGQ +++  +  Q+A+G +D +  E I +Y  D
Sbjct:    1 MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFG--NGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDD-SIALQIALGNKDINTFEQIDDYNPD 344          
BLAST of exonuclease 1-like vs. Ensembl Human
Match: EXO1 (exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511])

HSP 1 Score: 284.648 bits (727), Expect = 8.740e-86
Identity = 156/347 (44.96%), Postives = 223/347 (64.27%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ I +   KG VVAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  + IK ILVFDG  LP+K  VE  R++ R++   KG + + E K SEA+ECF + + I+H +A K+IK   S GV C+VAPYEADAQLAYL K  IV  IITEDSDLL FG  KV+ K+D  G  N +EI+     +   L + ++  KFRYMCI+SGCDY   L GIGL  A K+L+      +   + +I  Y K  I + +D IN  + A+ TF YQ+VFDP+  + +PLN Y  +V+P  LS+AGQ +++  +  Q+A+G +D +  E I +Y  D
Sbjct:    1 MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFG--NGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDD-SIALQIALGNKDINTFEQIDDYNPD 344          
BLAST of exonuclease 1-like vs. Ensembl Human
Match: EXO1 (exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511])

HSP 1 Score: 140.198 bits (352), Expect = 2.065e-38
Identity = 83/198 (41.92%), Postives = 110/198 (55.56%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEIN 653
            MGI+GLL ++K  ++ I +   KG VVAVDTY WL+K  + C++K+A GE TD                                        + R++   KG + + E K SEA+ECF + + I+H +A K+IK   S GV C+VAPYEADAQLAYL K  IV  IITEDSDLL FG  KV+ K+D  G  N +EI+
Sbjct:    1 MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTD----------------------------------------RRRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFG--NGLEID 156          
BLAST of exonuclease 1-like vs. Ensembl Human
Match: EXO1 (exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511])

HSP 1 Score: 131.339 bits (329), Expect = 3.183e-35
Identity = 81/198 (40.91%), Postives = 108/198 (54.55%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEIN 653
            MGI+GLL ++K  ++ I +   KG VVAVDTY WL+K  + C++K+A GE TD                                        + R++   KG + + E K SEA+ECF + + I+H +A K  +   S GV C+VAPYEADAQLAYL K  IV  IITEDSDLL FG  KV+ K+D  G  N +EI+
Sbjct:    1 MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTD----------------------------------------RRRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKAAR---SQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFG--NGLEID 153          
BLAST of exonuclease 1-like vs. Ensembl Celegans
Match: exo-1 (EXOnuclease [Source:UniProtKB/TrEMBL;Acc:O62245])

HSP 1 Score: 184.111 bits (466), Expect = 1.284e-50
Identity = 127/371 (34.23%), Postives = 192/371 (51.75%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSL-GVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKL-DFNGLANLIEINDINKVLKFPL--EKYSYNKFRYMCIISGCDYF-PGLAGIGLITAAKLLQKTQLLSLNDFLTRINMY---SKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNV--------------------NPSDLSFA-GQIIENRELVFQLAIGLRDPSNQELISN 1085
            MGI GLLP++K   ++  + +++G  VA+D    L++    C DKI +GE+T  Y+NY  +Y+K L      V++VFDG+ LPAK G   +R++ RE  +      + +    EA++ +     IS  +    I+   S+  V  +VAPYEADAQLAYL +  +VD +ITEDSDL++FG   + FK     G  ++ E  ++       L  +K+ + KFR +CI+SGCDY   GL G+GL TAAK    T +  L   L ++  Y    K K  ++ + I    +A+ TF++QIVFDP    Q PL  Y   V                     PS  SFA       + +  +LA+G  +P N+  I +
Sbjct:    1 MGISGLLPFVKNACRKGNILELRGKSVAIDVSCLLHRGLTGCMDKIHMGEETQSYVNYVNKYVKELLGMGCHVVMVFDGRPLPAKKGTNEERRELREKRKEHAEMLLAKGLEREARDTYRLATSISADIVENTIQYFRSMTNVDIVVAPYEADAQLAYLVQEKLVDAVITEDSDLIVFGCEMIYFKWQSATGECSVYEKCNLKNCFTGELGGDKFDFVKFRRICILSGCDYLQAGLPGVGLSTAAKFFSMTSIKDLRTLLRKVPSYLKNPKLKEHVNDEFIRNFEKAENTFKHQIVFDPRERCQKPLTPYPKEVLMTGVDDLEEVIDLDSPKKTAPSSKSFAYAGTASTQRIAIRLALG--NPENKSSIDD 369          
BLAST of exonuclease 1-like vs. Ensembl Celegans
Match: crn-1 (Flap endonuclease 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N3T2])

HSP 1 Score: 78.5666 bits (192), Expect = 1.877e-15
Identity = 86/314 (27.39%), Postives = 138/314 (43.95%), Query Frame = 3
Query:   60 MGIKGLLPYLK-GITKEICLADIK---GCVVAVDTYGWLYKATMCC-SDKIAL----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHS-----------LGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINM----------YSKTKIIISKDEINQAVEADLTFQ 911
            MGIKGL   +       I + ++K   G  VA+D    LY+  +    D   L    GE T   +    R +++ +   +K + VFDGK    K G   KR + R            E+  +EAKE  D  ++ + K   +L+K+              +G+  + AP EA+AQ A+L K   V   +TED D L FG+  VL +     +A  I I + N  L     K S  +F  +CI+ GCDY   + G+G   A +L++  Q  ++   L  I+           Y + + +    E+ +  E +LT++
Sbjct:    1 MGIKGLSQVIADNAPSAIKVNEMKAFFGRTVAIDASMCLYQFLIAVRQDGSQLQSEDGETTSHLMGMLNRTVRMFE-NGVKPVYVFDGKPPDMKGGELEKRSERRAE---------AEKALTEAKEKGD--VKEAEKFERRLVKVTKQQNDEAKRLLGLMGIPVVEAPCEAEAQCAHLVKAGKVFGTVTEDMDALTFGS-TVLLRHFLAPVAKKIPIKEFNLSLALEEMKLSVEEFIDLCILLGCDYCGTIRGVGPKKAVELIR--QHKNIETILENIDQNKYPPPEDWPYKRARELFLNPEVTKPEEVELTWK 299          
BLAST of exonuclease 1-like vs. Ensembl Celegans
Match: crn-1 (Flap endonuclease 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N3T2])

HSP 1 Score: 78.5666 bits (192), Expect = 1.877e-15
Identity = 86/314 (27.39%), Postives = 138/314 (43.95%), Query Frame = 3
Query:   60 MGIKGLLPYLK-GITKEICLADIK---GCVVAVDTYGWLYKATMCC-SDKIAL----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHS-----------LGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINM----------YSKTKIIISKDEINQAVEADLTFQ 911
            MGIKGL   +       I + ++K   G  VA+D    LY+  +    D   L    GE T   +    R +++ +   +K + VFDGK    K G   KR + R            E+  +EAKE  D  ++ + K   +L+K+              +G+  + AP EA+AQ A+L K   V   +TED D L FG+  VL +     +A  I I + N  L     K S  +F  +CI+ GCDY   + G+G   A +L++  Q  ++   L  I+           Y + + +    E+ +  E +LT++
Sbjct:    1 MGIKGLSQVIADNAPSAIKVNEMKAFFGRTVAIDASMCLYQFLIAVRQDGSQLQSEDGETTSHLMGMLNRTVRMFE-NGVKPVYVFDGKPPDMKGGELEKRSERRAE---------AEKALTEAKEKGD--VKEAEKFERRLVKVTKQQNDEAKRLLGLMGIPVVEAPCEAEAQCAHLVKAGKVFGTVTEDMDALTFGS-TVLLRHFLAPVAKKIPIKEFNLSLALEEMKLSVEEFIDLCILLGCDYCGTIRGVGPKKAVELIR--QHKNIETILENIDQNKYPPPEDWPYKRARELFLNPEVTKPEEVELTWK 299          
BLAST of exonuclease 1-like vs. Ensembl Celegans
Match: gen-1 (GEN1 Holliday junction resolvase homolog [Source:UniProtKB/TrEMBL;Acc:Q22418])

HSP 1 Score: 65.4698 bits (158), Expect = 3.590e-11
Identity = 63/249 (25.30%), Postives = 113/249 (45.38%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYL-NYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDF----NGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFP-GLAGIGLITAAKLL 788
            M I G+  +   + +++    ++   +++D + WLY++   C  +    +  + YL  +  R  +LL+   I ++ VFD  N+ A       + QN         +F+  ++ S     F   ++  +K    L +    LG+K I+AP + +AQ A L    +    IT D D  LFG  K L++ DF    +  A L +I  ++    F  +K S        I+ GCDYF  G+  IG+++   +L
Sbjct:    1 MTINGIWEWANHVVRKVPNETMRDKTLSIDGHIWLYESLKGC--EAHHQQTPNSYLVTFFTRIQRLLELKIIPIV-VFD--NINASSSAHESKDQN---------EFVPRKRRSFGDSPFTNLVDHVYKTNALLTE----LGIKVIIAPGDGEAQCARLEDLGVTSGCITTDFDYFLFGG-KNLYRFDFTAGTSSTACLHDIMHLSLGRMFMEKKVSRPHLISTAILLGCDYFQRGVQNIGIVSVFDIL 230          
BLAST of exonuclease 1-like vs. Ensembl Celegans
Match: gen-1 (GEN1 Holliday junction resolvase homolog [Source:UniProtKB/TrEMBL;Acc:Q22418])

HSP 1 Score: 65.4698 bits (158), Expect = 3.590e-11
Identity = 63/249 (25.30%), Postives = 113/249 (45.38%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYL-NYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDF----NGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFP-GLAGIGLITAAKLL 788
            M I G+  +   + +++    ++   +++D + WLY++   C  +    +  + YL  +  R  +LL+   I ++ VFD  N+ A       + QN         +F+  ++ S     F   ++  +K    L +    LG+K I+AP + +AQ A L    +    IT D D  LFG  K L++ DF    +  A L +I  ++    F  +K S        I+ GCDYF  G+  IG+++   +L
Sbjct:    1 MTINGIWEWANHVVRKVPNETMRDKTLSIDGHIWLYESLKGC--EAHHQQTPNSYLVTFFTRIQRLLELKIIPIV-VFD--NINASSSAHESKDQN---------EFVPRKRRSFGDSPFTNLVDHVYKTNALLTE----LGIKVIIAPGDGEAQCARLEDLGVTSGCITTDFDYFLFGG-KNLYRFDFTAGTSSTACLHDIMHLSLGRMFMEKKVSRPHLISTAILLGCDYFQRGVQNIGIVSVFDIL 230          
BLAST of exonuclease 1-like vs. Ensembl Fly
Match: tos (gene:FBgn0015553 transcript:FBtr0081131)

HSP 1 Score: 277.33 bits (708), Expect = 2.680e-84
Identity = 135/347 (38.90%), Postives = 214/347 (61.67%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTK-IIISKDEINQAVEADLTFQYQIVFDPVSCRQ---VPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNY 1088
            MGI GL+P++   + ++ L DI+G  VAVDTY WL+K    C++K+A GEDTD+Y+ YC++Y+ +L  YDIK ILVFDG++LPAK   E +R+ +R+  + +  + +   +  EA+    +C++++H +A++LI+   S  V CIVAPYEADAQ+A+L +  +  YIITEDSDL LFG   ++FKLD NG   L+E   ++  +    EKY ++KFR MCI+SGCDY   L GIGL  A K + KT+   +   L +I  Y   + + +  D I   ++A+ TF++  +++P+  R      L +Y  +      S AG ++E+ E    LA+G  +P + + + ++
Sbjct:    1 MGITGLIPFVGKASSQLHLKDIRGSTVAVDTYCWLHKGVFGCAEKLARGEDTDVYIQYCLKYVNMLLSYDIKPILVFDGQHLPAKALTEKRRRDSRKQSKERAAELLRLGRIEEARSHMRRCVDVTHDMALRLIRECRSRNVDCIVAPYEADAQMAWLNRADVAQYIITEDSDLTLFGAKNIIFKLDLNGSGLLVEAEKLHLAMGCTEEKYHFDKFRRMCILSGCDYLDSLPGIGLAKACKFILKTEQEDMRIALKKIPSYLNMRNLEVDDDYIENFMKAEATFRHMFIYNPLERRMQRLCALEDYETDER--YCSNAGTLLEDSEQALHLALGNLNPFSMKRLDSW 345          
BLAST of exonuclease 1-like vs. Ensembl Fly
Match: Fen1 (gene:FBgn0025832 transcript:FBtr0087075)

HSP 1 Score: 72.7886 bits (177), Expect = 2.005e-13
Identity = 77/264 (29.17%), Postives = 118/264 (44.70%), Query Frame = 3
Query:   60 MGIKGLLPYLKGIT----KEICLADIKGCVVAVDTYGWLYKATMCCSDKIAL-----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCL-EISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNK-----------FRYMCIISGCDYFPGLAGIGLITAAKLL 788
            MGI GL   +  +     +E  +    G  VA+D    LY+  +    + A      G+ T   +    R I+LL    IK + VFDGK    K G   KR + RE    K +K   +       E F++ L  ++ + A +  ++   +GV  + AP EA+AQ A L K   V    TED D L FG+ K+L  L +            ++  K P++++SY+K           F  +CI+ GCDY   + GIG   A +L+
Sbjct:    1 MGILGLSKLIADLAPQAIRESEMKHFFGRKVAIDASMCLYQFLIAVRSEGAQLATVNGDPTSHLMGMFYRTIRLLD-NGIKPVYVFDGKPPDLKSGELAKRAERREEA-EKALKAATDAGDDAGIEKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEAQCAALVKAGKVYATATEDMDALTFGSTKLLRYLTY------------SEARKMPVKEFSYDKLLEGLAINNREFIDLCILLGCDYCESIKGIGPKRAIELI 250          
BLAST of exonuclease 1-like vs. Ensembl Fly
Match: mus201 (gene:FBgn0002887 transcript:FBtr0100473)

HSP 1 Score: 57.7658 bits (138), Expect = 2.656e-8
Identity = 47/162 (29.01%), Postives = 81/162 (50.00%), Query Frame = 3
Query:  330 KRQQNRESFRSKGMKFILERKTSE-AKECFDKC-LEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEK----YSYNKFRYM---CIISGCDYFPGLAGIGLITAAKLL 788
            K Q+  E  +        ERK  E  +   D+  + IS ++++   ++    G+  IVAP EA+AQ A+L    +    IT+DSD+ LFG  + ++K       N    N    V++F  E+    ++ N+ + +   C++ G DY  G+ GIG +TA ++L
Sbjct:  819 KSQKTSEELQELATNLAQERKELEIERNRQDRMGMSISQRMSIDCQELLRLFGIPYIVAPMEAEAQCAFLNATDLTHGTITDDSDIWLFGG-RTVYK-------NFFAQN--KHVMEFRAEQIEQTFNCNRGKLIQLACLV-GSDYTTGIHGIGAVTALEIL 969          
BLAST of exonuclease 1-like vs. Ensembl Fly
Match: mus201 (gene:FBgn0002887 transcript:FBtr0346117)

HSP 1 Score: 57.7658 bits (138), Expect = 2.656e-8
Identity = 47/162 (29.01%), Postives = 81/162 (50.00%), Query Frame = 3
Query:  330 KRQQNRESFRSKGMKFILERKTSE-AKECFDKC-LEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEK----YSYNKFRYM---CIISGCDYFPGLAGIGLITAAKLL 788
            K Q+  E  +        ERK  E  +   D+  + IS ++++   ++    G+  IVAP EA+AQ A+L    +    IT+DSD+ LFG  + ++K       N    N    V++F  E+    ++ N+ + +   C++ G DY  G+ GIG +TA ++L
Sbjct:  819 KSQKTSEELQELATNLAQERKELEIERNRQDRMGMSISQRMSIDCQELLRLFGIPYIVAPMEAEAQCAFLNATDLTHGTITDDSDIWLFGG-RTVYK-------NFFAQN--KHVMEFRAEQIEQTFNCNRGKLIQLACLV-GSDYTTGIHGIGAVTALEIL 969          
BLAST of exonuclease 1-like vs. Ensembl Fly
Match: Gen (gene:FBgn0263831 transcript:FBtr0077176)

HSP 1 Score: 56.6102 bits (135), Expect = 4.238e-8
Identity = 57/243 (23.46%), Postives = 105/243 (43.21%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDI--KVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILE------RKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNG------LANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFP 746
            MG+K L   L    +   + +++G  VA+D  GW+     C S  +    D  ++  + ++ +     Y I  +V  VF  + +  KL  +   ++N   FR    K   E       K  + +  F+  L+    L +       S+G++C+  P EA+A  A+L K+ +VD +I++DSD   +G  +V      +           ++I D+ ++       +   K   M ++ GCDY P
Sbjct:    1 MGVKELWGVLTPHCERKPINELRGKKVAIDLAGWV-----CESLNVV---DYFVHPRHHLKNLFFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKGDKGRSRFNHVLKQCETLLL-------SMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRVYRNFSVSTQGAQAAAGGAVDIYDMREITS--RMDFGQQKIIVMALLCGCDYCP 226          
BLAST of exonuclease 1-like vs. Ensembl Zebrafish
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:406778])

HSP 1 Score: 275.789 bits (704), Expect = 6.068e-83
Identity = 161/440 (36.59%), Postives = 249/440 (56.59%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKS--KKSDK-----ESFFNQNVK----------VTKRTPMTKEKKMQVQCQ---FPWKHA----SKPDTEIDFSQIFDIYT 1307
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD Y++YC++++ +L  + +K ILVFDG+NLP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A  +I+   + GV C+VAPYEADAQLA+L K+ I   +ITEDSDLL FG  KV+ K+D  G    IE   + +        ++  KFRYMCI+SGCDY   L GIGL  A KLL+      +   + ++  Y K  I + ++ I    +A+ TF YQ+VFDP+  + VPLN Y  ++NP+ LS+AG  + + E   Q+A+G  D +  + I ++  D   Q+  P    + S   + DK      S ++QN +            KR P T+ K+  V  Q    P + +     + DT +    + + YT
Sbjct:    1 MGIQGLLQFIKDASEPMHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVDMLLSFGVKPILVFDGRNLPSKQEVEKSRRERRQANLQKGKQLLREGKITEARECFTRSVNITPSMAHDVIRAARTRGVDCVVAPYEADAQLAFLNKSDIAQAVITEDSDLLAFGCKKVILKMDKQGNGLEIEQCHLGRCKSL-GNIFTEEKFRYMCILSGCDYLQSLYGIGLGKACKLLRMANNPDILKVIKKMGQYLKMDISVPEEYIEGFTKANNTFLYQLVFDPLRRKVVPLNPYPDHINPAALSYAGTNVGD-EKGLQMALGNLDINTMQRIDDFNPDAP-QTQPPKAPRSSSWNDRCDKTATTQASIWSQNYEPGCTKPQSPTSPKRPPPTRGKERIVSVQSLKLPQRESQVKRPREDTSLSVDDLLEQYT 437          
BLAST of exonuclease 1-like vs. Ensembl Zebrafish
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:406778])

HSP 1 Score: 274.633 bits (701), Expect = 1.435e-82
Identity = 141/346 (40.75%), Postives = 215/346 (62.14%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD Y++YC++++ +L  + +K ILVFDG+NLP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A  +I+   + GV C+VAPYEADAQLA+L K+ I   +ITEDSDLL FG  KV+ K+D  G    IE   + +        ++  KFRYMCI+SGCDY   L GIGL  A KLL+      +   + ++  Y K  I + ++ I    +A+ TF YQ+VFDP+  + VPLN Y  ++NP+ LS+AG  + + E   Q+A+G  D +  + I ++  D
Sbjct:    1 MGIQGLLQFIKDASEPMHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVDMLLSFGVKPILVFDGRNLPSKQEVEKSRRERRQANLQKGKQLLREGKITEARECFTRSVNITPSMAHDVIRAARTRGVDCVVAPYEADAQLAFLNKSDIAQAVITEDSDLLAFGCKKVILKMDKQGNGLEIEQCHLGRCKSL-GNIFTEEKFRYMCILSGCDYLQSLYGIGLGKACKLLRMANNPDILKVIKKMGQYLKMDISVPEEYIEGFTKANNTFLYQLVFDPLRRKVVPLNPYPDHINPAALSYAGTNVGD-EKGLQMALGNLDINTMQRIDDFNPD 344          
BLAST of exonuclease 1-like vs. Ensembl Zebrafish
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:406778])

HSP 1 Score: 274.633 bits (701), Expect = 1.435e-82
Identity = 141/346 (40.75%), Postives = 215/346 (62.14%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD Y++YC++++ +L  + +K ILVFDG+NLP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A  +I+   + GV C+VAPYEADAQLA+L K+ I   +ITEDSDLL FG  KV+ K+D  G    IE   + +        ++  KFRYMCI+SGCDY   L GIGL  A KLL+      +   + ++  Y K  I + ++ I    +A+ TF YQ+VFDP+  + VPLN Y  ++NP+ LS+AG  + + E   Q+A+G  D +  + I ++  D
Sbjct:    1 MGIQGLLQFIKDASEPMHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVDMLLSFGVKPILVFDGRNLPSKQEVEKSRRERRQANLQKGKQLLREGKITEARECFTRSVNITPSMAHDVIRAARTRGVDCVVAPYEADAQLAFLNKSDIAQAVITEDSDLLAFGCKKVILKMDKQGNGLEIEQCHLGRCKSL-GNIFTEEKFRYMCILSGCDYLQSLYGIGLGKACKLLRMANNPDILKVIKKMGQYLKMDISVPEEYIEGFTKANNTFLYQLVFDPLRRKVVPLNPYPDHINPAALSYAGTNVGD-EKGLQMALGNLDINTMQRIDDFNPD 344          
BLAST of exonuclease 1-like vs. Ensembl Zebrafish
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:406778])

HSP 1 Score: 159.073 bits (401), Expect = 9.245e-46
Identity = 72/163 (44.17%), Postives = 113/163 (69.33%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLI 548
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD Y++YC++++ +L  + +K ILVFDG+NLP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A  +I+   + GV C+VAPYEADAQLA+L K+ I
Sbjct:    1 MGIQGLLQFIKDASEPMHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVDMLLSFGVKPILVFDGRNLPSKQEVEKSRRERRQANLQKGKQLLREGKITEARECFTRSVNITPSMAHDVIRAARTRGVDCVVAPYEADAQLAFLNKSDI 163          
BLAST of exonuclease 1-like vs. Ensembl Zebrafish
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:406778])

HSP 1 Score: 102.834 bits (255), Expect = 8.118e-26
Identity = 45/107 (42.06%), Postives = 74/107 (69.16%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFI 380
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD Y++YC++++ +L  + +K ILVFDG+NLP+K  VE  R++ R++   KG + +
Sbjct:    1 MGIQGLLQFIKDASEPMHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVDMLLSFGVKPILVFDGRNLPSKQEVEKSRRERRQANLQKGKQLL 107          
BLAST of exonuclease 1-like vs. Ensembl Xenopus
Match: ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:Xenbase;Acc:XB-GENE-1010019])

HSP 1 Score: 282.722 bits (722), Expect = 2.823e-86
Identity = 151/357 (42.30%), Postives = 221/357 (61.90%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNY-----ELDHKIQS 1112
            MGI+GLL +LK  ++ I +   KG  VAVDTY WL+K    C++K+A GE TD Y+ +C++++ +L  + +K ILVFDG  LP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A  +IK   + G+ CIVAP+EAD+QLAYL KN   + IITEDSDLL FG  KV+ K+D  G  N +EI+     +   L + ++  KFRYMCI+SGCDY P + GIGL  A KLL+      +   + +I  Y KT I +    I   + A+ TF YQ+VFDPV  + +PLN Y  +VNP +LS+AG  + +  +  Q+A+G  D +  + I +Y     +L H+ QS
Sbjct:    1 MGIQGLLQFLKEASEPIHVKKYKGKTVAVDTYCWLHKGAFACAEKLAKGEPTDQYVQFCMKFVHMLLSFGVKPILVFDGCTLPSKKDVEKARREKRQTNLQKGKQLLREGKLAEARECFARSVNITSSMAHDVIKAARAEGIDCIVAPFEADSQLAYLNKNEFAEAIITEDSDLLAFGCKKVILKMDKFG--NGLEIDQARFGMCRSLGDVFTEEKFRYMCILSGCDYLPSIHGIGLAKACKLLKIANNPDITTVIKKIGQYLKTNITVPDGYIEGFLRANNTFLYQLVFDPVERKLIPLNPYGDDVNPEELSYAGPNMGD-SVALQIALGNMDINTMKQIDDYNPDNPQLSHRSQS 354          
BLAST of exonuclease 1-like vs. Ensembl Xenopus
Match: ufc1 (ubiquitin-fold modifier conjugating enzyme 1 [Source:Xenbase;Acc:XB-GENE-1010019])

HSP 1 Score: 283.108 bits (723), Expect = 3.593e-86
Identity = 151/357 (42.30%), Postives = 221/357 (61.90%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNY-----ELDHKIQS 1112
            MGI+GLL +LK  ++ I +   KG  VAVDTY WL+K    C++K+A GE TD Y+ +C++++ +L  + +K ILVFDG  LP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A  +IK   + G+ CIVAP+EAD+QLAYL KN   + IITEDSDLL FG  KV+ K+D  G  N +EI+     +   L + ++  KFRYMCI+SGCDY P + GIGL  A KLL+      +   + +I  Y KT I +    I   + A+ TF YQ+VFDPV  + +PLN Y  +VNP +LS+AG  + +  +  Q+A+G  D +  + I +Y     +L H+ QS
Sbjct:    1 MGIQGLLQFLKEASEPIHVKKYKGKTVAVDTYCWLHKGAFACAEKLAKGEPTDQYVQFCMKFVHMLLSFGVKPILVFDGCTLPSKKDVEKARREKRQTNLQKGKQLLREGKLAEARECFARSVNITSSMAHDVIKAARAEGIDCIVAPFEADSQLAYLNKNEFAEAIITEDSDLLAFGCKKVILKMDKFG--NGLEIDQARFGMCRSLGDVFTEEKFRYMCILSGCDYLPSIHGIGLAKACKLLKIANNPDITTVIKKIGQYLKTNITVPDGYIEGFLRANNTFLYQLVFDPVERKLIPLNPYGDDVNPEELSYAGPNMGD-SVALQIALGNMDINTMKQIDDYNPDNPQLSHRSQS 354          
BLAST of exonuclease 1-like vs. Ensembl Xenopus
Match: GEN1 (GEN1 Holliday junction 5' flap endonuclease [Source:HGNC Symbol;Acc:HGNC:26881])

HSP 1 Score: 68.5514 bits (166), Expect = 2.049e-11
Identity = 66/265 (24.91%), Postives = 114/265 (43.02%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKV-LKFPLEKYSYNKFRYMCIISGCDYFP-GLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSK 848
            MG+  L   L  + K + L  + G  +AVD   W+ +A M    K  +G     +L      I  L    +K++ V +G+    K+  ET  ++N   +         +   S  K    +CL     L ++       LG+  + A  EA+A  AYL  +  VD  IT D D+ L+G   V      N     ++  +++K+  +  L++    +   + I+ GCDY P G+ G+  + A KL+   ++L+    L R   + K
Sbjct:    1 MGVTDLWSILGPVKKHVPLESLAGKTLAVDLSIWVCEAQMV---KQMIGVVHKPHLRNLFFRISSLNLLGVKLVFVSEGEA--PKIKAETMSKRNEMRYGPSASAAPPKAGRSYFKSVLKECL-----LMLEC------LGIPWVQAAGEAEAMCAYLNAHGYVDGCITNDGDVFLYGAQTVYRNFTMNVKDPHVDCYEVSKIKAQLGLDR---EELVGLAILLGCDYLPKGVPGVRKVQALKLI---EMLNGESLLQRFYQWEK 243          
BLAST of exonuclease 1-like vs. Ensembl Xenopus
Match: GEN1 (GEN1 Holliday junction 5' flap endonuclease [Source:HGNC Symbol;Acc:HGNC:26881])

HSP 1 Score: 65.4698 bits (158), Expect = 1.068e-10
Identity = 65/265 (24.53%), Postives = 111/265 (41.89%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKV-LKFPLEKYSYNKFRYMCIISGCDYFP-GLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSK 848
            MG+  L   L  + K + L  + G  +AVD   W+ +A M    K  +G     +L      I  L    +K++ V +G+    K+  ET  ++N   +         +   S  K    +CL +              LG+  + A  EA+A  AYL  +  VD  IT D D+ L+G   V      N     ++  +++K+  +  L++    +   + I+ GCDY P G+ G+  + A KL++     SL    T +   +K
Sbjct:    1 MGVTDLWSILGPVKKHVPLESLAGKTLAVDLSIWVCEAQMV---KQMIGVVHKPHLRNLFFRISSLNLLGVKLVFVSEGEA--PKIKAETMSKRNEMRYGPSASAAPPKAGRSYFKSVLKECLLMLE-----------CLGIPWVQAAGEAEAMCAYLNAHGYVDGCITNDGDVFLYGAQTVYRNFTMNVKDPHVDCYEVSKIKAQLGLDR---EELVGLAILLGCDYLPKGVPGVRKVQALKLIEMLNGESLLQSCTSVTGSAK 246          
BLAST of exonuclease 1-like vs. Ensembl Xenopus
Match: fen1 (flap structure-specific endonuclease 1 [Source:NCBI gene;Acc:549759])

HSP 1 Score: 64.6994 bits (156), Expect = 1.451e-10
Identity = 81/271 (29.89%), Postives = 126/271 (46.49%), Query Frame = 3
Query:   60 MGIKGLLPYLKGIT-KEICLADIK---GCVVAVDTYGWLYKATMCCSDKIAL-----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCL-EISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANL-IEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINM 839
            MGI GL   +  +    I   DIK   G  VAVD    +Y+  +       +     GE T   +    R I++++ + IK + VFDGK    K G   KR + R     K ++   E    E  E F+K L +++ +   +  K+   +GV  + AP EA+A  A L K   V    TED D L FGTP +L  L  +    L I+   +N+V++      S+ +F  +CI+ G DY   + GIG   A  L++  Q  S+ + +  I++
Sbjct:    1 MGIHGLAKLIADVAPAAIKEHDIKSYFGRKVAVDASMCIYQFLIAVRQDGNMLQNEDGETTSHLMGMFYRTIRMIE-HGIKPVYVFDGKPPQMKSGELAKRSERRAEA-EKLLEAAEEAGEVENIEKFNKRLVKVTKQHNEECKKLLTLMGVPYVDAPCEAEATCAALVKAGKVYAAATEDMDALTFGTPVLLRHLTASEAKKLPIQEFHLNRVMQD--MGVSHEQFVDLCILLGSDYCETIRGIGPKRAIDLIR--QHKSIEEIVDNIDL 265          
BLAST of exonuclease 1-like vs. Ensembl Mouse
Match: Exo1 (exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427])

HSP 1 Score: 280.411 bits (716), Expect = 2.346e-84
Identity = 150/347 (43.23%), Postives = 221/347 (63.69%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDIN-KVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL +++  ++ + +   KG  VAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  Y +K IL+FDG  LP+K  VE  R++ R+S   KG + + E K SEA++CF + + I+H +A K+IK   +LGV C+VAPYEADAQLAYL K  IV  +ITEDSDLL FG  KV+ K+D  G  N +E++     + K   + ++  KFRYMCI+SGCDY   L GIGL  A K+L+      +   + +I  Y +  I + +D I   + A+ TF YQ+VFDP+  + VPLN Y  +VNP  L++AGQ + +  +  Q+A+G RD +  E I +Y  D
Sbjct:    1 MGIQGLLQFIQEASEPVNVKKYKGQAVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSYGVKPILIFDGCTLPSKKEVERSRRERRQSNLLKGKQLLREGKVSEARDCFARSINITHAMAHKVIKAARALGVDCLVAPYEADAQLAYLNKAGIVQAVITEDSDLLAFGCKKVILKMDQFG--NGLEVDQARLGMCKQLGDVFTEEKFRYMCILSGCDYLASLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLRMNITVPEDYITGFIRANNTFLYQLVFDPIQRKLVPLNAYGDDVNPETLTYAGQYVGD-SVALQIALGNRDVNTFEQIDDYSPD 344          
BLAST of exonuclease 1-like vs. Ensembl Mouse
Match: Exo1 (exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427])

HSP 1 Score: 192.2 bits (487), Expect = 2.257e-57
Identity = 104/225 (46.22%), Postives = 152/225 (67.56%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDIN-KVLKFPLEKYSYNKFRYMCIISG 731
            MGI+GLL +++  ++ + +   KG  VAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  Y +K IL+FDG  LP+K  VE  R++ R+S   KG + + E K SEA++CF + + I+H +A K+IK   +LGV C+VAPYEADAQLAYL K  IV  +ITEDSDLL FG  KV+ K+D  G  N +E++     + K   + ++  KFRYMCI+SG
Sbjct:    1 MGIQGLLQFIQEASEPVNVKKYKGQAVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSYGVKPILIFDGCTLPSKKEVERSRRERRQSNLLKGKQLLREGKVSEARDCFARSINITHAMAHKVIKAARALGVDCLVAPYEADAQLAYLNKAGIVQAVITEDSDLLAFGCKKVILKMDQFG--NGLEVDQARLGMCKQLGDVFTEEKFRYMCILSG 223          
BLAST of exonuclease 1-like vs. Ensembl Mouse
Match: Exo1 (exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427])

HSP 1 Score: 159.844 bits (403), Expect = 1.102e-45
Identity = 92/232 (39.66%), Postives = 129/232 (55.60%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDIN-KVLKFPLEKYSYNKFRYMCIISGCDYFPGL 752
            MGI+GLL +++  ++ + +   KG  VAVDTY WL+K  + C++K+A GE TD                                        + R+S   KG + + E K SEA++CF + + I+H +A K+IK   +LGV C+VAPYEADAQLAYL K  IV  +ITEDSDLL FG  KV+ K+D  G  N +E++     + K   + ++  KFRYMCI+SGCDY   L
Sbjct:    1 MGIQGLLQFIQEASEPVNVKKYKGQAVAVDTYCWLHKGAIACAEKLAKGEPTD----------------------------------------RRRQSNLLKGKQLLREGKVSEARDCFARSINITHAMAHKVIKAARALGVDCLVAPYEADAQLAYLNKAGIVQAVITEDSDLLAFGCKKVILKMDQFG--NGLEVDQARLGMCKQLGDVFTEEKFRYMCILSGCDYLASL 190          
BLAST of exonuclease 1-like vs. Ensembl Mouse
Match: Exo1 (exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427])

HSP 1 Score: 158.688 bits (400), Expect = 2.898e-45
Identity = 91/230 (39.57%), Postives = 128/230 (55.65%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDIN-KVLKFPLEKYSYNKFRYMCIISGCDYFP 746
            MGI+GLL +++  ++ + +   KG  VAVDTY WL+K  + C++K+A GE TD                                        + R+S   KG + + E K SEA++CF + + I+H +A K+IK   +LGV C+VAPYEADAQLAYL K  IV  +ITEDSDLL FG  KV+ K+D  G  N +E++     + K   + ++  KFRYMCI+SGCDY  
Sbjct:    1 MGIQGLLQFIQEASEPVNVKKYKGQAVAVDTYCWLHKGAIACAEKLAKGEPTD----------------------------------------RRRQSNLLKGKQLLREGKVSEARDCFARSINITHAMAHKVIKAARALGVDCLVAPYEADAQLAYLNKAGIVQAVITEDSDLLAFGCKKVILKMDQFG--NGLEVDQARLGMCKQLGDVFTEEKFRYMCILSGCDYLA 188          
BLAST of exonuclease 1-like vs. Ensembl Mouse
Match: Exo1 (exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427])

HSP 1 Score: 85.5001 bits (210), Expect = 9.184e-20
Identity = 37/85 (43.53%), Postives = 60/85 (70.59%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAK 314
            MGI+GLL +++  ++ + +   KG  VAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  Y +K IL+FDG  LP+K
Sbjct:    1 MGIQGLLQFIQEASEPVNVKKYKGQAVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSYGVKPILIFDGCTLPSK 85          
BLAST of exonuclease 1-like vs. UniProt/SwissProt
Match: sp|Q9UQ84|EXO1_HUMAN (Exonuclease 1 OS=Homo sapiens OX=9606 GN=EXO1 PE=1 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 4.197e-85
Identity = 156/347 (44.96%), Postives = 223/347 (64.27%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ I +   KG VVAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  + IK ILVFDG  LP+K  VE  R++ R++   KG + + E K SEA+ECF + + I+H +A K+IK   S GV C+VAPYEADAQLAYL K  IV  IITEDSDLL FG  KV+ K+D  G  N +EI+     +   L + ++  KFRYMCI+SGCDY   L GIGL  A K+L+      +   + +I  Y K  I + +D IN  + A+ TF YQ+VFDP+  + +PLN Y  +V+P  LS+AGQ +++  +  Q+A+G +D +  E I +Y  D
Sbjct:    1 MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFG--NGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDD-SIALQIALGNKDINTFEQIDDYNPD 344          
BLAST of exonuclease 1-like vs. UniProt/SwissProt
Match: sp|Q9W6K2|EXO1_XENLA (Exonuclease 1 OS=Xenopus laevis OX=8355 GN=exo1 PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.153e-84
Identity = 152/358 (42.46%), Postives = 221/358 (61.73%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD------HKIQS 1112
            MGI+GLL +LK  ++ + +   KG  VAVDTY WL+K    C++K+A GE TD Y+ +C++ + +L  + +K ILVFDG  LP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A ++IK   S GV  IVAPYEAD+QLAYL KN   + IITEDSDLL FG  KVL K+D  G  N +EI+     +   L + ++  KFRYMCI+SGCDY P + GIGL  A KLL+      +   + +I  Y KT I + +  I   + A+ TF YQ+VFDPV  + +PLN Y  +VNP +L++AG  + +  +  Q+A+G  D + ++ I +Y  D      H+ QS
Sbjct:    1 MGIQGLLQFLKEASEPVHVKKYKGKTVAVDTYCWLHKGAFACAEKLAKGEPTDQYVQFCMKLVHMLLSFGVKPILVFDGCTLPSKKDVEKARREKRQTNLQKGKQLLREGKLAEARECFSRSVNITSSMAHEVIKAARSEGVDYIVAPYEADSQLAYLNKNDFAEAIITEDSDLLAFGCKKVLLKMDKFG--NGLEIDQARFGMCRSLGDVFTEEKFRYMCILSGCDYLPSIHGIGLAKACKLLKVANNPDITKVIQKIGQYLKTNITVPEGYIEGFLRANNTFLYQLVFDPVERKLIPLNPYGNDVNPEELNYAGPNMGD-SVALQIALGNMDINTRKQIDDYNPDIPQLSHHRSQS 355          
BLAST of exonuclease 1-like vs. UniProt/SwissProt
Match: sp|Q9QZ11|EXO1_MOUSE (Exonuclease 1 OS=Mus musculus OX=10090 GN=Exo1 PE=2 SV=2)

HSP 1 Score: 280.411 bits (716), Expect = 1.641e-83
Identity = 150/347 (43.23%), Postives = 221/347 (63.69%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDIN-KVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL +++  ++ + +   KG  VAVDTY WL+K  + C++K+A GE TD Y+ +C++++ +L  Y +K IL+FDG  LP+K  VE  R++ R+S   KG + + E K SEA++CF + + I+H +A K+IK   +LGV C+VAPYEADAQLAYL K  IV  +ITEDSDLL FG  KV+ K+D  G  N +E++     + K   + ++  KFRYMCI+SGCDY   L GIGL  A K+L+      +   + +I  Y +  I + +D I   + A+ TF YQ+VFDP+  + VPLN Y  +VNP  L++AGQ + +  +  Q+A+G RD +  E I +Y  D
Sbjct:    1 MGIQGLLQFIQEASEPVNVKKYKGQAVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSYGVKPILIFDGCTLPSKKEVERSRRERRQSNLLKGKQLLREGKVSEARDCFARSINITHAMAHKVIKAARALGVDCLVAPYEADAQLAYLNKAGIVQAVITEDSDLLAFGCKKVILKMDQFG--NGLEVDQARLGMCKQLGDVFTEEKFRYMCILSGCDYLASLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLRMNITVPEDYITGFIRANNTFLYQLVFDPIQRKLVPLNAYGDDVNPETLTYAGQYVGD-SVALQIALGNRDVNTFEQIDDYSPD 344          
BLAST of exonuclease 1-like vs. UniProt/SwissProt
Match: sp|Q24558|EXO1_DROME (Exonuclease 1 OS=Drosophila melanogaster OX=7227 GN=tos PE=1 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 2.686e-83
Identity = 135/347 (38.90%), Postives = 214/347 (61.67%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTK-IIISKDEINQAVEADLTFQYQIVFDPVSCRQ---VPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNY 1088
            MGI GL+P++   + ++ L DI+G  VAVDTY WL+K    C++K+A GEDTD+Y+ YC++Y+ +L  YDIK ILVFDG++LPAK   E +R+ +R+  + +  + +   +  EA+    +C++++H +A++LI+   S  V CIVAPYEADAQ+A+L +  +  YIITEDSDL LFG   ++FKLD NG   L+E   ++  +    EKY ++KFR MCI+SGCDY   L GIGL  A K + KT+   +   L +I  Y   + + +  D I   ++A+ TF++  +++P+  R      L +Y  +      S AG ++E+ E    LA+G  +P + + + ++
Sbjct:    1 MGITGLIPFVGKASSQLHLKDIRGSTVAVDTYCWLHKGVFGCAEKLARGEDTDVYIQYCLKYVNMLLSYDIKPILVFDGQHLPAKALTEKRRRDSRKQSKERAAELLRLGRIEEARSHMRRCVDVTHDMALRLIRECRSRNVDCIVAPYEADAQMAWLNRADVAQYIITEDSDLTLFGAKNIIFKLDLNGSGLLVEAEKLHLAMGCTEEKYHFDKFRRMCILSGCDYLDSLPGIGLAKACKFILKTEQEDMRIALKKIPSYLNMRNLEVDDDYIENFMKAEATFRHMFIYNPLERRMQRLCALEDYETDER--YCSNAGTLLEDSEQALHLALGNLNPFSMKRLDSW 345          
BLAST of exonuclease 1-like vs. UniProt/SwissProt
Match: sp|Q803U7|EXO1_DANRE (Exonuclease 1 OS=Danio rerio OX=7955 GN=exo1 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 4.395e-82
Identity = 161/440 (36.59%), Postives = 249/440 (56.59%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKS--KKSDK-----ESFFNQNVK----------VTKRTPMTKEKKMQVQCQ---FPWKHAS----KPDTEIDFSQIFDIYT 1307
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD Y++YC++++ +L  + +K ILVFDG+NLP+K  VE  R++ R++   KG + + E K +EA+ECF + + I+  +A  +I+   + GV C+VAPYEADAQLA+L K+ I   +ITEDSDLL FG  KV+ K+D  G    IE   + +        ++  KFRYMCI+SGCDY   L GIGL  A KLL+      +   + ++  Y K  I + ++ I    +A+ TF YQ+VFDP+  + VPLN Y  ++NP+ LS+AG  + + E   Q+A+G  D +  + I ++  D   Q+  P    + S   + DK      S ++QN +            KR P T+ K+  V  Q    P + +     + DT +    + + YT
Sbjct:    1 MGIQGLLQFIKDASEPMHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVDMLLSFGVKPILVFDGRNLPSKQEVEKSRRERRQANLQKGKQLLREGKITEARECFTRSVNITPSMAHDVIRAARTRGVDCVVAPYEADAQLAFLNKSDIAQAVITEDSDLLAFGCKKVILKMDKQGNGLEIEQCHLGRCKSL-GNIFTEEKFRYMCILSGCDYLQSLYGIGLGKACKLLRMANNPDILKVIKKMGQYLKMDISVPEEYIEGFTKANNTFLYQLVFDPLRRKVVPLNPYPDHINPAALSYAGTNVGD-EKGLQMALGNLDINTMQRIDDFNPDAP-QTQPPKAPRSSSWNDRCDKTATTQASIWSQNYEPGCTKSQSPTSPKRPPPTRGKERIVSVQSLKLPQRESQVKRPREDTSLSVDDLLEQYT 437          
BLAST of exonuclease 1-like vs. TrEMBL
Match: V3Z9S6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127400 PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 2.386e-102
Identity = 158/346 (45.66%), Postives = 234/346 (67.63%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLLP+LK I K + ++  KGC VA+D Y WL+K    C+DK+ALGE T++Y+ YC++Y+  L   DIK ILVFDG +LP+K  VE  R++ RE +R K  +++   + +EA++C  KC++I+ ++A++L+    + GV CIVAPYEADAQLAYL K  I   IITEDSDLLLFG  KV+FK+DF+G   LIE  D+N+VL+     Y+++KFR MC++SGCDY P L GIGL TA K+ +KT+L  +   L +++ Y K  ++++ D I++ ++A+ TF YQ+ FDP+  R VPLN Y  +V+ +++ +AG    + E   ++A+G  D      I +Y  D
Sbjct:    1 MGIQGLLPFLKKIHKPMNISQFKGCTVAIDAYCWLHKGAFSCADKLALGEKTEMYVYYCMKYVDYLLKADIKPILVFDGCHLPSKKDVEKSRRERRELYRKKAAEYLRAGQRAEARDCLQKCIDITPQMALELMNTCRNKGVDCIVAPYEADAQLAYLNKTGIAQVIITEDSDLLLFGCDKVMFKMDFHGNGMLIEQKDLNQVLEINQGFYTFDKFRQMCVLSGCDYLPSLPGIGLATACKVFKKTRLTDMRMLLKKLSSYLKKNVVVTDDYIDKFIQAENTFLYQLCFDPIKRRLVPLNPYEPDVDQNNIKYAGSYCSD-ERALEIALGNIDIYTGGTIHDYNPD 345          
BLAST of exonuclease 1-like vs. TrEMBL
Match: A0A3S0ZF14 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016133 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.601e-95
Identity = 155/330 (46.97%), Postives = 220/330 (66.67%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIG 1049
            MGI+GLLP+LK I + + ++D KGC VAVD Y WL+K    C++K+A+GE TD Y+ YC++Y+  L    +K ILVFDG +L +K  VE  R+  RE  R K  +F+ E K SEAK+C  KC++I+ ++A+ L+ +    GV CIVAPYEADAQLA+L  + I   ++TEDSDLLLFG  KV+FK+DF G   LIE + +N+VL      YS+ KFRYMCI+SGCDY P L GIGL+ A K+L+  +   L   L ++  Y K  ++++++ + + + AD TF YQ+V+DP+  R  PLN Y   V+P +L +AGQ +   E  +QLA+G
Sbjct:    1 MGIQGLLPFLKKIHQPVNISDFKGCTVAVDAYCWLHKGAFSCAEKLAMGEKTDQYVYYCMKYVDYLLRKGLKPILVFDGCHLKSKEDVEKTRRGRRELNRKKAAQFLREGKKSEAKDCLQKCVDITPQMALNLMNVCRDRGVDCIVAPYEADAQLAFLSLSGIAQLVVTEDSDLLLFGCDKVIFKMDFFGNGVLIEKSRLNEVLAIQNSFYSFEKFRYMCILSGCDYLPSLPGIGLVKACKVLKTARQQELRLLLKKLPTYLKMNLVVTEEYVEKFIRADNTFLYQLVYDPLRRRMAPLNPYPPEVDPGELHYAGQYMPE-EKAYQLALG 329          
BLAST of exonuclease 1-like vs. TrEMBL
Match: A0A0L8HBQ1 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22018276mg PE=4 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 2.220e-92
Identity = 157/376 (41.76%), Postives = 233/376 (61.97%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFNQNVKV 1187
            MGI GLLP+LK I     ++  +G  VAVD Y WL+K    C++K+A GEDTD Y+ YC++Y+  +   ++K ILVFDG +LP+K  VE  R++ R+ +R K  +F+ E K SEA+EC  +C++I+  +A KLI++    G+ CIVAPYEADAQLAYL ++ I   I+TEDSDLLLFG  KV+FK+D  G   +IE + +N+V+      Y+++KFR+MCI+SGCDY   L GIGL  A K+ +  +   L   L +I  Y      +  D I   + A+ TF YQ++FDP++ + VPLN Y+ ++ P DL +AG+ I   E  F +A+G  D   ++ +S++  D  + S   V   AK       S +N+N ++
Sbjct:    1 MGITGLLPFLKKIHVPTNISQFQGATVAVDVYCWLHKGAFSCAEKLAFGEDTDQYIYYCMKYVNFMISKNLKPILVFDGCHLPSKKDVEDSRRERRKVYRQKAAQFLKEGKRSEARECLQRCVDITPDMARKLIEVCQKQGIDCIVAPYEADAQLAYLAQSGIAQIIVTEDSDLLLFGCDKVIFKMDLYGNGIMIEKSRLNEVVDIRDGFYTFSKFRHMCILSGCDYLSSLPGIGLANACKVFKLARQADLRQLLRKIPSYLNKSFSVPNDYIEGFIRAENTFLYQLIFDPLTRKLVPLNPYAEDLRPDDLHYAGEYIPTSE-AFNIALGNTDIQTRKKLSSFNPDTDLNSGPEV--AAKYNGPHMLSIWNRNYRI 373          
BLAST of exonuclease 1-like vs. TrEMBL
Match: A0A0P5E400 (Exonuclease OS=Daphnia magna OX=35525 GN=APZ42_020348 PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 8.962e-92
Identity = 153/358 (42.74%), Postives = 226/358 (63.13%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKII-ISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFY 1130
            MGI GLLP+LK  +    +   KG  VA+D Y WL+K   CC+DK+  GE TD+Y+ YC+++I +L  +DIK ILVFDG+ LP+KLG E KR++NRE  + +  +++ +   S+A+ECF KC++++  +A++L+K+  +  + CIVAPYEADAQLAYL    I   IITEDSDLL FG P+VLFK+D NG   LIE + +   L    E ++  KFR MCI+SGCDY P L GIGL  A K    +    +N  L ++    K   + I+++   + ++A+ TF YQ+++DP   + +PL  Y  N++P  L FAGQ I++ ++ FQLAIG  D    E + +Y+ D  ++     F+
Sbjct:    1 MGISGLLPFLKKSSVNCNVQQFKGKTVAIDAYCWLHKGAFCCADKLVKGEKTDMYVTYCMKFINMLISHDIKPILVFDGQPLPSKLGTELKRRENRERNKIQAREYLRQGNNSKARECFQKCVDVTSTMALELMKVCRARNIDCIVAPYEADAQLAYLAVQGIAHLIITEDSDLLAFGCPRVLFKMDQNGSGVLIEKDKLFLSLGGRAEFFNDEKFRRMCILSGCDYLPSLKGIGLGKAFKFFSGSTNSDINSLLCQVPGCLKMPTLEITREYREEFIKAEQTFLYQLIYDPQQRKLIPLTPYPPNLDPLSLPFAGQYIKD-DVAFQLAIGNLDAETLERLDSYDPDAMVEKRNRSFF 357          
BLAST of exonuclease 1-like vs. TrEMBL
Match: A0A1S3I8U7 (exonuclease 1-like OS=Lingula unguis OX=7574 GN=LOC106161808 PE=4 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.286e-91
Identity = 151/346 (43.64%), Postives = 228/346 (65.90%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLLP+L+ + +E+ L D KGC VAVD Y WL+K    C++K+A+GE TD Y+ YC++++  +  +DIK +LVFDG +LP+K  VE  R++ R+++R K  +F+ E K SEA++C ++C++I+ ++A++L+K     GV CIVAPYEAD+QLAYL K  +   IITEDSDLLLFG  +VL+KLD NG   +IE   + +         ++ KFR+MCI+SGCDY P L GIGL  AAK+++K +   +   L +++ Y K    + ++ I+   +A+ TF YQ+VFDP+  R  PLN +   +NP DL +AG    N    +Q+A+G  +  N E + +Y+ D
Sbjct:    1 MGIQGLLPFLRDVQREVNLKDYKGCTVAVDAYCWLHKGAFACAEKLAVGEKTDQYVYYCMKFVNAMLSWDIKPVLVFDGCHLPSKKEVERTRRERRDAYRKKAAQFLREGKKSEARQCLERCIDITPQMALELMKACREKGVDCIVAPYEADSQLAYLNKIGVAQIIITEDSDLLLFGCERVLYKLDVNGNGIMIEKERLGEAASLKNSFCTFEKFRHMCILSGCDYLPSLRGIGLGNAAKIIKKAKNPDMTKVLRKLSTYLKNAPEVPQEYIDGFTQAENTFLYQVVFDPLQRRLAPLNPFPDGMNPKDLEYAGAYFCNGR-AYQIALGNINIYNGERMDDYDPD 345          
BLAST of exonuclease 1-like vs. Ensembl Cavefish
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:103044915])

HSP 1 Score: 281.182 bits (718), Expect = 4.417e-85
Identity = 146/347 (42.07%), Postives = 223/347 (64.27%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD Y++YC++++ +L  + +K ILVFDG+NLP+K  VE  R++ RE+   KG + + + K SEA++CF +C+ ++  +A ++IK   + GV C+VAPYEADAQLA+L K+ I   +ITEDSDLL FG  KVL K+D  G  N +EI+  +      L + ++  KFRYMCI+SGCDY   L GIGL  A KLL+      +   + +I  Y K  I + ++ +   V+A+ TF YQ+VFDP++ + VPLN Y  N++ S LS+AG  + +++   Q+A+G  D    + I N++ D
Sbjct:    1 MGIQGLLQFIKDASEPVHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVSYCMKFVDMLLSFGVKPILVFDGRNLPSKQEVEKARRERREANLQKGKQLLRQGKLSEARDCFTRCVNVTPTMAHEVIKAARTRGVDCVVAPYEADAQLAFLNKSGIAHAVITEDSDLLAFGCKKVLLKMDKQG--NGLEIDQCHLGRCRSLGDIFTEEKFRYMCILSGCDYLASLYGIGLGKACKLLRMANNPDILKVIRKIGQYLKMNITVPEEYVEGFVKANNTFLYQLVFDPINRKVVPLNPYPENIDLSTLSYAGVNVGDKQ-GLQMALGNVDIYTMKRIDNFDPD 344          
BLAST of exonuclease 1-like vs. Ensembl Cavefish
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:103044915])

HSP 1 Score: 220.705 bits (561), Expect = 4.946e-63
Identity = 129/347 (37.18%), Postives = 193/347 (55.62%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPL-EKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            MGI+GLL ++K  ++ + +   +G  VAVDTY WL+K    C++K+A GE TD                                        Q RE+   KG + + + K SEA++CF +C+ ++  +A ++IK   + GV C+VAPYEADAQLA+L K+ I   +ITEDSDLL FG  KVL K+D  G  N +EI+  +      L + ++  KFRYMCI+SGCDY   L GIGL  A KLL+      +   + +I  Y K  I + ++ +   V+A+ TF YQ+VFDP++ + VPLN Y  N++ S LS+AG  + +++   Q+A+G  D    + I N++ D
Sbjct:    1 MGIQGLLQFIKDASEPVHVKKYRGQTVAVDTYCWLHKGAFSCAEKLAKGEPTD----------------------------------------QRREANLQKGKQLLRQGKLSEARDCFTRCVNVTPTMAHEVIKAARTRGVDCVVAPYEADAQLAFLNKSGIAHAVITEDSDLLAFGCKKVLLKMDKQG--NGLEIDQCHLGRCRSLGDIFTEEKFRYMCILSGCDYLASLYGIGLGKACKLLRMANNPDILKVIRKIGQYLKMNITVPEEYVEGFVKANNTFLYQLVFDPINRKVVPLNPYPENIDLSTLSYAGVNVGDKQ-GLQMALGNVDIYTMKRIDNFDPD 304          
BLAST of exonuclease 1-like vs. Ensembl Cavefish
Match: zgc:110269 (zgc:110269 [Source:NCBI gene;Acc:550274])

HSP 1 Score: 63.5438 bits (153), Expect = 1.497e-10
Identity = 52/180 (28.89%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  264 YDIKVILVFDGKNLPAKLGVETKRQQN---RESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQK 794
            +DIK + VFDGK    K  V  KR Q+     S+RS      +  KT E                   +++   +G+  I+AP + +A  A+L +  +VD + +ED D L FG   +L +L+    + + E   + K+L+    + +  +F  +CI+ GCDY   + G+G   A KL+Q+
Sbjct:   43 HDIKPVFVFDGKPPNQKKAVLEKRAQSAGWNSSYRSN----TVSTKTQE------------------FLRLVQLMGMPFIMAPADGEALCAHLVRGGVVDAVASEDMDTLAFGGTTLLRQLNAKRDSEVTEYY-LPKLLE--TLQLTQEEFVDLCILLGCDYCDKITGLGPSRALKLIQQ 197          
BLAST of exonuclease 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000001764.2 (GEN1 Holliday junction 5' flap endonuclease [Source:NCBI gene;Acc:103041329])

HSP 1 Score: 64.3142 bits (155), Expect = 2.085e-10
Identity = 66/253 (26.09%), Postives = 109/253 (43.08%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYL-NYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFR----SKGMKFILERKTSEA--KECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKV-LKFPLEKYSYNKFRYMCIISGCDYFP-GLAGIGLITAAKLLQ 791
            MG+  L   L  + + + L  + G  +AVD   W+ +A      +  +G  T  +L N   R   LL+   +K++ V +G+    K+  ET  ++   +FR      G K      T     K    +C E+              LGV  + A  EA+A  A+L    +VD  IT D D  L+G   V    + N     I+   +++V  +  L++ +      + ++ GCDY P G+AG+G     KL+Q
Sbjct:    1 MGVNELWSILNPVRESVPLYSLTGRTLAVDLSLWICEAQHV---QAMMGRVTKPHLRNLFFRVSSLLRM-GVKLVFVMEGEA--PKIKAETISKRTEGAFRRGKTESGPKQAKTTNTGRGRFKAVLRECAEMLD-----------CLGVPWVAAAGEAEAMCAFLDAQGLVDGCITSDGDAFLYGAQTVYRNFNMNTKDPQIDCYKMSRVETELQLKRET---LVGLAVLLGCDYIPKGVAGVGKEQTLKLIQ 233          
BLAST of exonuclease 1-like vs. Ensembl Cavefish
Match: zgc:110269 (zgc:110269 [Source:NCBI gene;Acc:550274])

HSP 1 Score: 60.8474 bits (146), Expect = 8.475e-10
Identity = 59/236 (25.00%), Postives = 94/236 (39.83%), Query Frame = 3
Query:  108 ICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQN---RESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLL 806
            +C+  + G V+A+DT   +      C     L   T  +L +           DIK + VFDGK    K  V  KR Q+     S+RS      +  KT E                   +++   +G+  I+AP + +A  A+L +  +VD + +ED D L FG   +                         L   + N F  +CI+ GCDY   + G+G   A KL+Q+ + +
Sbjct:    4 LCVFCVVGKVIALDTSIVVTSFAQLCPSSTRLFYRTLTFLEH-----------DIKPVFVFDGKPPNQKKAVLEKRAQSAGWNSSYRSN----TVSTKTQE------------------FLRLVQLMGMPFIMAPADGEALCAHLVRGGVVDAVASEDMDTLAFGGTTL-------------------------LRHTTINTFVDLCILLGCDYCDKITGLGPSRALKLIQQHRTI 181          
BLAST of exonuclease 1-like vs. Ensembl Sea Lamprey
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:406778])

HSP 1 Score: 227.254 bits (578), Expect = 1.533e-68
Identity = 118/292 (40.41%), Postives = 182/292 (62.33%), Query Frame = 3
Query:  222 YLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELD 1097
            Y+ YC+++I++L   D+K ILVFDG  LP+K  VE  R++ R+    KG + + E K SEA+ CF +C+ ++ ++A+++IK   + GV CIVAPYEADAQLAYL +  I   +ITEDSDLL FG  KV+ K+D +G    I  + + +V       ++  KFR+MCI+SGCDY P + GIGL+ A+K+L+ +   ++   + ++  Y K  + + ++ I   V A+ TF+YQ+VFDP+S +  PLN Y  +++ S LS+AG       L  Q+A+G  D +    I N+  D
Sbjct:    2 YVFYCVKFIEMLLGCDVKPILVFDGCMLPSKKEVEKSRRERRQVNLQKGKQLLREGKVSEARACFTRCINVTPQMALEVIKAARARGVDCIVAPYEADAQLAYLNRAGIAQAVITEDSDLLAFGCDKVILKMDQSGNGVEISRSRLGRVTHLG-NYFTEEKFRHMCILSGCDYLPSIPGIGLVKASKVLKLSNNPNVVKVIRKMGHYLKMNVTVPEEYIEGFVRAENTFRYQLVFDPISRQLCPLNPYPEDLDSSQLSYAGAYPFKALLALQIALGNIDINTMIKIDNFNPD 292          
BLAST of exonuclease 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009136.1 (pep scaffold:Pmarinus_7.0:GL481492:10436:20158:-1 gene:ENSPMAG00000008254.1 transcript:ENSPMAT00000009136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 9.491e-8
Identity = 49/201 (24.38%), Postives = 84/201 (41.79%), Query Frame = 3
Query:  246 IKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRY-----------MCIISGCDYFP-GLAGIGLITAAKLLQKTQLLSL 812
            + LL    ++++ V +G     K G+  +R + R    ++      +  +  A+    +C    H    +L+    SLG+ C+ A  E +A  A L    +V    T+D D  L+G   V     + GLA     + +       +E+Y  ++ R            + ++ GCDY P G+ GIG   A KL+   Q  SL
Sbjct:    7 VSLLCRLGLRLVFVVEGDAPALKAGMMAQRNEARFGPSARNKPRTAQGDSQRAERGRLRC-SSRHNQCCELLS---SLGLPCLQAAGEGEALCAALDAAGLVHGCFTDDGDAFLYGARTV-----YRGLA---ASDQVPSYTDPHVERYCVDRIRRELGLDRDALIGLAVLLGCDYLPKGVKGIGKELALKLIHSLQGESL 195          
BLAST of exonuclease 1-like vs. Ensembl Sea Lamprey
Match: fen1 (flap structure-specific endonuclease 1 [Source:NCBI gene;Acc:386707])

HSP 1 Score: 49.6766 bits (117), Expect = 4.006e-7
Identity = 45/147 (30.61%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  498 APYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRIN----------MYSKTKIIISKDEINQAVEADLTF 908
            AP EA+A  A L K   V    TED D L FGT  VL +      A  + I + +        K S+++F  +CI+ GCDY   + GIG   A +L++  Q   +   L  I+          +Y + + +  K E+  A E DL +
Sbjct:    1 APCEAEASCAALVKAGKVFATATEDMDGLTFGT-GVLLRHLTASEAKKLPIQEFHFTKLLEEIKLSHDEFIDLCILLGCDYCETIRGIGPKRAIELVR--QYKRIEAILQHIDTKKYPVPDNWLYQEARQLFLKPEVVDAEEVDLKW 144          
BLAST of exonuclease 1-like vs. Ensembl Yeast
Match: EXO1 (5'-3' exonuclease and flap-endonuclease; involved in recombination, double-strand break repair, MMS2 error-free branch of the post replication (PRR) pathway and DNA mismatch repair; role in telomere maintenance; member of the Rad2p nuclease family, with conserved N and I nuclease domains; relative distribution to the nucleus increases upon DNA replication stress; EXO1 has a paralog, DIN7, that arose from the whole genome duplication [Source:SGD;Acc:S000005559])

HSP 1 Score: 186.808 bits (473), Expect = 6.210e-52
Identity = 110/303 (36.30%), Postives = 175/303 (57.76%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKL-DFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRI--NMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLN 959
            MGI+GLLP LK I   + L   +G V+A+D Y WL++A   C+ ++A+G+ TD YL + I+   LL+ + ++  LVFDG  +P K   E+KR+  R+  ++   +     +   A + F KC++I+ ++A  +I      G++ IVAP+EAD+Q+ YL +  IV  II+EDSDLL+FG  +++ KL D+     +   N I    KFPL   +  +   M  +SGCDY  G+  +GLITA KL+++       + + RI  ++  + K++I    IN+   A L FQ+Q VF P+  + V LN
Sbjct:    1 MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKLVRRF------NTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLN 297          
BLAST of exonuclease 1-like vs. Ensembl Yeast
Match: DIN7 (Mitochondrial nuclease functioning in DNA repair and replication; modulates the stability of the mitochondrial genome, induced by exposure to mutagens, also induced during meiosis at a time nearly coincident with commitment to recombination; DIN7 has a paralog, EXO1, that arose from the whole genome duplication [Source:SGD;Acc:S000002671])

HSP 1 Score: 171.4 bits (433), Expect = 3.376e-48
Identity = 116/351 (33.05%), Postives = 189/351 (53.85%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLK-FPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQ 1109
            MGI GLLP LK I K++ L       +A+D Y WL++A+  C+ ++ + + T+ YL + I+ ++LL+   IK  +VFDG +L  K   ET+R++ R        K         A E F K ++I+ ++A  +I       +  IVAP+EAD Q+ YL K  ++  II+EDSDLL+FG   ++ KL+  G A  I  +D + + + FPL + S  +FR +  ++GCDY  G+  +G++TA K++++     + D L +I      K+  SK    Q   A+  FQYQ VF P+S +   LNN    V  S      +I++    V +   G+R    +++I+   +DHK+ 
Sbjct:    1 MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMNKPTNKYLQFFIKRLQLLKRLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYFQKSVDITPEMAKCIIDYCKLHSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDLLVFGCKTLITKLNDQGKALEISKDDFSALPENFPLGELSEQQFRNLVCLAGCDYTSGIWKVGVVTAMKIVKRYS--EMKDILIQIE--RTEKLCFSKAFKQQVEFANYAFQYQRVFCPLSNQITTLNNIPKAVTNSHAEII-KIMKCIGSVVERGSGVR----KDVINTKNIDHKVH 342          
BLAST of exonuclease 1-like vs. Ensembl Yeast
Match: RAD27 (5' to 3' exonuclease, 5' flap endonuclease; required for Okazaki fragment processing and maturation, for long-patch base-excision repair and large loop repair (LLR), ribonucleotide excision repair; member of the S. pombe RAD2/FEN1 family; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000001596])

HSP 1 Score: 75.0998 bits (183), Expect = 4.605e-15
Identity = 76/254 (29.92%), Postives = 118/254 (46.46%), Query Frame = 3
Query:   60 MGIKGLLPYL-KGITKEICLADIK---GCVVAVDTYGWLYKATMCCSDKIA------LGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQ 791
            MGIKGL   + + +   I  +DIK   G  VA+D    LY+  +    +         GE T   +    R ++++    IK   VFDGK    K    TKR   R     K  +   E +  + +    K  +  ++ A KL+ +   +G+  I+AP EA+AQ A L K   V    +ED D L + TP +L  L F+  A    I++I+  L       +  +F  +CI+ GCDY   + G+G +TA KL++
Sbjct:    1 MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGETTSHLMGMFYRTLRMID-NGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTELEKMKQERRLVKVSKEHNEEAQKLLGL---MGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYRTPFLLRHLTFSE-AKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVGPVTALKLIK 249          
BLAST of exonuclease 1-like vs. Ensembl Yeast
Match: RAD2 (Single-stranded DNA endonuclease; cleaves single-stranded DNA during nucleotide excision repair to excise damaged DNA; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPG protein [Source:SGD;Acc:S000003490])

HSP 1 Score: 57.3806 bits (137), Expect = 4.212e-9
Identity = 46/164 (28.05%), Postives = 83/164 (50.61%), Query Frame = 3
Query:  330 KRQQNRESFRSKGMKFILERKTSE----AKECFDKCL-------EISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLL 788
            K Q+  ++F++  +    ER  +E      E F++ +       E++  +  ++ ++    G+  I AP EA+AQ A L +  +VD IIT+DSD+ LFG  K+ +K  F+   N +E  D   +LK  L          +  + G DY  GL G+G +++ +++
Sbjct:  722 KEQEEFDTFKNTTLSTSAERNVAENAFVEDELFEQQMKDKRDSDEVTMDMIKEVQELLSRFGIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKI-YKNMFHE-KNYVEFYDAESILK--LLGLDRKNMIELAQLLGSDYTNGLKGMGPVSSIEVI 881          
BLAST of exonuclease 1-like vs. Ensembl Yeast
Match: YEN1 (Holliday junction resolvase; promotes template switching during break-induced replication (BIR), causing non-reciprocal translocations (NRTs); localization is cell-cycle dependent and regulated by Cdc28p phosphorylation; homolog of human GEN1; similar to S. cerevisiae endonuclease Rth1p [Source:SGD;Acc:S000000843])

HSP 1 Score: 47.3654 bits (111), Expect = 5.527e-6
Identity = 59/275 (21.45%), Postives = 113/275 (41.09%), Query Frame = 3
Query:  126 KGCVVAVDTYGWLYKATMCCSDKIALGE------------DTDI------------------YLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKC---LEISHKLAVKLI-KIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVL-----FKLDF--------------NGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQ 791
            +   +A+D YGWL++     +  I+               D+DI                   +N+  R  +LL   +++ +LVFDG   P+    +   +QN  +   +   +    +  +  E +  C   L  S    + L+ K+   + +  ++A  E +AQ  +L  +  VD+I++ DSD L+FG  K+L     F  DF              +   + + + D+ K+ K   +K+      +  ++ G DY  G+ G+G   + +L Q
Sbjct:   34 RAPRIAIDAYGWLFECGFIQNIDISARSRSRSRSPTRSPRDSDIDSSQEYYGSRSYTTTGKAVINFISRLKELLSL-NVEFLLVFDGVMKPS-FKRKFNHEQNATTCDDEKEYYSSWEQHVKNHEVYGNCKGLLAPSDPEFISLVRKLLDLMNISYVIACGEGEAQCVWLQVSGAVDFILSNDSDTLVFGGEKILKNYSKFYDDFGPSSITSHSPSRHHDSKESFVTVIDLPKINKVAGKKFDRLSLLFFSVLLGADYNRGVKGLGKNKSLQLAQ 306          
BLAST of exonuclease 1-like vs. Ensembl Nematostella
Match: EDO31577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI5])

HSP 1 Score: 264.618 bits (675), Expect = 1.049e-84
Identity = 131/303 (43.23%), Postives = 200/303 (66.01%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLS---LNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLN 959
            MGI+GLLP LK I + + +++ KG  V VD Y WL+K    C+  +  G+ T +Y+NY ++ I ++ F+D+K +LVFDG  LP+K   E +R+++R   ++ G+ F+     ++A+ECF KC++IS  +A+++IK+  S GV CIVAPYEADAQLAYL K  I+  +I+EDSDLL++G  KV+FK+D +G   L+ ++ ++++    + +++  KFR+MCI+SGCDY P + GIGLI A KLL+ +  ++   +N  L R N+    +  +  D      +AD TF YQ VFDPVSC  VPLN
Sbjct:    1 MGIQGLLPLLKPIHRSVNISEFKGQTVGVDAYCWLHKGAYGCAMDLVEGKKTTVYINYVLKRINMMLFHDVKPVLVFDGAYLPSKANKEAERRKSRNENKANGLAFLRAGNRAKAQECFQKCVDISPDMALEVIKMCRSKGVDCIVAPYEADAQLAYLMKKNIIQAVISEDSDLLVYGCKKVMFKMDASGYGTLVSLDHLSELTNLKMHEFTLEKFRHMCILSGCDYLPSIKGIGLIKANKLLRNSSNINKACINLTLVR-NLRMDDQYRVPVDYEKSFKQADETFLYQRVFDPVSCELVPLN 302          
BLAST of exonuclease 1-like vs. Ensembl Nematostella
Match: EDO45269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTI4])

HSP 1 Score: 78.1814 bits (191), Expect = 2.584e-16
Identity = 74/249 (29.72%), Postives = 115/249 (46.18%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKT--SEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDF--NGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQK 794
            MG+KGL   L+ + K + L  ++G V+AVD    + +A     D                R  KLL FY +K + VFDG  +P    V  K+   R            E++T  SE         E+S ++  +  ++    GV  +V+P EA+AQ A+L      D  IT+DSD+ LFG  +V +K  F  N  A      DI+K L       S +K   +  ++G DY  G+ G+G ++A ++L +
Sbjct:    1 MGVKGLWQLLEPVGKPVTLESLQGKVLAVDASILMNQAIKGMRDGSGNPVPNAHLFVLFHRLCKLL-FYRVKPVFVFDG-GVP----VLKKKTLVRAYLEEMQTNLNREQRTLQSERARQARASAEVSTEMLNESQELLRLFGVPFLVSPMEAEAQCAFLDMTGQTDGTITDDSDVFLFGGRRV-YKNIFNQNKHAECYTCEDIDKGLAL-----SRSKMIKLAFVTGSDYTEGIQGLGAVSAMEVLHE 237          
BLAST of exonuclease 1-like vs. Ensembl Nematostella
Match: FEN1 (Flap endonuclease 1 [Source:UniProtKB/Swiss-Prot;Acc:A7RRJ0])

HSP 1 Score: 73.1738 bits (178), Expect = 5.136e-14
Identity = 85/314 (27.07%), Postives = 138/314 (43.95%), Query Frame = 3
Query:   60 MGIKGLLPYLKGIT----KEICLADIKGCVVAVDTYGWLYKATMCC-SDKIAL----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHS-----------LGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRIN----------MYSKTKIIISKDEINQAVEADLTFQ 911
            MGI+GL   L  I     KE  + +  G  +A+D    +Y+  +   SD   L    GE T   +    R I++++   IK + VFDGK    K G   KR + RE           ++  S+A+E  D   E   K + +L+++              +G+  + AP EA+AQ A L K+  V    TED D L FGT  +L  L F+  A  + I + +          S ++F  +CI+ GCDY   + GIG   +  L++  Q  S++  L  I+          +Y + + +    E+    E +L ++
Sbjct:    1 MGIQGLAKLLGDIAPSGIKENEIKNYFGRKIAIDASMSIYQFLIAVRSDGSQLTNEAGETTSHLMGLFYRTIRMVE-NGIKPVYVFDGKPPQLKSGELAKRTERREE---------AQKALSKAEEAGD--TENIDKFSRRLVRVTKEHNEECKQLLKLMGIPYVEAPCEAEAQCAALVKSGKVYATGTEDMDALTFGTTVMLRHLTFS-EAKKMPIKEFHLQNVLSEAGLSQDEFIDLCILLGCDYCDSIKGIGPKRSVDLIR--QHRSIDKILENIDTSKHPPPENWLYKEARELFKNPEVRNPEEIELKWE 299          
BLAST of exonuclease 1-like vs. Ensembl Nematostella
Match: EDO37860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEH4])

HSP 1 Score: 48.1358 bits (113), Expect = 1.317e-6
Identity = 22/40 (55.00%), Postives = 30/40 (75.00%), Query Frame = 3
Query:  483 VKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPK 602
            V+ +VAPYEADAQ+AYL K+ + D  + ED+DLL +G  K
Sbjct:   48 VQYVVAPYEADAQIAYLMKSGVADPALIEDADLLAYGCSK 87          
BLAST of exonuclease 1-like vs. Ensembl Medaka
Match: exo1 (exonuclease 1 [Source:NCBI gene;Acc:101157803])

HSP 1 Score: 283.878 bits (725), Expect = 1.290e-86
Identity = 166/478 (34.73%), Postives = 260/478 (54.39%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEK-YSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFNQN---------VKVTKRTPMTKEKKMQV------QCQFPWKHASKPDTEIDFSQIFDIYTDNTVNTEETNGGKVENEDDDEVATLFNELLSNEETIMIRQKNRDNE 1445
            MGI GLL ++K   + I +   KG  VAVDTY WL+K    C++K+A GE TD Y+ YC++++ +L  + IK ILVFDG+NLP+K  VE  R++ RE+   KG + + E K SEA++CF +C+ I+  +A  LIK   + GV C+VAPYEADAQLAYL K+ +   +ITEDSDLL FG   V+ K+D  G  N +EI+  N      L   ++  KFRYMCI+SGCDY P L GIGL  A KLL+  +   +   + ++  Y K  +++ ++ +   + A+ TF +Q+VFDPV  + +PLN Y  + +P+ LS+AG +    +   ++A+G  D +  E I ++  D+  Q       +  S  S   S +++               R P T+ ++  +      Q + P +    PD E     + + Y+ + +        + ++E  D           N    +++++NRD E
Sbjct:    1 MGITGLLQFIKDAAEPINVKKYKGQTVAVDTYCWLHKGAFSCAEKLAKGEPTDQYVWYCLKFVDMLLNFSIKPILVFDGRNLPSKQEVEKARRERREANLQKGRRLLREGKLSEARDCFTRCVNITPAMAHNLIKAARARGVDCLVAPYEADAQLAYLTKSGLAQAVITEDSDLLAFGCKTVILKMDKQG--NGLEIDQGNLGRCRSLGNIFTEEKFRYMCILSGCDYLPSLHGIGLGKACKLLRLAKDPDILKVIKKMGQYLKMNLVVPEEYVEGFIRANNTFLHQLVFDPVQRKVIPLNPYPEHTDPASLSYAG-LNPGDDRGLEMALGNLDFNTMERIDDFSPDNPQQGKHRTNSWKGSPASSGGSIWSRGFTPAPPPQAAASPHRPPPTRGQERVISVDRLLQVKRPREDCDVPDQE-----VLEQYSTSVLK-------RSKSETPDRPVVGGKPRTQNRFATLLQRRNRDEE 463          
BLAST of exonuclease 1-like vs. Ensembl Medaka
Match: ENSORLT00000039492.1 (GEN1 Holliday junction 5' flap endonuclease [Source:NCBI gene;Acc:101167838])

HSP 1 Score: 66.2402 bits (160), Expect = 5.614e-11
Identity = 64/246 (26.02%), Postives = 110/246 (44.72%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLE-KYSYNKFRYMCIISGCDYFP-GLAGIGLITAAKLLQ 791
            MG+  L   ++ + + + L  + G  +AVD   W+ +A      +  +G  T  +L      +  L    IK++ V +G     KL  ET     R   R    K   +  T+ ++  F+  L+       +  ++   LGV  ++A  EA+A  AYL    +VD  IT D D  L+G  + +++ +FN  +   +I D  +  +   E   S      + I+ GCDY P G+ G+G   A +L+Q
Sbjct:    1 MGVHDLWSIVEPVRESVSLYSLSGKTLAVDLSLWVCEAQHV---QAMMGRVTKPHLRNLFFRVSSLSLMGIKLVFVMEGTA--PKLKAET--MSKRTKARYGQFKNPTKCSTNTSRGRFNSILK-------ECAEMLDYLGVPWVMAAGEAEAMCAYLDSQGLVDGCITNDGDAFLYGA-RTVYR-NFNMSSKDPQI-DCYQTSRVQTELNLSRENLVGLAILLGCDYIPKGIPGVGKEQALRLIQ 229          
BLAST of exonuclease 1-like vs. Ensembl Medaka
Match: fen1 (flap structure-specific endonuclease 1 [Source:NCBI gene;Acc:101158562])

HSP 1 Score: 63.5438 bits (153), Expect = 2.346e-10
Identity = 75/267 (28.09%), Postives = 116/267 (43.45%), Query Frame = 3
Query:   57 IMGIKGLLPYLK-GITKEICLADIK---GCVVAVDTYGWLYKATMCCSDKIAL-----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCL-EISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNK-----------FRYMCIISGCDYFPGLAGIGLITAAKLLQK 794
            IMGI GL   +       I   DIK   G  +A+D    +Y+  +       +     GE T   +    R I++L+ + IK + VFDGK  P     E +++  R +   K +    E    E  E F K L +++ +   +  K+   +GV  I AP EA+A  A L K   V    TED D L FGT  +L  L              ++  K P++++ +N+           F  +CI+ GCDY   + GIG   A  L+++
Sbjct:   52 IMGIHGLAKLIADHAPSAIKEQDIKSYFGRKIAIDASMCMYQFLIAVRQDGNVLQNEDGETTSHLMGMFYRTIRMLE-HGIKPVYVFDGKP-PQLKSSELEKRGERRAEAEKLLAQAQEMGEQENVEKFTKRLVKVTKQHNDECKKLLSLMGVPYIEAPCEAEASCAALVKEGKVFATATEDMDGLTFGTNVLLRHL------------TASEAKKLPIQEFHFNRILQDMDLTKEQFIDLCILLGCDYCGTIKGIGPKRAVDLIRQ 304          
BLAST of exonuclease 1-like vs. Ensembl Medaka
Match: fen1 (flap structure-specific endonuclease 1 [Source:NCBI gene;Acc:101158562])

HSP 1 Score: 63.1586 bits (152), Expect = 2.782e-10
Identity = 75/267 (28.09%), Postives = 116/267 (43.45%), Query Frame = 3
Query:   57 IMGIKGLLPYLK-GITKEICLADIK---GCVVAVDTYGWLYKATMCCSDKIAL-----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCL-EISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNK-----------FRYMCIISGCDYFPGLAGIGLITAAKLLQK 794
            IMGI GL   +       I   DIK   G  +A+D    +Y+  +       +     GE T   +    R I++L+ + IK + VFDGK  P     E +++  R +   K +    E    E  E F K L +++ +   +  K+   +GV  I AP EA+A  A L K   V    TED D L FGT  +L  L              ++  K P++++ +N+           F  +CI+ GCDY   + GIG   A  L+++
Sbjct:   52 IMGIHGLAKLIADHAPSAIKEQDIKSYFGRKIAIDASMCMYQFLIAVRQDGNVLQNEDGETTSHLMGMFYRTIRMLE-HGIKPVYVFDGKP-PQLKSSELEKRGERRAEAEKLLAQAQEMGEQENVEKFTKRLVKVTKQHNDECKKLLSLMGVPYIEAPCEAEASCAALVKEGKVFATATEDMDGLTFGTNVLLRHL------------TASEAKKLPIQEFHFNRILQDMDLTKEQFIDLCILLGCDYCGTIKGIGPKRAVDLIRQ 304          
BLAST of exonuclease 1-like vs. Ensembl Medaka
Match: fen1 (flap structure-specific endonuclease 1 [Source:NCBI gene;Acc:101158562])

HSP 1 Score: 63.1586 bits (152), Expect = 2.915e-10
Identity = 75/267 (28.09%), Postives = 116/267 (43.45%), Query Frame = 3
Query:   57 IMGIKGLLPYLK-GITKEICLADIK---GCVVAVDTYGWLYKATMCCSDKIAL-----GEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCL-EISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNK-----------FRYMCIISGCDYFPGLAGIGLITAAKLLQK 794
            IMGI GL   +       I   DIK   G  +A+D    +Y+  +       +     GE T   +    R I++L+ + IK + VFDGK  P     E +++  R +   K +    E    E  E F K L +++ +   +  K+   +GV  I AP EA+A  A L K   V    TED D L FGT  +L  L              ++  K P++++ +N+           F  +CI+ GCDY   + GIG   A  L+++
Sbjct:   52 IMGIHGLAKLIADHAPSAIKEQDIKSYFGRKIAIDASMCMYQFLIAVRQDGNVLQNEDGETTSHLMGMFYRTIRMLE-HGIKPVYVFDGKP-PQLKSSELEKRGERRAEAEKLLAQAQEMGEQENVEKFTKRLVKVTKQHNDECKKLLSLMGVPYIEAPCEAEASCAALVKEGKVFATATEDMDGLTFGTNVLLRHL------------TASEAKKLPIQEFHFNRILQDMDLTKEQFIDLCILLGCDYCGTIKGIGPKRAVDLIRQ 304          
BLAST of exonuclease 1-like vs. Planmine SMEST
Match: SMESG000064333.1 (SMESG000064333.1)

HSP 1 Score: 1058.51 bits (2736), Expect = 0.000e+0
Identity = 515/518 (99.42%), Postives = 517/518 (99.81%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFNQNVKVTKRTPMTKEKKMQVQCQFPWKHASKPDTEIDFSQIFDIYTDNTVNTEETNGGKVENEDDDEVATLFNELLSNEETIMIRQKNRDNETANYPFSGNSIIRNKRQHLSSPNKENERIKRGKFLMEKKEFIQSKLSHLIRKSQQN 1613
            MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDY+ITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLN FLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFN+NVKVTKRTPMTKEKKMQVQCQFPWKHASKPDTEIDFSQIFDIYTDNTVNTEETNGGKVENEDDDEVATLFNELLSNEETIMIRQKNRDNETANYPFSGNSIIRNKRQHLSSPNKENERIKRGKFLMEKKEFIQSKLSHLIRKSQQN
Sbjct:    1 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYVITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNYFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFNKNVKVTKRTPMTKEKKMQVQCQFPWKHASKPDTEIDFSQIFDIYTDNTVNTEETNGGKVENEDDDEVATLFNELLSNEETIMIRQKNRDNETANYPFSGNSIIRNKRQHLSSPNKENERIKRGKFLMEKKEFIQSKLSHLIRKSQQN 518          
BLAST of exonuclease 1-like vs. Planmine SMEST
Match: SMESG000064333.1 (SMESG000064333.1)

HSP 1 Score: 1005.74 bits (2599), Expect = 0.000e+0
Identity = 495/518 (95.56%), Postives = 497/518 (95.95%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFNQNVKVTKRTPMTKEKKMQVQCQFPWKHASKPDTEIDFSQIFDIYTDNTVNTEETNGGKVENEDDDEVATLFNELLSNEETIMIRQKNRDNETANYPFSGNSIIRNKRQHLSSPNKENERIKRGKFLMEKKEFIQSKLSHLIRKSQQN 1613
            MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDY+ITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLN FLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFN+NVKVTKRTPMTKEKKMQVQCQFPWKHASKP                    EETNGGKVENEDDDEVATLFNELLSNEETIMIRQKNRDNETANYPFSGNSIIRNKRQHLSSPNKENERIKRGKFLMEKKEFIQSKLSHLIRKSQQN
Sbjct:    1 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYVITEDSDLLLFGTPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLSLNYFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLNNYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQSSTPVFYFAKSKKSDKESFFNKNVKVTKRTPMTKEKKMQVQCQFPWKHASKP--------------------EETNGGKVENEDDDEVATLFNELLSNEETIMIRQKNRDNETANYPFSGNSIIRNKRQHLSSPNKENERIKRGKFLMEKKEFIQSKLSHLIRKSQQN 498          
BLAST of exonuclease 1-like vs. Planmine SMEST
Match: SMESG000020104.1 (SMESG000020104.1)

HSP 1 Score: 67.781 bits (164), Expect = 6.364e-12
Identity = 78/264 (29.55%), Postives = 125/264 (47.35%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIK--------GCVVAVDTYGWLYKATMCCS-DKIALGEDTDIYLNYCIR-YIKLLQFYD--IKVILVFDGKNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKECFDKCL-EISHKLAVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANL-IEINDINKVL-KFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLL 806
            MGI  L   L     E C + +K        G  +A+D    LY+  +    +   L +D +   ++ +  + + L+  D  IK + VFDGK    K     KR + RE    K ++   +   +E  + F K L ++  K      K+   +G+  I AP EA+AQ A + K   V  + TED D L FG   +L +L F+    L I+  +++K+L K  L   +  +F  +CI+ GCDY P + GIG   A +L++K + L
Sbjct:    1 MGIHQLAKVLA----EQCCSAVKTTEIKNYTGAKIAIDASMSLYQFLIAIRLEGNTLTDDNNETTSHLMGIFYRTLRMIDNGIKPVYVFDGKPPTLKSDELLKRTERREEA-EKQLEVAQKEDDAENIDKFSKRLVKVLPKHNEDCKKLLSLMGIPYITAPCEAEAQCAAMVKAKKVFAVGTEDMDALTFGGSILLRRLTFSEAKKLPIQEYNLDKILSKMEL---TMEQFIDLCILLGCDYCPSIRGIGPKKAVELIKKHKSL 256          
BLAST of exonuclease 1-like vs. Planmine SMEST
Match: SMESG000019370.1 (SMESG000019370.1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.018e-9
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  447 AVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFG---TPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLL 788
            A  L+KI    G+  I +P EA+AQ A+L K  + +  ITEDSD+ LFG     K +F  DF+  A    +  I KVL       S +    + ++SG DY PG+ GIG + A ++L
Sbjct:  593 AKDLLKI---FGIPYIESPGEAEAQCAFLEKKNLTNGTITEDSDIWLFGGCMVYKHVFSRDFSARA--YSLKHIFKVLGL-----SQDLMICIALLSGSDYTPGVYGIGPVIAMEIL 699          

HSP 2 Score: 50.0618 bits (118), Expect = 4.829e-6
Identity = 32/125 (25.60%), Postives = 60/125 (48.00%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDG-------KNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKEC 413
            MG++GL   L    ++I L+ ++G V+A+D   WL +A     D        +++L    R I  L FY IK + VFDG       + +  +  +   +Q+  E  +S  +  ++++K  E ++ 
Sbjct:    1 MGVQGLWNILHSTGRDIDLSSLEGKVLAIDMSIWLNQALRSGIDS------PNVHLEVLFRRICKLLFYKIKPVFVFDGPSPSLKKETIINRRKLRQLKQEKSEKIKSNIIDLLMKKKLVEKRKT 119          
BLAST of exonuclease 1-like vs. Planmine SMEST
Match: SMESG000019370.1 (SMESG000019370.1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.019e-9
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  447 AVKLIKIGHSLGVKCIVAPYEADAQLAYLGKNLIVDYIITEDSDLLLFG---TPKVLFKLDFNGLANLIEINDINKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLL 788
            A  L+KI    G+  I +P EA+AQ A+L K  + +  ITEDSD+ LFG     K +F  DF+  A    +  I KVL       S +    + ++SG DY PG+ GIG + A ++L
Sbjct:  594 AKDLLKI---FGIPYIESPGEAEAQCAFLEKKNLTNGTITEDSDIWLFGGCMVYKHVFSRDFSARA--YSLKHIFKVLGL-----SQDLMICIALLSGSDYTPGVYGIGPVIAMEIL 700          

HSP 2 Score: 50.0618 bits (118), Expect = 4.830e-6
Identity = 32/125 (25.60%), Postives = 60/125 (48.00%), Query Frame = 3
Query:   60 MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGEDTDIYLNYCIRYIKLLQFYDIKVILVFDG-------KNLPAKLGVETKRQQNRESFRSKGMKFILERKTSEAKEC 413
            MG++GL   L    ++I L+ ++G V+A+D   WL +A     D        +++L    R I  L FY IK + VFDG       + +  +  +   +Q+  E  +S  +  ++++K  E ++ 
Sbjct:    1 MGVQGLWNILHSTGRDIDLSSLEGKVLAIDMSIWLNQALRSGIDS------PNVHLEVLFRRICKLLFYKIKPVFVFDGPSPSLKKETIINRRKLRQLKQEKSEKIKSNIIDLLMKKKLVEKRKT 119          
The following BLAST results are available for this feature:
BLAST of exonuclease 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EXO13.191e-8644.96exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511][more]
EXO18.740e-8644.96exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511][more]
EXO18.740e-8644.96exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511][more]
EXO12.065e-3841.92exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511][more]
EXO13.183e-3540.91exonuclease 1 [Source:HGNC Symbol;Acc:HGNC:3511][more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exo-11.284e-5034.23EXOnuclease [Source:UniProtKB/TrEMBL;Acc:O62245][more]
crn-11.877e-1527.39Flap endonuclease 1 [Source:UniProtKB/Swiss-Prot;... [more]
crn-11.877e-1527.39Flap endonuclease 1 [Source:UniProtKB/Swiss-Prot;... [more]
gen-13.590e-1125.30GEN1 Holliday junction resolvase homolog [Source:... [more]
gen-13.590e-1125.30GEN1 Holliday junction resolvase homolog [Source:... [more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tos2.680e-8438.90gene:FBgn0015553 transcript:FBtr0081131[more]
Fen12.005e-1329.17gene:FBgn0025832 transcript:FBtr0087075[more]
mus2012.656e-829.01gene:FBgn0002887 transcript:FBtr0100473[more]
mus2012.656e-829.01gene:FBgn0002887 transcript:FBtr0346117[more]
Gen4.238e-823.46gene:FBgn0263831 transcript:FBtr0077176[more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exo16.068e-8336.59exonuclease 1 [Source:NCBI gene;Acc:406778][more]
exo11.435e-8240.75exonuclease 1 [Source:NCBI gene;Acc:406778][more]
exo11.435e-8240.75exonuclease 1 [Source:NCBI gene;Acc:406778][more]
exo19.245e-4644.17exonuclease 1 [Source:NCBI gene;Acc:406778][more]
exo18.118e-2642.06exonuclease 1 [Source:NCBI gene;Acc:406778][more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ufc12.823e-8642.30ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
ufc13.593e-8642.30ubiquitin-fold modifier conjugating enzyme 1 [Sour... [more]
GEN12.049e-1124.91GEN1 Holliday junction 5' flap endonuclease [Sourc... [more]
GEN11.068e-1024.53GEN1 Holliday junction 5' flap endonuclease [Sourc... [more]
fen11.451e-1029.89flap structure-specific endonuclease 1 [Source:NCB... [more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Exo12.346e-8443.23exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427][more]
Exo12.257e-5746.22exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427][more]
Exo11.102e-4539.66exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427][more]
Exo12.898e-4539.57exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427][more]
Exo19.184e-2043.53exonuclease 1 [Source:MGI Symbol;Acc:MGI:1349427][more]
back to top
BLAST of exonuclease 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UQ84|EXO1_HUMAN4.197e-8544.96Exonuclease 1 OS=Homo sapiens OX=9606 GN=EXO1 PE=1... [more]
sp|Q9W6K2|EXO1_XENLA1.153e-8442.46Exonuclease 1 OS=Xenopus laevis OX=8355 GN=exo1 PE... [more]
sp|Q9QZ11|EXO1_MOUSE1.641e-8343.23Exonuclease 1 OS=Mus musculus OX=10090 GN=Exo1 PE=... [more]
sp|Q24558|EXO1_DROME2.686e-8338.90Exonuclease 1 OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q803U7|EXO1_DANRE4.395e-8236.59Exonuclease 1 OS=Danio rerio OX=7955 GN=exo1 PE=2 ... [more]
back to top
BLAST of exonuclease 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3Z9S62.386e-10245.66Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3S0ZF144.601e-9546.97Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0L8HBQ12.220e-9241.76Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A0P5E4008.962e-9242.74Exonuclease OS=Daphnia magna OX=35525 GN=APZ42_020... [more]
A0A1S3I8U71.286e-9143.64exonuclease 1-like OS=Lingula unguis OX=7574 GN=LO... [more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exo14.417e-8542.07exonuclease 1 [Source:NCBI gene;Acc:103044915][more]
exo14.946e-6337.18exonuclease 1 [Source:NCBI gene;Acc:103044915][more]
zgc:1102691.497e-1028.89zgc:110269 [Source:NCBI gene;Acc:550274][more]
ENSAMXT00000001764.22.085e-1026.09GEN1 Holliday junction 5' flap endonuclease [Sourc... [more]
zgc:1102698.475e-1025.00zgc:110269 [Source:NCBI gene;Acc:550274][more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exo11.533e-6840.41exonuclease 1 [Source:NCBI gene;Acc:406778][more]
ENSPMAT00000009136.19.491e-824.38pep scaffold:Pmarinus_7.0:GL481492:10436:20158:-1 ... [more]
fen14.006e-730.61flap structure-specific endonuclease 1 [Source:NCB... [more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
EXO16.210e-5236.305'-3' exonuclease and flap-endonuclease; involved ... [more]
DIN73.376e-4833.05Mitochondrial nuclease functioning in DNA repair a... [more]
RAD274.605e-1529.925' to 3' exonuclease, 5' flap endonuclease; requir... [more]
RAD24.212e-928.05Single-stranded DNA endonuclease; cleaves single-s... [more]
YEN15.527e-621.45Holliday junction resolvase; promotes template swi... [more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO315771.049e-8443.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452692.584e-1629.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
FEN15.136e-1427.07Flap endonuclease 1 [Source:UniProtKB/Swiss-Prot;... [more]
EDO378601.317e-655.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of exonuclease 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exo11.290e-8634.73exonuclease 1 [Source:NCBI gene;Acc:101157803][more]
ENSORLT00000039492.15.614e-1126.02GEN1 Holliday junction 5' flap endonuclease [Sourc... [more]
fen12.346e-1028.09flap structure-specific endonuclease 1 [Source:NCB... [more]
fen12.782e-1028.09flap structure-specific endonuclease 1 [Source:NCB... [more]
fen12.915e-1028.09flap structure-specific endonuclease 1 [Source:NCB... [more]
back to top
BLAST of exonuclease 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064333.10.000e+099.42SMESG000064333.1[more]
SMESG000064333.10.000e+095.56SMESG000064333.1[more]
SMESG000020104.16.364e-1229.55SMESG000020104.1[more]
SMESG000019370.12.018e-937.61SMESG000019370.1[more]
SMESG000019370.12.019e-937.61SMESG000019370.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025421 ID=SMED30025421|Name=exonuclease 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1631bp
GTTTTATTACATGTTAATTTGAAAATATTTTGTTAATTTTACTTTATAAT
TTTTTCATAATGGGTATTAAAGGCCTTTTACCCTATTTGAAAGGAATTAC
AAAAGAAATATGTTTAGCTGATATTAAAGGATGTGTCGTTGCTGTTGATA
CATATGGTTGGTTATACAAAGCAACTATGTGTTGTTCAGATAAAATTGCA
TTGGGCGAAGATACAGACATATATCTTAATTATTGTATCCGATATATAAA
ACTTTTGCAGTTTTATGATATTAAAGTTATATTAGTATTTGATGGGAAAA
ATTTACCTGCTAAATTGGGCGTGGAAACTAAACGTCAACAAAACCGTGAA
AGTTTTCGAAGTAAAGGAATGAAATTTATTCTTGAAAGGAAAACATCAGA
AGCCAAAGAGTGCTTTGATAAATGTCTAGAGATATCTCACAAATTAGCTG
TAAAATTGATCAAGATTGGTCATTCACTCGGCGTTAAGTGTATCGTTGCT
CCATATGAGGCAGATGCCCAGTTAGCTTATCTAGGAAAGAACCTCATTGT
CGATTACATAATAACCGAGGATTCAGATTTGCTTTTGTTTGGAACTCCAA
AAGTATTATTTAAGCTGGATTTCAATGGCCTGGCAAACCTAATTGAAATC
AATGATATCAATAAAGTCTTGAAGTTCCCTCTTGAAAAGTACAGCTATAA
TAAATTCCGCTACATGTGTATAATATCCGGTTGCGATTATTTCCCCGGAC
TGGCCGGCATTGGACTCATTACCGCAGCCAAGCTACTTCAAAAGACTCAA
TTGTTGAGCCTAAATGATTTCCTGACTCGTATTAACATGTATAGTAAAAC
AAAGATTATTATTAGCAAAGATGAGATCAATCAAGCAGTCGAGGCCGATT
TAACATTTCAATATCAAATAGTATTCGATCCGGTTAGTTGTCGGCAGGTT
CCATTGAACAATTACTCAGTGAATGTGAATCCATCAGATTTATCTTTTGC
CGGACAAATTATTGAAAACAGAGAACTCGTATTTCAATTAGCAATTGGTC
TGCGTGATCCTTCTAATCAGGAATTGATTTCGAATTATGAACTTGATCAT
AAAATTCAGTCTTCAACTCCGGTTTTTTATTTTGCTAAATCGAAAAAGTC
TGACAAAGAGTCTTTTTTTAATCAAAACGTTAAAGTGACGAAAAGAACTC
CAATGACAAAAGAGAAAAAAATGCAGGTTCAATGTCAATTTCCATGGAAA
CATGCTTCAAAACCAGATACAGAAATTGATTTTTCCCAAATTTTTGATAT
TTATACTGACAACACTGTAAATACAGAAGAAACTAATGGGGGGAAAGTCG
AAAATGAGGACGATGATGAAGTCGCGACATTATTTAATGAATTGCTATCG
AATGAAGAAACTATTATGATACGACAGAAAAATAGAGATAATGAAACTGC
TAATTATCCTTTCTCTGGCAATTCAATTATCCGTAATAAAAGACAACATC
TCAGTTCTCCAAATAAAGAAAACGAACGTATTAAAAGAGGAAAATTTTTA
ATGGAAAAAAAAGAATTTATTCAGTCGAAACTATCACATTTGATCAGAAA
GAGTCAACAGAATTGAAATATATTTTTAGAG
back to top

protein sequence of SMED30025421-orf-1

>SMED30025421-orf-1 ID=SMED30025421-orf-1|Name=SMED30025421-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MGIKGLLPYLKGITKEICLADIKGCVVAVDTYGWLYKATMCCSDKIALGE
DTDIYLNYCIRYIKLLQFYDIKVILVFDGKNLPAKLGVETKRQQNRESFR
SKGMKFILERKTSEAKECFDKCLEISHKLAVKLIKIGHSLGVKCIVAPYE
ADAQLAYLGKNLIVDYIITEDSDLLLFGTPKVLFKLDFNGLANLIEINDI
NKVLKFPLEKYSYNKFRYMCIISGCDYFPGLAGIGLITAAKLLQKTQLLS
LNDFLTRINMYSKTKIIISKDEINQAVEADLTFQYQIVFDPVSCRQVPLN
NYSVNVNPSDLSFAGQIIENRELVFQLAIGLRDPSNQELISNYELDHKIQ
SSTPVFYFAKSKKSDKESFFNQNVKVTKRTPMTKEKKMQVQCQFPWKHAS
KPDTEIDFSQIFDIYTDNTVNTEETNGGKVENEDDDEVATLFNELLSNEE
TIMIRQKNRDNETANYPFSGNSIIRNKRQHLSSPNKENERIKRGKFLMEK
KEFIQSKLSHLIRKSQQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR032641Exo1
IPR0362795-3_exonuclease_C_sf
IPR006084XPG/Rad2
IPR006086XPG-I_dom
IPR008918HhH2
IPR006085XPG_DNA_repair_N
IPR029060PIN-like_dom_sf
IPR019974XPG_CS
IPR0200455-3_exonuclease_C
Vocabulary: molecular function
TermDefinition
GO:0004518nuclease activity
GO:0003824catalytic activity
GO:0003677DNA binding
GO:0016788hydrolase activity, acting on ester bonds
GO:0016787hydrolase activity
GO:00353125'-3' exodeoxyribonuclease activity
GO:0045145single-stranded DNA 5'-3' exodeoxyribonuclease activity
GO:0046872metal ion binding
GO:0048256flap endonuclease activity
GO:0051908double-stranded DNA 5'-3' exodeoxyribonuclease activity
GO:0003682chromatin binding
GO:0004519endonuclease activity
GO:0004523RNA-DNA hybrid ribonuclease activity
GO:0004527exonuclease activity
GO:0005515protein binding
GO:00084095'-3' exonuclease activity
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0045190isotype switching
GO:0051321meiotic cell cycle
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0090656t-circle formation
GO:1901796regulation of signal transduction by p53 class mediator
GO:0000731DNA synthesis involved in DNA repair
GO:0000732strand displacement
GO:0002376immune system process
GO:0002455humoral immune response mediated by circulating immunoglobulin
GO:0006260DNA replication
GO:0006298mismatch repair
GO:0006310DNA recombination
GO:0006974cellular response to DNA damage stimulus
GO:0016446somatic hypermutation of immunoglobulin genes
Vocabulary: cellular component
TermDefinition
GO:0016604nuclear body
GO:0005634nucleus
GO:0005654nucleoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006084XPG/Rad2 endonucleasePRINTSPR00853XPGRADSUPERcoord: 216..231
score: 41.8
coord: 158..178
score: 47.77
coord: 73..92
score: 42.97
coord: 24..38
score: 44.58
coord: 137..154
score: 46.88
IPR006084XPG/Rad2 endonucleasePANTHERPTHR11081FLAP ENDONUCLEASE FAMILY MEMBERcoord: 1..471
IPR006086XPG-I domainSMARTSM00484xpgineucoord: 138..208
e-value: 7.9E-23
score: 91.8
IPR006086XPG-I domainPFAMPF00867XPG_Icoord: 139..226
e-value: 3.3E-22
score: 78.6
IPR008918Helix-hairpin-helix motif, class 2SMARTSM00279HhH_4coord: 213..246
e-value: 6.1E-9
score: 45.7
IPR006085XPG N-terminalSMARTSM00485xpgn3coord: 1..99
e-value: 5.2E-27
score: 105.7
IPR006085XPG N-terminalPFAMPF00752XPG_Ncoord: 1..97
e-value: 4.7E-17
score: 62.3
NoneNo IPR availableGENE3DG3DSA:1.10.150.20coord: 209..286
e-value: 1.8E-20
score: 74.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.1010coord: 1..206
e-value: 3.9E-67
score: 227.6
NoneNo IPR availableCDDcd09857PIN_EXO1coord: 1..202
e-value: 1.77672E-97
score: 291.23
IPR032641Exonuclease 1PANTHERPTHR11081:SF8EXONUCLEASE 1coord: 1..471
IPR019974XPG conserved sitePROSITEPS00841XPG_1coord: 71..85
IPR0362795'-3' exonuclease, C-terminal domain superfamilySUPERFAMILYSSF478075' to 3' exonuclease, C-terminal subdomaincoord: 213..343
IPR029060PIN-like domain superfamilySUPERFAMILYSSF88723PIN domain-likecoord: 2..226