Nicotinate phosphoribosyltransferase

Overview
NameNicotinate phosphoribosyltransferase
Smed IDSMED30025412
Length (bp)2196
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nicotinate phosphoribosyltransferase (SMED30025412) t-SNE clustered cells

Violin plots show distribution of expression levels for Nicotinate phosphoribosyltransferase (SMED30025412) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nicotinate phosphoribosyltransferase (SMED30025412) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nicotinate phosphoribosyltransferase (SMED30025412) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025412

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025412h1SMcG0019699 dd_Smed_v4_12183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025412h1SMcG0019699 dd_Smed_v4_12183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025412h1SMcG0019699 dd_Smed_v4_12183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025412h1SMcG0019699 dd_Smed_v6_12183_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30025412h1SMcG0019699 dd_Smed_v4_12183_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Human
Match: NAPRT (nicotinate phosphoribosyltransferase [Source:HGNC Symbol;Acc:HGNC:30450])

HSP 1 Score: 471.47 bits (1212), Expect = 1.053e-158
Identity = 231/564 (40.96%), Postives = 343/564 (60.82%), Query Frame = 2
Query:   74 QPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTM--KTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAP 1759
            +PLLTD YQ +M+  YW++G+  D A F+L+FR+ PF G + +  GL +C+  ++ F+  + D+++L  ++P D D  FF +L+ L+ +++T+ +LPEGS+ FP VPL+ V GPL++ QLLET LL LV+++SLVATNAAR R  AG  K+LLE GLRR+QGPDGG++AS   +LGGF+++SNVLAG++  +P+ GT AH++VTS+S   E+    M    + +   VD     + W ++V   LG+   + + GE A+F++YALAFP  F  L+DTY V +SG+PNF++V+LAL E GY+AVGVR+DSGDL   + EIRK F   + +F + W  S+ IV SN+I+E+ L  L Q                                     +G  ++  GIGT +VTC +QP+LG VYKLV + GQ  +KL+ED +K T+PG KA +RL G DG  L D L  + EP+P     L    P  A +   V P+ +E + ++  + GQ    +PSL E +  A+ SL  + P+H+R  +P  Y+V +S  L      +    +P
Sbjct:   14 RPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSG-SEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ-------------------------------------EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRV-WPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP 538          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Human
Match: NAPRT (nicotinate phosphoribosyltransferase [Source:HGNC Symbol;Acc:HGNC:30450])

HSP 1 Score: 471.47 bits (1212), Expect = 1.053e-158
Identity = 231/564 (40.96%), Postives = 343/564 (60.82%), Query Frame = 2
Query:   74 QPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTM--KTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAP 1759
            +PLLTD YQ +M+  YW++G+  D A F+L+FR+ PF G + +  GL +C+  ++ F+  + D+++L  ++P D D  FF +L+ L+ +++T+ +LPEGS+ FP VPL+ V GPL++ QLLET LL LV+++SLVATNAAR R  AG  K+LLE GLRR+QGPDGG++AS   +LGGF+++SNVLAG++  +P+ GT AH++VTS+S   E+    M    + +   VD     + W ++V   LG+   + + GE A+F++YALAFP  F  L+DTY V +SG+PNF++V+LAL E GY+AVGVR+DSGDL   + EIRK F   + +F + W  S+ IV SN+I+E+ L  L Q                                     +G  ++  GIGT +VTC +QP+LG VYKLV + GQ  +KL+ED +K T+PG KA +RL G DG  L D L  + EP+P     L    P  A +   V P+ +E + ++  + GQ    +PSL E +  A+ SL  + P+H+R  +P  Y+V +S  L      +    +P
Sbjct:   14 RPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSG-SEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ-------------------------------------EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRV-WPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP 538          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Human
Match: NAPRT (nicotinate phosphoribosyltransferase [Source:HGNC Symbol;Acc:HGNC:30450])

HSP 1 Score: 467.618 bits (1202), Expect = 1.609e-156
Identity = 229/551 (41.56%), Postives = 338/551 (61.34%), Query Frame = 2
Query:   74 QPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTM--KTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNL 1720
            +PLLTD YQ +M+  YW++G+  D A F+L+FR+ PF G + +  GL +C+  ++ F+  + D+++L  ++P D D  FF +L+ L+ +++T+ +LPEGS+ FP VPL+ V GPL++ QLLET LL LV+++SLVATNAAR R  AG  K+LLE GLRR+QGPDGG++AS   +LGGF+++SNVLAG++  +P+ GT AH++VTS+S   E+    M    + +   VD     + W ++V   LG+   + + GE A+F++YALAFP  F  L+DTY V +SG+PNF++V+LAL E GY+AVGVR+DSGDL   + EIRK F   + +F + W  S+ IV SN+I+E+ L  L Q                                     +G  ++  GIGT +VTC +QP+LG VYKLV + GQ  +KL+ED +K T+PG KA +RL G DG  L D L  + EP+P     L    P  A +   V P+ +E + ++  + GQ    +PSL E +  A+ SL  + P+H+R  +P  Y+V     L
Sbjct:   14 RPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSG-SEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ-------------------------------------EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRV-WPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVGGRPTL 525          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Human
Match: NAPRT (nicotinate phosphoribosyltransferase [Source:HGNC Symbol;Acc:HGNC:30450])

HSP 1 Score: 467.618 bits (1202), Expect = 1.609e-156
Identity = 229/551 (41.56%), Postives = 338/551 (61.34%), Query Frame = 2
Query:   74 QPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTM--KTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNL 1720
            +PLLTD YQ +M+  YW++G+  D A F+L+FR+ PF G + +  GL +C+  ++ F+  + D+++L  ++P D D  FF +L+ L+ +++T+ +LPEGS+ FP VPL+ V GPL++ QLLET LL LV+++SLVATNAAR R  AG  K+LLE GLRR+QGPDGG++AS   +LGGF+++SNVLAG++  +P+ GT AH++VTS+S   E+    M    + +   VD     + W ++V   LG+   + + GE A+F++YALAFP  F  L+DTY V +SG+PNF++V+LAL E GY+AVGVR+DSGDL   + EIRK F   + +F + W  S+ IV SN+I+E+ L  L Q                                     +G  ++  GIGT +VTC +QP+LG VYKLV + GQ  +KL+ED +K T+PG KA +RL G DG  L D L  + EP+P     L    P  A +   V P+ +E + ++  + GQ    +PSL E +  A+ SL  + P+H+R  +P  Y+V     L
Sbjct:   14 RPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSG-SEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ-------------------------------------EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRV-WPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVGGRPTL 525          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Human
Match: NAPRT (nicotinate phosphoribosyltransferase [Source:HGNC Symbol;Acc:HGNC:30450])

HSP 1 Score: 459.144 bits (1180), Expect = 4.191e-154
Identity = 231/565 (40.88%), Postives = 338/565 (59.82%), Query Frame = 2
Query:   74 QPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTM--KTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVE-IPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAP 1759
            +PLLTD YQ +M+  YW++G+  D A F+L+FR+ PF G + +  GL +C+  ++ F+  + D+++L  ++P D D  FF +L+ L+ +++T+ +LPEGS+ FP VPL+ V GPL++ QLLET LL LV+++SLVATNAAR R  AG  K+LLE GLRR+QGPDGG++AS   +LGGF+++SNVLAG++  +P+ GT AH++VTS+S   E+    M    + +   VD     + W ++V   LG+   + + GE A+F++YALAFP  F  L+DTY V +SG+PNF++V+LAL E GY+AVGVR+DSGDL   + EIRK F   + +F + W  S+ IV SN+I+E+ L  L Q                                     +G  ++  GIGT +VTC +QP+LG VYKLV + GQ  +KL+ED +K T+PG KA +RL G DG  L D L  + EP+P     L    P  A +   V P+              QL E +PSL E +  A+ SL  + P+H+R  +P  Y+V +S  L      +    +P
Sbjct:   14 RPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSG-SEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ-------------------------------------EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRV-WPPGAQEPCTVRPA--------------QLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP 525          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Celegans
Match: nprt-1 (Nicotinate phosphoribosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q95XX1])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 294/576 (51.04%), Postives = 412/576 (71.53%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLC---KKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIIST-EFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLS-IRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            +D+ +QPLLTD+YQI+M YAYWK+G  ++ AVFD++FRKNPF+GE+T+F GLE+CL  ++ FK+S++DI+Y++KI+P + +  F+ YL+ LN + +T+ ++ EGSVVFPKVPL+ + GPL +CQL+ET +LNLVN++SLVATNAARFRQA+G   QLLEFGLRR+QGP+GG++AS+ C++GGF+ATSNVLAGK+Y IP+KGT AH+++ S+S   ELK   +         D   +    + W     +    L  + ++GE ++F++YA+AFP TFL L+DTYDVI+SG+ NF++VSLAL++ GY+++G RIDSGDL+YLS E+R+ F  +ST + +  +F  ++IVASNDINE+T+ SLN Q+                                     H I++FG+GTHLVTCQKQPALGCVYKLV  + Q  IKLS+D+ K+TIPGKK  YR+FGK+G A+ D +   +EP P  N ++LCRHP + SKRA VN + I  +H VYWKDG+ +  +P+L E+K+H   S+ S +R DH+R LNPTPYKVSVS  LY F   +WL++APIG+L
Sbjct:   24 QDSLVQPLLTDFYQITMCYAYWKTGTHNEPAVFDVFFRKNPFQGEFTVFAGLEDCLRFVENFKFSQSDIDYVKKILPENAEPEFYEYLETLNGSHLTIEAVAEGSVVFPKVPLLTINGPLAMCQLIETSILNLVNYASLVATNAARFRQASGWKIQLLEFGLRRAQGPNGGLTASKYCYIGGFDATSNVLAGKLYGIPVKGTQAHSFICSFSSPAELKVRLLNHKITNEKADLFQISMEKRAWLLDQFSWKAAL-SEVSDGELSAFVAYAIAFPDTFLALIDTYDVIRSGVVNFVAVSLALHDLGYRSMGCRIDSGDLSYLSKELRECFVKVSTLKGEYKFFEKMSIVASNDINEETIMSLNDQQ-------------------------------------HEINAFGVGTHLVTCQKQPALGCVYKLVAQSAQPKIKLSQDVTKITIPGKKKCYRIFGKNGYAILDLMMLEDEPEPQPNQQILCRHPFEESKRALVNANKIIKLHNVYWKDGEMITPLPTLNEIKEHVNESIRSTLRQDHRRYLNPTPYKVSVSERLYQFLHTLWLQNAPIGQL 561          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Celegans
Match: nprt-1 (Nicotinate phosphoribosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q95XX1])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 294/576 (51.04%), Postives = 412/576 (71.53%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLC---KKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIIST-EFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLS-IRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            +D+ +QPLLTD+YQI+M YAYWK+G  ++ AVFD++FRKNPF+GE+T+F GLE+CL  ++ FK+S++DI+Y++KI+P + +  F+ YL+ LN + +T+ ++ EGSVVFPKVPL+ + GPL +CQL+ET +LNLVN++SLVATNAARFRQA+G   QLLEFGLRR+QGP+GG++AS+ C++GGF+ATSNVLAGK+Y IP+KGT AH+++ S+S   ELK   +         D   +    + W     +    L  + ++GE ++F++YA+AFP TFL L+DTYDVI+SG+ NF++VSLAL++ GY+++G RIDSGDL+YLS E+R+ F  +ST + +  +F  ++IVASNDINE+T+ SLN Q+                                     H I++FG+GTHLVTCQKQPALGCVYKLV  + Q  IKLS+D+ K+TIPGKK  YR+FGK+G A+ D +   +EP P  N ++LCRHP + SKRA VN + I  +H VYWKDG+ +  +P+L E+K+H   S+ S +R DH+R LNPTPYKVSVS  LY F   +WL++APIG+L
Sbjct:   24 QDSLVQPLLTDFYQITMCYAYWKTGTHNEPAVFDVFFRKNPFQGEFTVFAGLEDCLRFVENFKFSQSDIDYVKKILPENAEPEFYEYLETLNGSHLTIEAVAEGSVVFPKVPLLTINGPLAMCQLIETSILNLVNYASLVATNAARFRQASGWKIQLLEFGLRRAQGPNGGLTASKYCYIGGFDATSNVLAGKLYGIPVKGTQAHSFICSFSSPAELKVRLLNHKITNEKADLFQISMEKRAWLLDQFSWKAAL-SEVSDGELSAFVAYAIAFPDTFLALIDTYDVIRSGVVNFVAVSLALHDLGYRSMGCRIDSGDLSYLSKELRECFVKVSTLKGEYKFFEKMSIVASNDINEETIMSLNDQQ-------------------------------------HEINAFGVGTHLVTCQKQPALGCVYKLVAQSAQPKIKLSQDVTKITIPGKKKCYRIFGKNGYAILDLMMLEDEPEPQPNQQILCRHPFEESKRALVNANKIIKLHNVYWKDGEMITPLPTLNEIKEHVNESIRSTLRQDHRRYLNPTPYKVSVSERLYQFLHTLWLQNAPIGQL 561          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Celegans
Match: nprt-1 (Nicotinate phosphoribosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q95XX1])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 294/576 (51.04%), Postives = 412/576 (71.53%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLC---KKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIIST-EFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLS-IRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            +D+ +QPLLTD+YQI+M YAYWK+G  ++ AVFD++FRKNPF+GE+T+F GLE+CL  ++ FK+S++DI+Y++KI+P + +  F+ YL+ LN + +T+ ++ EGSVVFPKVPL+ + GPL +CQL+ET +LNLVN++SLVATNAARFRQA+G   QLLEFGLRR+QGP+GG++AS+ C++GGF+ATSNVLAGK+Y IP+KGT AH+++ S+S   ELK   +         D   +    + W     +    L  + ++GE ++F++YA+AFP TFL L+DTYDVI+SG+ NF++VSLAL++ GY+++G RIDSGDL+YLS E+R+ F  +ST + +  +F  ++IVASNDINE+T+ SLN Q+                                     H I++FG+GTHLVTCQKQPALGCVYKLV  + Q  IKLS+D+ K+TIPGKK  YR+FGK+G A+ D +   +EP P  N ++LCRHP + SKRA VN + I  +H VYWKDG+ +  +P+L E+K+H   S+ S +R DH+R LNPTPYKVSVS  LY F   +WL++APIG+L
Sbjct:    4 QDSLVQPLLTDFYQITMCYAYWKTGTHNEPAVFDVFFRKNPFQGEFTVFAGLEDCLRFVENFKFSQSDIDYVKKILPENAEPEFYEYLETLNGSHLTIEAVAEGSVVFPKVPLLTINGPLAMCQLIETSILNLVNYASLVATNAARFRQASGWKIQLLEFGLRRAQGPNGGLTASKYCYIGGFDATSNVLAGKLYGIPVKGTQAHSFICSFSSPAELKVRLLNHKITNEKADLFQISMEKRAWLLDQFSWKAAL-SEVSDGELSAFVAYAIAFPDTFLALIDTYDVIRSGVVNFVAVSLALHDLGYRSMGCRIDSGDLSYLSKELRECFVKVSTLKGEYKFFEKMSIVASNDINEETIMSLNDQQ-------------------------------------HEINAFGVGTHLVTCQKQPALGCVYKLVAQSAQPKIKLSQDVTKITIPGKKKCYRIFGKNGYAILDLMMLEDEPEPQPNQQILCRHPFEESKRALVNANKIIKLHNVYWKDGEMITPLPTLNEIKEHVNESIRSTLRQDHRRYLNPTPYKVSVSERLYQFLHTLWLQNAPIGQL 541          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Celegans
Match: nprt-1 (Nicotinate phosphoribosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q95XX1])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 294/576 (51.04%), Postives = 412/576 (71.53%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLC---KKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIIST-EFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLS-IRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            +D+ +QPLLTD+YQI+M YAYWK+G  ++ AVFD++FRKNPF+GE+T+F GLE+CL  ++ FK+S++DI+Y++KI+P + +  F+ YL+ LN + +T+ ++ EGSVVFPKVPL+ + GPL +CQL+ET +LNLVN++SLVATNAARFRQA+G   QLLEFGLRR+QGP+GG++AS+ C++GGF+ATSNVLAGK+Y IP+KGT AH+++ S+S   ELK   +         D   +    + W     +    L  + ++GE ++F++YA+AFP TFL L+DTYDVI+SG+ NF++VSLAL++ GY+++G RIDSGDL+YLS E+R+ F  +ST + +  +F  ++IVASNDINE+T+ SLN Q+                                     H I++FG+GTHLVTCQKQPALGCVYKLV  + Q  IKLS+D+ K+TIPGKK  YR+FGK+G A+ D +   +EP P  N ++LCRHP + SKRA VN + I  +H VYWKDG+ +  +P+L E+K+H   S+ S +R DH+R LNPTPYKVSVS  LY F   +WL++APIG+L
Sbjct:    4 QDSLVQPLLTDFYQITMCYAYWKTGTHNEPAVFDVFFRKNPFQGEFTVFAGLEDCLRFVENFKFSQSDIDYVKKILPENAEPEFYEYLETLNGSHLTIEAVAEGSVVFPKVPLLTINGPLAMCQLIETSILNLVNYASLVATNAARFRQASGWKIQLLEFGLRRAQGPNGGLTASKYCYIGGFDATSNVLAGKLYGIPVKGTQAHSFICSFSSPAELKVRLLNHKITNEKADLFQISMEKRAWLLDQFSWKAAL-SEVSDGELSAFVAYAIAFPDTFLALIDTYDVIRSGVVNFVAVSLALHDLGYRSMGCRIDSGDLSYLSKELRECFVKVSTLKGEYKFFEKMSIVASNDINEETIMSLNDQQ-------------------------------------HEINAFGVGTHLVTCQKQPALGCVYKLVAQSAQPKIKLSQDVTKITIPGKKKCYRIFGKNGYAILDLMMLEDEPEPQPNQQILCRHPFEESKRALVNANKIIKLHNVYWKDGEMITPLPTLNEIKEHVNESIRSTLRQDHRRYLNPTPYKVSVSERLYQFLHTLWLQNAPIGQL 541          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Celegans
Match: nprt-1 (Nicotinate phosphoribosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q95XX1])

HSP 1 Score: 303.138 bits (775), Expect = 3.920e-98
Identity = 129/219 (58.90%), Postives = 185/219 (84.47%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQ 715
            +D+ +QPLLTD+YQI+M YAYWK+G  ++ AVFD++FRKNPF+GE+T+F GLE+CL  ++ FK+S++DI+Y++KI+P + +  F+ YL+ LN + +T+ ++ EGSVVFPKVPL+ + GPL +CQL+ET +LNLVN++SLVATNAARFRQA+G   QLLEFGLRR+QGP+GG++AS+ C++GGF+ATSNVLAGK+Y IP+KGT AH+++ S+S   E++ 
Sbjct:    4 QDSLVQPLLTDFYQITMCYAYWKTGTHNEPAVFDVFFRKNPFQGEFTVFAGLEDCLRFVENFKFSQSDIDYVKKILPENAEPEFYEYLETLNGSHLTIEAVAEGSVVFPKVPLLTINGPLAMCQLIETSILNLVNYASLVATNAARFRQASGWKIQLLEFGLRRAQGPNGGLTASKYCYIGGFDATSNVLAGKLYGIPVKGTQAHSFICSFSSPAEVEH 222          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Fly
Match: Naprt (gene:FBgn0031589 transcript:FBtr0077481)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 312/572 (54.55%), Postives = 412/572 (72.03%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            ++  +QPLLTD YQI+M+YAYWKS KT DTAVFDL+FR NPF GE+TIF GLE CL  +  F YS++DIEYL++ +P  ++  FF YL +L A D+TL ++ EG+V FP+VP++ +EGPLII QLLET LL LVN++SL+ATNAAR+R  AG++ +LLEFGLRR+QGPDGG+SAS+  + GGF+ TSNVLAGK++NIP+KGTHAHAY+TS+S +GELK   +K        D L+   +    ++++L V  ++++EGE A+ +SYA+AFP  F+ LVDTYDV +SG+ NF +V+LALN+ GY A+G+RIDSGDLAYLS   R+ F  ++  F + WF  LTIVASNDINEDT+ SLN+                                     QGH ID FGIGTHLVTCQ+QPALGCVYKLVEINGQ  IKLS+D++K+T+PG K  YRL+  DG AL D L   +EP P    ++LCRHP   SKRAYV PS +E ++KVYWK G+   ++P+L ++++  + SL ++R DHKR LNPTPYKV+VS NLY+F  ++WL++APIGELS
Sbjct:   21 QNGVVQPLLTDLYQITMAYAYWKSDKTDDTAVFDLFFRNNPFHGEFTIFAGLEECLKFLDSFHYSQSDIEYLKQTLPEGIEHEFFEYLGNLTARDVTLYAIDEGTVAFPRVPIIKIEGPLIIVQLLETTLLTLVNYASLMATNAARYRMVAGKHVKLLEFGLRRAQGPDGGLSASKYSYTGGFDGTSNVLAGKLFNIPVKGTHAHAYITSFSSIGELKTRLIKHKQTGILEDLLEHAVRHRALLSHLLDVSTEESSEGELAAMVSYAIAFPDGFMALVDTYDVKRSGLLNFSAVALALNDLGYHALGIRIDSGDLAYLSCLARETFEKVAERFKVPWFNKLTIVASNDINEDTILSLNE-------------------------------------QGHKIDCFGIGTHLVTCQRQPALGCVYKLVEINGQPRIKLSQDVEKVTMPGNKNAYRLYSADGHALIDLLQKVSEPPPAVGQKVLCRHPFQESKRAYVIPSHVESLYKVYWKSGKICQQLPTLEQVREKVQISLKTLRNDHKRTLNPTPYKVAVSDNLYNFIHDLWLQNAPIGELS 555          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Fly
Match: Naprt (gene:FBgn0031589 transcript:FBtr0334791)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 309/572 (54.02%), Postives = 408/572 (71.33%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            ++  +QPLLTD YQI+M+YAYWKS KT DTAVFDL+FR NPF GE+TIF GLE CL  +  F YS++DIEYL++ +P  ++  FF YL +L A D+TL ++ EG+V FP+VP++ +EGPLII QLLET LL LVN++SL+ATNAAR+R  AG++ +LLEFGLRR+QGPDGG+SAS+  + GGF+ TSNVLAGK++NIP+KGTHAHAY+TS+S +GELK   +K        D L+   +    ++++L V  ++++EGE A+ +SYA+AFP  F+ LVDT     SG+ NF +V+LALN+ GY A+G+RIDSGDLAYLS   R+ F  ++  F + WF  LTIVASNDINEDT+ SLN+                                     QGH ID FGIGTHLVTCQ+QPALGCVYKLVEINGQ  IKLS+D++K+T+PG K  YRL+  DG AL D L   +EP P    ++LCRHP   SKRAYV PS +E ++KVYWK G+   ++P+L ++++  + SL ++R DHKR LNPTPYKV+VS NLY+F  ++WL++APIGELS
Sbjct:   21 QNGVVQPLLTDLYQITMAYAYWKSDKTDDTAVFDLFFRNNPFHGEFTIFAGLEECLKFLDSFHYSQSDIEYLKQTLPEGIEHEFFEYLGNLTARDVTLYAIDEGTVAFPRVPIIKIEGPLIIVQLLETTLLTLVNYASLMATNAARYRMVAGKHVKLLEFGLRRAQGPDGGLSASKYSYTGGFDGTSNVLAGKLFNIPVKGTHAHAYITSFSSIGELKTRLIKHKQTGILEDLLEHAVRHRALLSHLLDVSTEESSEGELAAMVSYAIAFPDGFMALVDT-----SGLLNFSAVALALNDLGYHALGIRIDSGDLAYLSCLARETFEKVAERFKVPWFNKLTIVASNDINEDTILSLNE-------------------------------------QGHKIDCFGIGTHLVTCQRQPALGCVYKLVEINGQPRIKLSQDVEKVTMPGNKNAYRLYSADGHALIDLLQKVSEPPPAVGQKVLCRHPFQESKRAYVIPSHVESLYKVYWKSGKICQQLPTLEQVREKVQISLKTLRNDHKRTLNPTPYKVAVSDNLYNFIHDLWLQNAPIGELS 550          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Fly
Match: Naprt (gene:FBgn0031589 transcript:FBtr0077482)

HSP 1 Score: 341.658 bits (875), Expect = 3.319e-107
Identity = 161/283 (56.89%), Postives = 218/283 (77.03%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDV 907
            ++  +QPLLTD YQI+M+YAYWKS KT DTAVFDL+FR NPF GE+TIF GLE CL  +  F YS++DIEYL++ +P  ++  FF YL +L A D+TL ++ EG+V FP+VP++ +EGPLII QLLET LL LVN++SL+ATNAAR+R  AG++ +LLEFGLRR+QGPDGG+SAS+  + GGF+ TSNVLAGK++NIP+KGTHAHAY+TS+S +GELK   +K        D L+   +    ++++L V  ++++EGE A+ +SYA+AFP  F+ LVDTYDV
Sbjct:   21 QNGVVQPLLTDLYQITMAYAYWKSDKTDDTAVFDLFFRNNPFHGEFTIFAGLEECLKFLDSFHYSQSDIEYLKQTLPEGIEHEFFEYLGNLTARDVTLYAIDEGTVAFPRVPIIKIEGPLIIVQLLETTLLTLVNYASLMATNAARYRMVAGKHVKLLEFGLRRAQGPDGGLSASKYSYTGGFDGTSNVLAGKLFNIPVKGTHAHAYITSFSSIGELKTRLIKHKQTGILEDLLEHAVRHRALLSHLLDVSTEESSEGELAAMVSYAIAFPDGFMALVDTYDV 303          

HSP 2 Score: 305.834 bits (782), Expect = 1.421e-93
Identity = 151/289 (52.25%), Postives = 194/289 (67.13%), Query Frame = 2
Query:  908 IKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
             +SG+ NF +V+LALN+ GY A+G+RIDSGDLAYLS   R+ F  ++  F + WF  LTIVASNDINEDT+ SLN+Q                                     GH ID FGIGTHLVTCQ+QPALGCVYKLVEINGQ  IKLS+D++K+T+PG K  YRL+  DG AL D L   +EP P    ++LCRHP   SKRAYV PS +E ++KVYWK G+   ++P+L ++++  + SL ++R DHKR LNPTPYKV+VS NLY+F  ++WL++APIGELS
Sbjct:  416 FRSGLLNFSAVALALNDLGYHALGIRIDSGDLAYLSCLARETFEKVAERFKVPWFNKLTIVASNDINEDTILSLNEQ-------------------------------------GHKIDCFGIGTHLVTCQRQPALGCVYKLVEINGQPRIKLSQDVEKVTMPGNKNAYRLYSADGHALIDLLQKVSEPPPAVGQKVLCRHPFQESKRAYVIPSHVESLYKVYWKSGKICQQLPTLEQVREKVQISLKTLRNDHKRTLNPTPYKVAVSDNLYNFIHDLWLQNAPIGELS 667          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Fly
Match: Naprt (gene:FBgn0031589 transcript:FBtr0077479)

HSP 1 Score: 341.658 bits (875), Expect = 3.319e-107
Identity = 161/283 (56.89%), Postives = 218/283 (77.03%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDV 907
            ++  +QPLLTD YQI+M+YAYWKS KT DTAVFDL+FR NPF GE+TIF GLE CL  +  F YS++DIEYL++ +P  ++  FF YL +L A D+TL ++ EG+V FP+VP++ +EGPLII QLLET LL LVN++SL+ATNAAR+R  AG++ +LLEFGLRR+QGPDGG+SAS+  + GGF+ TSNVLAGK++NIP+KGTHAHAY+TS+S +GELK   +K        D L+   +    ++++L V  ++++EGE A+ +SYA+AFP  F+ LVDTYDV
Sbjct:   21 QNGVVQPLLTDLYQITMAYAYWKSDKTDDTAVFDLFFRNNPFHGEFTIFAGLEECLKFLDSFHYSQSDIEYLKQTLPEGIEHEFFEYLGNLTARDVTLYAIDEGTVAFPRVPIIKIEGPLIIVQLLETTLLTLVNYASLMATNAARYRMVAGKHVKLLEFGLRRAQGPDGGLSASKYSYTGGFDGTSNVLAGKLFNIPVKGTHAHAYITSFSSIGELKTRLIKHKQTGILEDLLEHAVRHRALLSHLLDVSTEESSEGELAAMVSYAIAFPDGFMALVDTYDV 303          

HSP 2 Score: 305.834 bits (782), Expect = 1.421e-93
Identity = 151/289 (52.25%), Postives = 194/289 (67.13%), Query Frame = 2
Query:  908 IKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
             +SG+ NF +V+LALN+ GY A+G+RIDSGDLAYLS   R+ F  ++  F + WF  LTIVASNDINEDT+ SLN+Q                                     GH ID FGIGTHLVTCQ+QPALGCVYKLVEINGQ  IKLS+D++K+T+PG K  YRL+  DG AL D L   +EP P    ++LCRHP   SKRAYV PS +E ++KVYWK G+   ++P+L ++++  + SL ++R DHKR LNPTPYKV+VS NLY+F  ++WL++APIGELS
Sbjct:  416 FRSGLLNFSAVALALNDLGYHALGIRIDSGDLAYLSCLARETFEKVAERFKVPWFNKLTIVASNDINEDTILSLNEQ-------------------------------------GHKIDCFGIGTHLVTCQRQPALGCVYKLVEINGQPRIKLSQDVEKVTMPGNKNAYRLYSADGHALIDLLQKVSEPPPAVGQKVLCRHPFQESKRAYVIPSHVESLYKVYWKSGKICQQLPTLEQVREKVQISLKTLRNDHKRTLNPTPYKVAVSDNLYNFIHDLWLQNAPIGELS 667          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Fly
Match: Naprt (gene:FBgn0031589 transcript:FBtr0113020)

HSP 1 Score: 341.658 bits (875), Expect = 3.319e-107
Identity = 161/283 (56.89%), Postives = 218/283 (77.03%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDV 907
            ++  +QPLLTD YQI+M+YAYWKS KT DTAVFDL+FR NPF GE+TIF GLE CL  +  F YS++DIEYL++ +P  ++  FF YL +L A D+TL ++ EG+V FP+VP++ +EGPLII QLLET LL LVN++SL+ATNAAR+R  AG++ +LLEFGLRR+QGPDGG+SAS+  + GGF+ TSNVLAGK++NIP+KGTHAHAY+TS+S +GELK   +K        D L+   +    ++++L V  ++++EGE A+ +SYA+AFP  F+ LVDTYDV
Sbjct:   21 QNGVVQPLLTDLYQITMAYAYWKSDKTDDTAVFDLFFRNNPFHGEFTIFAGLEECLKFLDSFHYSQSDIEYLKQTLPEGIEHEFFEYLGNLTARDVTLYAIDEGTVAFPRVPIIKIEGPLIIVQLLETTLLTLVNYASLMATNAARYRMVAGKHVKLLEFGLRRAQGPDGGLSASKYSYTGGFDGTSNVLAGKLFNIPVKGTHAHAYITSFSSIGELKTRLIKHKQTGILEDLLEHAVRHRALLSHLLDVSTEESSEGELAAMVSYAIAFPDGFMALVDTYDV 303          

HSP 2 Score: 305.834 bits (782), Expect = 1.421e-93
Identity = 151/289 (52.25%), Postives = 194/289 (67.13%), Query Frame = 2
Query:  908 IKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
             +SG+ NF +V+LALN+ GY A+G+RIDSGDLAYLS   R+ F  ++  F + WF  LTIVASNDINEDT+ SLN+Q                                     GH ID FGIGTHLVTCQ+QPALGCVYKLVEINGQ  IKLS+D++K+T+PG K  YRL+  DG AL D L   +EP P    ++LCRHP   SKRAYV PS +E ++KVYWK G+   ++P+L ++++  + SL ++R DHKR LNPTPYKV+VS NLY+F  ++WL++APIGELS
Sbjct:  416 FRSGLLNFSAVALALNDLGYHALGIRIDSGDLAYLSCLARETFEKVAERFKVPWFNKLTIVASNDINEDTILSLNEQ-------------------------------------GHKIDCFGIGTHLVTCQRQPALGCVYKLVEINGQPRIKLSQDVEKVTMPGNKNAYRLYSADGHALIDLLQKVSEPPPAVGQKVLCRHPFQESKRAYVIPSHVESLYKVYWKSGKICQQLPTLEQVREKVQISLKTLRNDHKRTLNPTPYKVAVSDNLYNFIHDLWLQNAPIGELS 667          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Zebrafish
Match: naprt (nicotinate phosphoribosyltransferase [Source:NCBI gene;Acc:393864])

HSP 1 Score: 479.559 bits (1233), Expect = 6.321e-162
Identity = 236/560 (42.14%), Postives = 348/560 (62.14%), Query Frame = 2
Query:   65 NYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLC-RHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEM 1741
            N + PLLTD YQ +M+YAYW++G+ ++ AVF+L+FR NPF G +++F GL +CL  ++ F +S++D++YLR ++P D D  FF YLK L+ + +++ ++PEGSVVF +VPL+ V GPL + QLLET LL LVN++SLV +NAARFR AAG  ++L+E GLRR+QGPDGG++ASR  ++GGF+ TSN LAG++Y IP+ GT AH+Y+TS+S L E+   T+K      ++DF+ L K    +V  +LG       EGE A+F+SYA+A+P  FL ++D+Y V  SG+  F +V+LAL E  Y+ +GVR+DSGDL   S ++R+ F   S  F +  F SL IV +N I+E +L  LN+++N                                      ID  G+GTHLVTC +QP+LGCVYKLVE+ G+  +KLSED +K T+PG+KA+YRL   DG    D L   +E  P     L C     +++ +  + P+ +  +    +  GQ  + + S  E ++ A+ SL  + P HKR   P  Y V++S  L+    ++
Sbjct:   12 NRVPPLLTDLYQFTMAYAYWRAGRHNEPAVFELFFRDNPFGGGFSLFAGLSDCLLFLQNFSFSDDDVQYLRSVLPADTDAGFFSYLKELDCSCVSVSAVPEGSVVFARVPLLEVSGPLAVVQLLETSLLCLVNYASLVCSNAARFRLAAGPRRRLMEMGLRRAQGPDGGLTASRYTYIGGFDLTSNALAGRLYGIPVAGTMAHSYITSFSSLEEVWPQTLKPCGGGDSIDFICLVKGLLGRVCQLLGSKTSLIREGELAAFLSYAIAYPQNFLPVIDSYSVRCSGLLCFCAVALALFELQYRPLGVRLDSGDLCRQSLDVRRVFRECSKHFSVPQFESLIIVGTNSISEQSLSELNKKDN-------------------------------------EIDVVGVGTHLVTCTRQPSLGCVYKLVEVRGRPRMKLSEDPEKSTLPGRKAVYRLLDADGHPQMDVLCLCDEAAPAAGVELQCFSLLGNSTLQCSITPAQVSSLRTQVFSCGQITLPLNSASESRERAQISLQMLNPHHKRLQEPLNYTVALSERLHSLVSDI 534          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Xenopus
Match: znf33a (zinc finger protein 33A [Source:Xenbase;Acc:XB-GENE-5824922])

HSP 1 Score: 220.32 bits (560), Expect = 1.354e-66
Identity = 109/205 (53.17%), Postives = 153/205 (74.63%), Query Frame = 2
Query:  428 QLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKT-SDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFH 1039
            Q L + LL    + SLV TNA+RFR AAG +K+LLE GLRR+QGPDGG+SASR C+LGGF++TSNVLAGK+Y IP+ GT AH+YV S+S + +++  +++  +      DF++L ++   +V  +L V  + TN+GE A+FISYA+AFP  FL ++DTY V++SG+PNF +V+ AL+  GY+AVGVR+DSG+LA  S EIR+ FH
Sbjct:    7 QQLVSFLLPFPLWFSLVGTNASRFRLAAGPDKKLLEMGLRRAQGPDGGLSASRYCYLGGFDSTSNVLAGKLYGIPVAGTVAHSYVASFSSVADVRHGSLRPLNGDDRGGDFVELSERCLGEVCELLRVPKEHTNKGELAAFISYAIAFPQNFLVVLDTYSVMRSGVPNFCAVARALHHYGYQAVGVRLDSGNLARQSVEIREIFH 211          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Xenopus
Match: nkrf (NFKB repressing factor [Source:Xenbase;Acc:XB-GENE-877251])

HSP 1 Score: 65.0846 bits (157), Expect = 2.160e-12
Identity = 35/84 (41.67%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 1358 IKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIP 1609
            +KLSED +K TIPG KAIYRLFG +   + D L C +EP P+    L C       +   V P   E++H V + DG+  V  P
Sbjct:    1 MKLSEDTEKATIPGSKAIYRLFGHNDHPILDLLACEDEPPPETGIELECHKLGGNGETERVAPVKAELMHSVCF-DGKVSVPTP 83          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Mouse
Match: Naprt (nicotinate phosphoribosyltransferase [Source:MGI Symbol;Acc:MGI:2442664])

HSP 1 Score: 458.373 bits (1178), Expect = 1.068e-153
Identity = 230/552 (41.67%), Postives = 335/552 (60.69%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTM--KTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNL 1720
            ++PLLTD YQ +M+  YW++G+  + A F+L+FR  PF G + +  GL++C+  ++ F+  + D+++L  ++P D D  FF +L+ L+ + +T+ +LPEGS+ FP VPL+ V GPL++ QLLET LL LV+++SLVATNAAR R  AG +K+LLE GLRR+QGPDGG +AS   +LGGF+++SN LAG++  +P+ GT AH++VTS+S   E+    M    S +  TVD       W K+V   LG+   + + GE A+F++YALAFP  F  L+D+Y V +SG+PNF++V+LAL E GY+AVGVR+DSGDL   + EIR  F     +F + W  S+ I  SN+I+E  L  L Q                                     +G  ++  GIGT +VTC KQP++GCVYKLV + GQ  IKL+ED +K T+PG KA +R  G DG  L D L  + EP P     L    P    +   V P+ +E + ++Y + GQ    +PSL E +  A++SL  +RP HK+  +P  Y V++S  L
Sbjct:   13 VRPLLTDLYQATMALGYWRAGRACEAAEFELFFRHCPFGGSFALSAGLQDCMRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSGVTVRALPEGSLAFPGVPLLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPDKKLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGVPVAGTLAHSFVTSFSG-SEVPPDPMLAPASSEGPTVDLPARVNLWLKRVCLYLGLEEQEPHPGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAKEIRGIFRTAGAQFQMPWLESVPIAVSNNIDESELMRLAQ-------------------------------------KGSEVNVIGIGTSVVTCPKQPSMGCVYKLVSVGGQPRIKLTEDPEKQTLPGSKAAFRFLGPDGSLLLDLLQLAEEPPPKAGQELRV-WPRGTQEPCTVKPAQVEPLLRLYLQQGQLCEPLPSLDESRRFAQQSLSLLRPAHKQLQSPAVYPVALSEKL 525          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Mouse
Match: Naprt (nicotinate phosphoribosyltransferase [Source:MGI Symbol;Acc:MGI:2442664])

HSP 1 Score: 332.028 bits (850), Expect = 1.544e-107
Identity = 154/330 (46.67%), Postives = 227/330 (68.79%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTM--KTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTE 1054
            ++PLLTD YQ +M+  YW++G+  + A F+L+FR  PF G + +  GL++C+  ++ F+  + D+++L  ++P D D  FF +L+ L+ + +T+ +LPEGS+ FP VPL+ V GPL++ QLLET LL LV+++SLVATNAAR R  AG +K+LLE GLRR+QGPDGG +AS   +LGGF+++SN LAG++  +P+ GT AH++VTS+S   E+    M    S +  TVD       W K+V   LG+   + + GE A+F++YALAFP  F  L+D+Y V +SG+PNF++V+LAL E GY+AVGVR+DSGDL   + EIR  F     +
Sbjct:   13 VRPLLTDLYQATMALGYWRAGRACEAAEFELFFRHCPFGGSFALSAGLQDCMRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSGVTVRALPEGSLAFPGVPLLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPDKKLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGVPVAGTLAHSFVTSFSG-SEVPPDPMLAPASSEGPTVDLPARVNLWLKRVCLYLGLEEQEPHPGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAKEIRGIFRTAGAQ 341          
BLAST of Nicotinate phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q9VQX4|PNCB_DROME (Nicotinate phosphoribosyltransferase OS=Drosophila melanogaster OX=7227 GN=Naprt PE=2 SV=2)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 312/572 (54.55%), Postives = 412/572 (72.03%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            ++  +QPLLTD YQI+M+YAYWKS KT DTAVFDL+FR NPF GE+TIF GLE CL  +  F YS++DIEYL++ +P  ++  FF YL +L A D+TL ++ EG+V FP+VP++ +EGPLII QLLET LL LVN++SL+ATNAAR+R  AG++ +LLEFGLRR+QGPDGG+SAS+  + GGF+ TSNVLAGK++NIP+KGTHAHAY+TS+S +GELK   +K        D L+   +    ++++L V  ++++EGE A+ +SYA+AFP  F+ LVDTYDV +SG+ NF +V+LALN+ GY A+G+RIDSGDLAYLS   R+ F  ++  F + WF  LTIVASNDINEDT+ SLN+                                     QGH ID FGIGTHLVTCQ+QPALGCVYKLVEINGQ  IKLS+D++K+T+PG K  YRL+  DG AL D L   +EP P    ++LCRHP   SKRAYV PS +E ++KVYWK G+   ++P+L ++++  + SL ++R DHKR LNPTPYKV+VS NLY+F  ++WL++APIGELS
Sbjct:   21 QNGVVQPLLTDLYQITMAYAYWKSDKTDDTAVFDLFFRNNPFHGEFTIFAGLEECLKFLDSFHYSQSDIEYLKQTLPEGIEHEFFEYLGNLTARDVTLYAIDEGTVAFPRVPIIKIEGPLIIVQLLETTLLTLVNYASLMATNAARYRMVAGKHVKLLEFGLRRAQGPDGGLSASKYSYTGGFDGTSNVLAGKLFNIPVKGTHAHAYITSFSSIGELKTRLIKHKQTGILEDLLEHAVRHRALLSHLLDVSTEESSEGELAAMVSYAIAFPDGFMALVDTYDVKRSGLLNFSAVALALNDLGYHALGIRIDSGDLAYLSCLARETFEKVAERFKVPWFNKLTIVASNDINEDTILSLNE-------------------------------------QGHKIDCFGIGTHLVTCQRQPALGCVYKLVEINGQPRIKLSQDVEKVTMPGNKNAYRLYSADGHALIDLLQKVSEPPPAVGQKVLCRHPFQESKRAYVIPSHVESLYKVYWKSGKICQQLPTLEQVREKVQISLKTLRNDHKRTLNPTPYKVAVSDNLYNFIHDLWLQNAPIGELS 555          
BLAST of Nicotinate phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q95XX1|PNCB_CAEEL (Nicotinate phosphoribosyltransferase OS=Caenorhabditis elegans OX=6239 GN=nprt-1 PE=3 SV=3)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 294/576 (51.04%), Postives = 412/576 (71.53%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLC---KKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIIST-EFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLS-IRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            +D+ +QPLLTD+YQI+M YAYWK+G  ++ AVFD++FRKNPF+GE+T+F GLE+CL  ++ FK+S++DI+Y++KI+P + +  F+ YL+ LN + +T+ ++ EGSVVFPKVPL+ + GPL +CQL+ET +LNLVN++SLVATNAARFRQA+G   QLLEFGLRR+QGP+GG++AS+ C++GGF+ATSNVLAGK+Y IP+KGT AH+++ S+S   ELK   +         D   +    + W     +    L  + ++GE ++F++YA+AFP TFL L+DTYDVI+SG+ NF++VSLAL++ GY+++G RIDSGDL+YLS E+R+ F  +ST + +  +F  ++IVASNDINE+T+ SLN Q+                                     H I++FG+GTHLVTCQKQPALGCVYKLV  + Q  IKLS+D+ K+TIPGKK  YR+FGK+G A+ D +   +EP P  N ++LCRHP + SKRA VN + I  +H VYWKDG+ +  +P+L E+K+H   S+ S +R DH+R LNPTPYKVSVS  LY F   +WL++APIG+L
Sbjct:   24 QDSLVQPLLTDFYQITMCYAYWKTGTHNEPAVFDVFFRKNPFQGEFTVFAGLEDCLRFVENFKFSQSDIDYVKKILPENAEPEFYEYLETLNGSHLTIEAVAEGSVVFPKVPLLTINGPLAMCQLIETSILNLVNYASLVATNAARFRQASGWKIQLLEFGLRRAQGPNGGLTASKYCYIGGFDATSNVLAGKLYGIPVKGTQAHSFICSFSSPAELKVRLLNHKITNEKADLFQISMEKRAWLLDQFSWKAAL-SEVSDGELSAFVAYAIAFPDTFLALIDTYDVIRSGVVNFVAVSLALHDLGYRSMGCRIDSGDLSYLSKELRECFVKVSTLKGEYKFFEKMSIVASNDINEETIMSLNDQQ-------------------------------------HEINAFGVGTHLVTCQKQPALGCVYKLVAQSAQPKIKLSQDVTKITIPGKKKCYRIFGKNGYAILDLMMLEDEPEPQPNQQILCRHPFEESKRALVNANKIIKLHNVYWKDGEMITPLPTLNEIKEHVNESIRSTLRQDHRRYLNPTPYKVSVSERLYQFLHTLWLQNAPIGQL 561          
BLAST of Nicotinate phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q84WV8|NPRT2_ARATH (Nicotinate phosphoribosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=NAPRT2 PE=2 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 296/573 (51.66%), Postives = 394/573 (68.76%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSD-QTTTVDFLDLCKKWHKKVT---NILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVE--IPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            + PLL D YQ +M+YAYWK+GK ++ +VFDLYFRKNPF GEYT+F GLE C+  +  FK ++ +I+++++ +P   +E F  YL+ L+ +D+ + ++PEGSVVFPKVPLM VEGP+ + QLLET  LNLVNF+SLVATNAAR R  AG++K LLEFG RR+QGPDG +SAS+ C+LGGF+ATSNV AGK++ IP++GTH+HAYV+S+    E+    ++++D +TT  DF+   + W KK+    ++ G+   +TN+ E A+F SYALAFP TFL LVDTYDV+KSGIPNF +V+LALN+ GYKA+G+R+DSGDLAYLS E R  F  +  E  +  F  + + ASND+NE+T+ +LN+                                     QGH +D+FGIGT+LVTC  Q ALGCV+KLVEIN Q  IKLSED+ K++IP KK  YRL+GK+G  L D +T  NEP P    RLLCRHP + SKRAYV P  +E + K YW+         +P L E++D   + L ++RPDH R LNPTPYKVSVS+ LYDF   +WL  AP+GEL
Sbjct:   23 VTPLLNDLYQFTMAYAYWKAGKHNERSVFDLYFRKNPFGGEYTVFAGLEECVKFLANFKLTDEEIDFVQECLPGS-EEAFCDYLRGLDCSDVEVYAIPEGSVVFPKVPLMRVEGPVGVVQLLETPFLNLVNFASLVATNAARHRFVAGKSKSLLEFGARRAQGPDGAISASKYCYLGGFDATSNVAAGKLFGIPLRGTHSHAYVSSFMSTDEIVDKVLRSADGKTTCEDFVSHVQTWLKKIQYSPSLSGIF-SETNQSELAAFTSYALAFPKTFLALVDTYDVMKSGIPNFCAVALALNDFGYKALGIRLDSGDLAYLSREARNFFCTVERELKVPGFGKMVVTASNDLNEETIDALNK-------------------------------------QGHEVDAFGIGTYLVTCYSQAALGCVFKLVEINNQPRIKLSEDVTKVSIPCKKRSYRLYGKEGYPLVDIMTGENEPPPKVGERLLCRHPFNESKRAYVVPQRVEELLKCYWRGSADEAREVLPPLKEIRDRCIKQLENMRPDHMRRLNPTPYKVSVSAKLYDFIHFLWLNEAPVGEL 556          
BLAST of Nicotinate phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q8RWM2|NPRT1_ARATH (Nicotinate phosphoribosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=NAPRT1 PE=2 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 297/573 (51.83%), Postives = 396/573 (69.11%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSD-QTTTVDFLDLCKKWHKKVTN---ILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDG--QQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            + PLL D YQ +M+YAYWK+GK S+ +VFDLYFRKNPF GEYTIF GLE C+  +  F  ++ +I+++R  +P   +E F  YL+ L+ +DI + ++ EGSVVFPKVPL+ +EGP+ + QLLET  LNL+N++SLVATNAAR R  AG++K LLEFG RR+QGPDG +SAS+ C+LGGF+ATSNV AGK++ IP++GTH+HA+V+S+  L E+    +++SD ++T  DF+ L +    K+ N   + G+   +TN+ E A+FISYALAFP++FL LVDTYDV+KSGIPNF +V+LALNE GYKAVG+R+DSGDLAYLS E+RK F  I  +  +  F  + + ASND+NE+T+ +LN+                                     QGH +D+FGIGT+LVTC  Q ALGCV+KLVEIN Q  IKLSED+ K++IP KK  YRLFGK+G  L D +T  NEP P    RLLCRHP + SKRAYV P  +E + K YW+    +   E+  L E+++   + L ++RPDH R LNPTPYKVSVS+ LYDF   +WL  AP+GEL
Sbjct:   25 VTPLLNDLYQFTMAYAYWKAGKQSERSVFDLYFRKNPFGGEYTIFAGLEECIKFLANFNLTDEEIDFVRDSLPG-CEEAFCDYLRGLDCSDIEVYAISEGSVVFPKVPLLRIEGPVAVVQLLETPFLNLINYASLVATNAARHRFVAGKSKLLLEFGARRAQGPDGAISASKYCYLGGFDATSNVAAGKLFGIPLRGTHSHAFVSSFMSLDEIVDKVLRSSDGKSTCKDFICLVQTCLTKIQNSSSLQGIF-SETNQSELAAFISYALAFPNSFLALVDTYDVMKSGIPNFCAVALALNELGYKAVGIRLDSGDLAYLSTEVRKFFCAIERDLKVPDFGKMIVTASNDLNEETVDALNK-------------------------------------QGHEVDAFGIGTNLVTCYAQAALGCVFKLVEINNQPRIKLSEDVTKVSIPCKKRTYRLFGKEGYPLVDIMTGENEPPPKVGERLLCRHPFNESKRAYVVPQRVEELLKCYWRGNADEAREELEPLKELRNRCIKQLENMRPDHMRRLNPTPYKVSVSAKLYDFIHFLWLNEAPVGEL 558          
BLAST of Nicotinate phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q55G10|PNCB_DICDI (Nicotinate phosphoribosyltransferase OS=Dictyostelium discoideum OX=44689 GN=naprt PE=2 SV=1)

HSP 1 Score: 531.561 bits (1368), Expect = 1.090e-180
Identity = 264/577 (45.75%), Postives = 375/577 (64.99%), Query Frame = 2
Query:   62 DNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNE-------PMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            + ++ PLLTD YQI+M+Y+ WK+ +    AVFDLYFRK+PF GE+T+F GLE  +  +  F Y++ ++ ++++++P D ++ F  YL  L+++ +TL ++ EGSVVFP+VPL+ VEGP+I+CQL ET LL LVNF+SLVATNAAR R A G+ K +LEFGLRR+QGPDG MSASR  +LGG + TSNVLA   + IPI+GTHAH+++T+YS   EL  +++K ++     + L++ +K+  +    LG     TN  E  +F++YA  FP+  + LVDTYD + SG+PNFI V+LAL++ GYKAVG+R+DSGDL+YLS   RK F  I  +F + +F   +IVASND+NE T+ +LN+                                     QGH ID F IGT+LVTCQ QPALGCVYKLVEING   IKLS++ +K+T+PG+K  YRLFG +G  L D L   N+        +P    ++LC HP +  KR  V P  IE +H + ++ GQ  + +P+L +++++  + +  +R DH R  NPTPYKVSV+  L+D    +WL S PI E+
Sbjct:   57 NGFVTPLLTDLYQITMAYSLWKNNRHEIPAVFDLYFRKSPFGGEFTVFAGLEEVIRFVSDFHYTKEEVGFIKEMIP-DCEQEFLDYLSKLDSSSVTLYAMKEGSVVFPRVPLLRVEGPMILCQLFETTLLCLVNFASLVATNAARHRLAVGKEKVMLEFGLRRAQGPDGAMSASRYSYLGGADGTSNVLAHCFFGIPIRGTHAHSFITNYSGPDELLDASIKDTNGNVH-NLLEMSQKYRDE----LGY--TATNLSELVAFVAYARTFPNGLVALVDTYDTLASGVPNFICVALALHQLGYKAVGIRLDSGDLSYLSKASRKLFKQIGEQFKIDYFEKFSIVASNDLNEPTIIALNR-------------------------------------QGHEIDVFAIGTNLVTCQAQPALGCVYKLVEINGSPRIKLSQEANKITLPGRKTAYRLFGSEGHPLVDLLVDDNDMIKDGSKQIPQVGKKVLCLHPFEEQKRVIVTPVQIEKLHHIVFEKGQLTMPLPALNDIREYCFQQISKVREDHLRNSNPTPYKVSVTKELFDTLHNLWLDSVPIKEM 588          
BLAST of Nicotinate phosphoribosyltransferase vs. TrEMBL
Match: A0A2C9JKT3 (Nicotinate phosphoribosyltransferase OS=Biomphalaria glabrata OX=6526 GN=106058186 PE=3 SV=1)

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 332/567 (58.55%), Postives = 427/567 (75.31%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            +Q LLTD YQI+M+YAYWKSGK  D +VFDLYFR+NPF+GE+TIF GLE C+ L++ F +SE+DIEYL+ ++P+  D  F+ YL  L+ANDITL ++PEG VVFPKVPL+ + GPL + QLLET LLNLVN++SLVATNAARFR AAG    LLEFGLRR+QGPDGG+SASR C+LGGF+ TSNVLAGK++ IP+KGTHAHAYVTSY  L +LK  T+ + D ++  +F+DLC K+ K++  ++G LPDQ   GE A+FISYA AFP  FL L+DTYDV+KSG+PNF +V++ALN+ GY+A G+R+DSGDL+YLS+E++ RF  ++  + L WF  LTIVASNDINEDT+HSLNQ                                     QGHSI+ +GIGTHLVTCQKQPALGCV+KLV+IN +A IKLSED+DK+TIPG K +YRL+G DG AL D L  S+E  P +  R+LCRHP   SKRAYV P+ +  +H+++W +G+ +  +P+L E+++  ++SL +IR DHKRALNPTPYKVSVSS+LY F  E+WL+SAPIGEL
Sbjct:   34 VQALLTDLYQITMAYAYWKSGKMDDISVFDLYFRRNPFQGEFTIFAGLEECIKLMQSFHFSESDIEYLKTVLPSKTDPKFYDYLASLSANDITLSAVPEGEVVFPKVPLITITGPLAVVQLLETPLLNLVNYASLVATNAARFRMAAGPETTLLEFGLRRAQGPDGGLSASRYCYLGGFDGTSNVLAGKMFGIPVKGTHAHAYVTSYITLEDLKIKTLTSLDGSSEFNFIDLCLKYQKELAGVIGFLPDQVMAGELAAFISYAQAFPEGFLALIDTYDVLKSGLPNFCTVAMALNDLGYQARGIRLDSGDLSYLSNEVKARFVKVANHYSLPWFEKLTIVASNDINEDTIHSLNQ-------------------------------------QGHSINCYGIGTHLVTCQKQPALGCVFKLVQINKKARIKLSEDVDKVTIPGMKNVYRLYGADGTALVDLLQDSSEVPPKQGDRVLCRHPIQESKRAYVIPASVRALHEIWWHNGKVMKPLPTLTELREKTKQSLRTIRQDHKRALNPTPYKVSVSSSLYTFIHELWLESAPIGEL 563          
BLAST of Nicotinate phosphoribosyltransferase vs. TrEMBL
Match: A0A1S3GZZ9 (Nicotinate phosphoribosyltransferase OS=Lingula unguis OX=7574 GN=LOC106150496 PE=3 SV=1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 335/572 (58.57%), Postives = 429/572 (75.00%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            ++  IQPLLTD YQI+M+YAYWKS K  DTAVFDL+FR+NPF+GE+TIF GLE C+  ++ F Y+ +DIEYLR I+P   +E FF +L +L A D+ + ++ EGSVVFP+VP++ +EGPL + QLLET LLNLVN++SLVATNAARFR AAG++KQLLEFGLRR+QGPDGG+SASR C++GGF+ TSNVLAGK+++IP+KGTHAHA+VTSY KL ++ + TM   D + TVDF+ LC++  ++++ +LG   DQ + GE A+F+SYA AFP+ FL L+DTYDV+KSG+ NF +V LAL++ GY+ VGVR+DSGDLAYLS  +R+RF  ++ +F+L WF  LTIVASNDI+EDT+HSLNQ                                     QGHSID++GIGTHLVTC+KQPALGCVYKLVEING A IKLS+D++K+T PGKK  YRLFG DG AL D +T S E  P    R+LCRHP   SKRAYV P+ +E +HK+YWKDGQ    +P + E+K+ A  SL  +RPDHKRALNPTPYKVSVS  LY+F  ++WL +APIGELS
Sbjct:   19 QNGVIQPLLTDLYQITMAYAYWKSQKYEDTAVFDLFFRRNPFRGEFTIFAGLEECIKFLEHFHYTTDDIEYLRTILPPTTEEEFFEFLHNLTAKDVIVYAVDEGSVVFPRVPIIRLEGPLPVVQLLETTLLNLVNYASLVATNAARFRLAAGQDKQLLEFGLRRAQGPDGGLSASRYCYIGGFDGTSNVLAGKLFDIPVKGTHAHAFVTSYEKLDDVHERTMTAKDGSKTVDFVSLCEQKLEELSKVLGFPIDQVHMGELAAFVSYARAFPTGFLALLDTYDVMKSGVHNFCAVCLALHDLGYRPVGVRLDSGDLAYLSLLLRERFKKVAEKFNLDWFGKLTIVASNDIDEDTIHSLNQ-------------------------------------QGHSIDAYGIGTHLVTCKKQPALGCVYKLVEINGLARIKLSQDVEKVTTPGKKVAYRLFGSDGNALLDLMTQSEEEPPKVKERVLCRHPFVESKRAYVIPAYVECLHKLYWKDGQVQQPLPKMKEIKERALASLNKLRPDHKRALNPTPYKVSVSDQLYNFMHDLWLDNAPIGELS 553          
BLAST of Nicotinate phosphoribosyltransferase vs. TrEMBL
Match: A0A267GCE6 (Nicotinate phosphoribosyltransferase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007965g1 PE=3 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 327/572 (57.17%), Postives = 417/572 (72.90%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            ++N IQPLLTD+YQISM+YAYWK+ K +DTAVFDLYFRK PF+GE+ +F GLE CL  +++F+YSE DI YLR ++P   D  FF YL  L A  ++L ++ EGS VFPKVPL+ VEGPLI+CQLLET LLNLVNF+SL ATNAARFR AAG  KQLLEFGLRR+QGPDG +SASR CF+GGFN TSNVLAGK+Y IP+KGTHAHA+VTS+  L E+K+ T+K        DF++   +  + V   +G+     N GE  +F +YALAFP +FL L+DTY+V+KSG+ NFI V+LAL++ GY+ +GVR+DSGDLAYLS ++R+ F  ++    + WF  LTIVASNDINEDT+HSLNQ                                     QGH IDSFGIGTHLVTCQKQPALGCVYKLVE+NG+ TIKLSED++KMTIPG+K ++R+FG+DGLA+ D + C++E  P   +R+L RH    SKR YV PS +E +H+ YW +G+ + E+P+L  +++HA  SL+++R DHKR LNPTPYKVSVS  LY FT ++WL+SAPI ELS
Sbjct:    6 QNNIIQPLLTDFYQISMAYAYWKANKVNDTAVFDLYFRKCPFQGEFALFAGLEECLKFVQRFRYSEQDIAYLRTVLPPSADSEFFDYLATLTAQGVSLYAVEEGSAVFPKVPLIRVEGPLIVCQLLETTLLNLVNFASLQATNAARFRLAAGPTKQLLEFGLRRAQGPDGALSASRYCFVGGFNGTSNVLAGKLYGIPVKGTHAHAFVTSFYSLDEVKERTLKNKTTGQLGDFIEAVNQCRRTVEAQVGLPTANVNVGELTAFAAYALAFPGSFLALIDTYNVLKSGVINFIVVALALDQFGYRPIGVRLDSGDLAYLSVQVRELFRQVAGSLKMPWFEHLTIVASNDINEDTIHSLNQ-------------------------------------QGHQIDSFGIGTHLVTCQKQPALGCVYKLVEVNGRPTIKLSEDVEKMTIPGRKRVFRVFGQDGLAILDLMQCADEKPPQAGSRVLARHSFHPSKRVYVTPSRVEELHRCYWHEGKVMSELPNLESIREHAAASLVTLRTDHKRFLNPTPYKVSVSEKLYQFTHKLWLESAPIMELS 540          
BLAST of Nicotinate phosphoribosyltransferase vs. TrEMBL
Match: A0A2T7PF69 (Nicotinate phosphoribosyltransferase OS=Pomacea canaliculata OX=400727 GN=C0Q70_07471 PE=3 SV=1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 324/567 (57.14%), Postives = 420/567 (74.07%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGEL 1771
            IQ LLTD YQI+M+YAYWKSGK  D A+FDL+FR+NPF+GE+T+F GLE C+ L++ F++SE+DI YLRK++P  V++ FF YL ++ AN +TL ++ EG+VVFPKVP++ +EGPL + QLLET LLNL+N++SLVATNA RFR AAG++K LLEFGLRR+QGPDGG+SASR C++GGF+ TSNVLAGK++ IP+KGTHAHA+VTSY  L E+K   +   D    VDF+DLC  W +K+++IL  L DQ +EGE A+FI YA AFP   L L+DTYDVIKSG+PNF +V++AL+E GYK  G+R+DSGDL+YLS E+RK F +++  FD+ WF  LTIVASNDINEDT+HSLN                                      QGH ID FGIGTHLVTCQKQPALGCV+KLVE+N +  +KLSED++K+TIPG+K  YRL+G DG AL D +   +E  P    R LCRHP+  SKRAYV P+ ++ +H  YWK+G+ + ++P+L E++  A +SL ++R DHKR LNPTPYKVSVSSNLY F  ++WL+S PIGEL
Sbjct:   21 IQALLTDLYQITMAYAYWKSGKMDDRAIFDLFFRRNPFQGEFTLFAGLEECVKLLQNFRFSESDISYLRKVLPPHVEDEFFQYLSNMTANAVTLSAVDEGTVVFPKVPMITIEGPLAVVQLLETPLLNLINYASLVATNAMRFRLAAGQDKVLLEFGLRRAQGPDGGLSASRYCYMGGFDGTSNVLAGKMFGIPVKGTHAHAFVTSYRDLREVKCRNLFRKDNLEKVDFIDLCLVWQQKLSSILNFLVDQVSEGELAAFICYAQAFPDQMLALIDTYDVIKSGLPNFCTVAMALHELGYKPRGIRLDSGDLSYLSREVRKVFKLVANSFDVPWFERLTIVASNDINEDTIHSLNT-------------------------------------QGHDIDCFGIGTHLVTCQKQPALGCVFKLVEVNDKPRMKLSEDVEKVTIPGRKKAYRLYGHDGTALVDLMLQPSEDPPSLGQRFLCRHPTMESKRAYVVPAEVQPLHHEYWKNGEVIRDLPNLTELRKKASKSLQTLRQDHKRTLNPTPYKVSVSSNLYTFIHDLWLESTPIGEL 550          
BLAST of Nicotinate phosphoribosyltransferase vs. TrEMBL
Match: A0A267FKH9 (Nicotinate phosphoribosyltransferase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033747g1 PE=3 SV=1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 326/572 (56.99%), Postives = 416/572 (72.73%), Query Frame = 2
Query:   59 EDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            ++N IQPLLTD+YQISM+YAYWK+ K +DTAVFDLYFRK PF+GE+ +F GLE CL  +++F+YSE DI YLR ++P   D  FF YL  L A  ++L ++ EGS VFPKVPL+ VEGPLI+CQLLET LLNLVNF+SL ATNAARFR AAG  KQLLEFGLRR+QGPDG +SASR CF+GGFN TSNVLAGK+Y IP+KGTHAHA+VTS+  L E+K+  +K        DF++   +  + V   +G+     N GE  +F +YALAFP +FL L+DTY+V+KSG+ NFI V+LAL++ GY+ +GVR+DSGDLAYLS ++R+ F  ++    + WF  LTIVASNDINEDT+HSLNQ                                     QGH IDSFGIGTHLVTCQKQPALGCVYKLVE+NG+ TIKLSED++KMTIPG+K ++R+FG+DGLA+ D + C++E  P   +R+L RH    SKR YV PS +E +H+ YW +G+ + E+P+L  +++HA  SL+++R DHKR LNPTPYKVSVS  LY FT ++WL+SAPI ELS
Sbjct:    6 QNNIIQPLLTDFYQISMAYAYWKANKVNDTAVFDLYFRKCPFQGEFALFAGLEECLKFVQRFRYSEQDIAYLRTVLPPSADSEFFDYLATLTAQGVSLYAVEEGSAVFPKVPLIRVEGPLIVCQLLETTLLNLVNFASLQATNAARFRLAAGPTKQLLEFGLRRAQGPDGALSASRYCFVGGFNGTSNVLAGKLYGIPVKGTHAHAFVTSFYSLDEVKERMLKNKTTGQLGDFIEAVNQCRRTVEAQVGLPTANVNVGELTAFAAYALAFPGSFLALIDTYNVLKSGVINFIVVALALDQFGYRPIGVRLDSGDLAYLSVQVRELFRQVAGSLKMPWFEHLTIVASNDINEDTIHSLNQ-------------------------------------QGHQIDSFGIGTHLVTCQKQPALGCVYKLVEVNGRPTIKLSEDVEKMTIPGRKRVFRVFGQDGLAILDLMQCADEKPPQAGSRVLARHSFHPSKRVYVTPSRVEELHRCYWHEGKVMSELPNLESIREHAAASLVTLRTDHKRFLNPTPYKVSVSEQLYQFTHKLWLESAPIMELS 540          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Cavefish
Match: naprt (nicotinate phosphoribosyltransferase [Source:NCBI gene;Acc:393864])

HSP 1 Score: 425.631 bits (1093), Expect = 6.267e-141
Identity = 224/555 (40.36%), Postives = 332/555 (59.82%), Query Frame = 2
Query:   77 PLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYK---LVEINGQATIKLSEDIDKMTIPGKKAIYRL--FGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAY-VNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLY 1723
            PLLTD YQ +M+YAYW++G+  + AVF+L+FR NPF G +++F GL +CL  ++ F +++ D+EYLR ++P++ D +FF +LK L+ + +++ ++ EG+VVF +VPL+ V GPL + QLLET LL LVN++SLV TNAARFR AAG  ++LLE GLRR+QGPDGG++ASR  ++GGF+ TSN LAG+++ IP+ GT AH+YVTS+S L E+   T+  S+    +DFL L K W  +V  +LG  P Q  EGE A+ +SYA+A+P+ FL ++D+Y+V  SG+  F +V LAL E  Y+ +GVR+DSGDL   S E+R  F   S  F +  F SL IV +N ++E +L  LN+++N                                      ID  G+GTHLVTC  QP+LGCVYK   L  +N  +T  L   +    +  ++A  R   F    +   D +  S EP P      L  +P   +K    V PS +  +    +  G+  + + +  E + HA+ SL ++ P HK+   P  Y V++S  ++
Sbjct:   15 PLLTDLYQFTMAYAYWRAGRHQEPAVFELFFRDNPFSGGFSVFAGLTDCLLFLRNFHFTDEDVEYLRSVLPSNTDPDFFTFLKGLDCSAVSISAVAEGTVVFARVPLLEVSGPLAVVQLLETSLLCLVNYASLVCTNAARFRIAAGPRRRLLEMGLRRAQGPDGGLTASRYTYIGGFDLTSNALAGRLFGIPVAGTMAHSYVTSFSSLEEVWPQTLVPSEGDDPIDFLSLVKGWLGRVCQLLGARPQQVREGELAALLSYAIAYPNNFLPVIDSYNVSCSGVLCFCAVGLALCELQYQPLGVRLDSGDLCKQSVEVRCVFRECSKHFSVPKFESLLIVGTNSVSEQSLVELNKRDN-------------------------------------EIDVVGVGTHLVTCTSQPSLGCVYKLWVLAVLNCASTFSLYPRLAAFMV-LRRAAERTSPFSHPQM---DLICLSEEPAPKVGVP-LNYYPLGLNKAVQSVTPSQVTSLRLDVFSHGEITLPLSTAPESRVHAQTSLQAMYPHHKKLQEPENYTVAISERIH 527          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Nematostella
Match: EDO46496 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ43])

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 309/576 (53.65%), Postives = 401/576 (69.62%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGL-ALT-------DYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            IQPLLTD+YQI+M+Y+YWK+GK  + AVFDLYFRKNPF GE+TIF GL  CL  +  +K S+ DIEYL+K +P   +E FF +LK ++   + L ++PEGS+VFPKVPL+ VEGPL + QLLET LLNLVNF+SLVATNAARFR AAG  K LLEFGLRR+QGPDGG+SAS+ C+LGGF+ TSNVLAGK+Y+IP+KGT AHA+V+S++ + E +  T+K        +   + + W KKV  +L VL  + N GE  +F +YA AFP +FL LVDTY V++SG+P + +V+LALN+ GY+A G+R+DSGDLAYLS E+RK+  I++ + D  W     IVASNDINEDTL SL Q                                     QGHSID+FGIGTHLVTCQKQPALGCV+KLVE+N +A +KLS+DI+K+TIP KK +YRL+G DG+ ALT       D L  ++E +P    R+LCRH  D  KRAYV PS +E + + YWKD +    +P+L E++ + R  L  +RPDH R LNPTPYKV++S  LY F   +WL++ PIGEL+
Sbjct:    8 IQPLLTDFYQITMAYSYWKNGKKDEIAVFDLYFRKNPFGGEFTIFAGLSACLDFLNNWKISDEDIEYLKKNLPPTTEEEFFTFLKTIDPGSVELWAVPEGSIVFPKVPLIRVEGPLPVVQLLETTLLNLVNFASLVATNAARFRLAAGMEKVLLEFGLRRAQGPDGGLSASKYCYLGGFDGTSNVLAGKLYDIPVKGTMAHAFVSSFTSIDEGRVGTLKHFKNGEAKELYPIARAWLKKVAPLLSVLEQEVNSGELVAFSAYAAAFPGSFLALVDTYHVLRSGVPCYCAVALALNDFGYRASGMRLDSGDLAYLSIEVRKKLKIVAEKLDAPWIAKSLIVASNDINEDTLLSLKQ-------------------------------------QGHSIDAFGIGTHLVTCQKQPALGCVFKLVELNKRACMKLSQDIEKITIPSKKVVYRLYGADGMPALTHAQEYTVDLLKRTDEAVPALGGRVLCRHAFDEGKRAYVLPSKVETLLRPYWKDSKICQSLPTLKEIQTNLREDLQRLRPDHIRPLNPTPYKVALSGELYTFMHHLWLENMPIGELA 546          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Medaka
Match: naprt (nicotinate phosphoribosyltransferase [Source:NCBI gene;Acc:101167697])

HSP 1 Score: 482.256 bits (1240), Expect = 7.465e-163
Identity = 236/558 (42.29%), Postives = 348/558 (62.37%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGEL-KQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEM 1741
            + PLLTD YQ +M+YAYW++G+  + AVF+L+FR NPF G +++F GL +CL  ++ F+++E+D+E+LR ++P   D  FF +L+ L+ + +TL S+PEG+VVF +VPLM VEGPL + QLLET LL L N++SLV +NAARFR AAG  +QLLE GLRR+QGPDGG++ASR   +GGF+ TSNV AG ++ IP+ GT AH+YVTS++ L ++  Q+ +  +     VD + L K + ++V  +LG  P +  EGE A+F+SYA+A+P  FL ++D+Y V  SG+ NF +V+L+L + GYK +GVR+DSGDL   S E+R+ F + S  F ++ F SL IV +N+I+E ++  LN +EN                                      I   G+GTHLVTC +QP+LGCVYKLVE+ G+  +K+SED +K TIPG+KA+YRL   +G    D L+   EP P+   +L           A V P+ +  + +  +  GQ    + S  + +   + SL ++ P HKR   P  Y V++S  L+    E+
Sbjct:   20 VPPLLTDLYQFTMAYAYWRAGRHQEPAVFELFFRDNPFGGGFSLFAGLHDCLLFLRGFRFAEDDVEFLRSVLPPTTDPGFFQFLRELDCSGVTLRSVPEGTVVFARVPLMEVEGPLAVVQLLETSLLCLTNYASLVCSNAARFRLAAGSGRQLLEMGLRRAQGPDGGLTASRYSHIGGFDLTSNVQAGFLFGIPVAGTMAHSYVTSFTSLEQVCPQTLVAANSDLAPVDVISLTKGYLRRVCELLGAEPGKIREGELAAFLSYAIAYPCNFLPVIDSYSVSCSGLLNFCAVALSLCQLGYKPLGVRLDSGDLCRQSLEVRRVFRLCSKHFSIADFDSLIIVGTNNISEKSIAELNSKEN-------------------------------------EISVVGVGTHLVTCTEQPSLGCVYKLVEVGGRPKMKISEDPEKSTIPGRKALYRLIDAEGHPFLDLLSLEAEPPPEAGRQLKYFPLGCGDSPASVTPAQVSCLRQEVFLKGQVTQPLCSAAKTRAKVQSSLQTLHPRHKRLQEPDSYTVALSERLHSLVLEL 540          
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Medaka
Match: naprt (nicotinate phosphoribosyltransferase [Source:NCBI gene;Acc:101167697])

HSP 1 Score: 462.611 bits (1189), Expect = 3.247e-155
Identity = 229/531 (43.13%), Postives = 336/531 (63.28%), Query Frame = 2
Query:   71 IQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGEL-KQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIP--SLLEMKDHARRSLLS 1654
            + PLLTD YQ +M+YAYW++G+  + AVF+L+FR NPF G +++F GL +CL  ++ F+++E+D+E+LR ++P   D  FF +L+ L+ + +TL S+PEG+VVF +VPLM VEGPL + QLLET LL L N++SLV +NAARFR AAG  +QLLE GLRR+QGPDGG++ASR   +GGF+ TSNV AG ++ IP+ GT AH+YVTS++ L ++  Q+ +  +     VD + L K + ++V  +LG  P +  EGE A+F+SYA+A+P  FL ++D+Y V  SG+ NF +V+L+L + GYK +GVR+DSGDL   S E+R+ F + S  F ++ F SL IV +N+I+E ++  LN +EN                                      I   G+GTHLVTC +QP+LGCVYKLVE+ G+  +K+SED +K TIPG+KA+YRL   +G    D L+   EP P+   +L           A V P+ +  + +  +  GQ   + P  SL  + ++   +LLS
Sbjct:   20 VPPLLTDLYQFTMAYAYWRAGRHQEPAVFELFFRDNPFGGGFSLFAGLHDCLLFLRGFRFAEDDVEFLRSVLPPTTDPGFFQFLRELDCSGVTLRSVPEGTVVFARVPLMEVEGPLAVVQLLETSLLCLTNYASLVCSNAARFRLAAGSGRQLLEMGLRRAQGPDGGLTASRYSHIGGFDLTSNVQAGFLFGIPVAGTMAHSYVTSFTSLEQVCPQTLVAANSDLAPVDVISLTKGYLRRVCELLGAEPGKIREGELAAFLSYAIAYPCNFLPVIDSYSVSCSGLLNFCAVALSLCQLGYKPLGVRLDSGDLCRQSLEVRRVFRLCSKHFSIADFDSLIIVGTNNISEKSIAELNSKEN-------------------------------------EISVVGVGTHLVTCTEQPSLGCVYKLVEVGGRPKMKISEDPEKSTIPGRKALYRLIDAEGHPFLDLLSLEAEPPPEAGRQLKYFPLGCGDSPASVTPAQVSCLRQEVFLKGQVNTKCPLTSLWGLIEYLTEALLS 513          
BLAST of Nicotinate phosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000014532.1 (SMESG000014532.1)

HSP 1 Score: 1190.25 bits (3078), Expect = 0.000e+0
Identity = 571/573 (99.65%), Postives = 573/573 (100.00%), Query Frame = 2
Query:   56 MEDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            MEDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECG+KAVGVRIDSGDLAYLSHEIRKRFHIISTEF+LSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS
Sbjct:    1 MEDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGFKAVGVRIDSGDLAYLSHEIRKRFHIISTEFNLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 573          
BLAST of Nicotinate phosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000014532.1 (SMESG000014532.1)

HSP 1 Score: 1093.57 bits (2827), Expect = 0.000e+0
Identity = 534/573 (93.19%), Postives = 536/573 (93.54%), Query Frame = 2
Query:   56 MEDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDINEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 1774
            MEDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECG+KAVGVRIDSGDLAYLSHEIRKRFHIISTEF+LSWFRSLTIVASNDINEDTLHSLNQ                                     QGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS
Sbjct:    1 MEDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIFTGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLISLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQAAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPIKGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILGVLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALNECGFKAVGVRIDSGDLAYLSHEIRKRFHIISTEFNLSWFRSLTIVASNDINEDTLHSLNQ-------------------------------------QGHSIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKKAIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLIEVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVSVSSNLYDFTQEMWLKSAPIGELS 536          
The following BLAST results are available for this feature:
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAPRT1.053e-15840.96nicotinate phosphoribosyltransferase [Source:HGNC ... [more]
NAPRT1.053e-15840.96nicotinate phosphoribosyltransferase [Source:HGNC ... [more]
NAPRT1.609e-15641.56nicotinate phosphoribosyltransferase [Source:HGNC ... [more]
NAPRT1.609e-15641.56nicotinate phosphoribosyltransferase [Source:HGNC ... [more]
NAPRT4.191e-15440.88nicotinate phosphoribosyltransferase [Source:HGNC ... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nprt-10.000e+051.04Nicotinate phosphoribosyltransferase [Source:UniP... [more]
nprt-10.000e+051.04Nicotinate phosphoribosyltransferase [Source:UniP... [more]
nprt-10.000e+051.04Nicotinate phosphoribosyltransferase [Source:UniP... [more]
nprt-10.000e+051.04Nicotinate phosphoribosyltransferase [Source:UniP... [more]
nprt-13.920e-9858.90Nicotinate phosphoribosyltransferase [Source:UniP... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naprt0.000e+054.55gene:FBgn0031589 transcript:FBtr0077481[more]
Naprt0.000e+054.02gene:FBgn0031589 transcript:FBtr0334791[more]
Naprt3.319e-10756.89gene:FBgn0031589 transcript:FBtr0077482[more]
Naprt3.319e-10756.89gene:FBgn0031589 transcript:FBtr0077479[more]
Naprt3.319e-10756.89gene:FBgn0031589 transcript:FBtr0113020[more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naprt6.321e-16242.14nicotinate phosphoribosyltransferase [Source:NCBI ... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
znf33a1.354e-6653.17zinc finger protein 33A [Source:Xenbase;Acc:XB-GEN... [more]
nkrf2.160e-1241.67NFKB repressing factor [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Naprt1.068e-15341.67nicotinate phosphoribosyltransferase [Source:MGI S... [more]
Naprt1.544e-10746.67nicotinate phosphoribosyltransferase [Source:MGI S... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VQX4|PNCB_DROME0.000e+054.55Nicotinate phosphoribosyltransferase OS=Drosophila... [more]
sp|Q95XX1|PNCB_CAEEL0.000e+051.04Nicotinate phosphoribosyltransferase OS=Caenorhabd... [more]
sp|Q84WV8|NPRT2_ARATH0.000e+051.66Nicotinate phosphoribosyltransferase 2 OS=Arabidop... [more]
sp|Q8RWM2|NPRT1_ARATH0.000e+051.83Nicotinate phosphoribosyltransferase 1 OS=Arabidop... [more]
sp|Q55G10|PNCB_DICDI1.090e-18045.75Nicotinate phosphoribosyltransferase OS=Dictyostel... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JKT30.000e+058.55Nicotinate phosphoribosyltransferase OS=Biomphalar... [more]
A0A1S3GZZ90.000e+058.57Nicotinate phosphoribosyltransferase OS=Lingula un... [more]
A0A267GCE60.000e+057.17Nicotinate phosphoribosyltransferase (Fragment) OS... [more]
A0A2T7PF690.000e+057.14Nicotinate phosphoribosyltransferase OS=Pomacea ca... [more]
A0A267FKH90.000e+056.99Nicotinate phosphoribosyltransferase (Fragment) OS... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naprt6.267e-14140.36nicotinate phosphoribosyltransferase [Source:NCBI ... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464960.000e+053.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naprt7.465e-16342.29nicotinate phosphoribosyltransferase [Source:NCBI ... [more]
naprt3.247e-15543.13nicotinate phosphoribosyltransferase [Source:NCBI ... [more]
back to top
BLAST of Nicotinate phosphoribosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000014532.10.000e+099.65SMESG000014532.1[more]
SMESG000014532.10.000e+093.19SMESG000014532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025412 ID=SMED30025412|Name=Nicotinate phosphoribosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2196bp
GTTTAAATCAATTATTCTTAGTAATAATTTGAATTATTAATTTAATAAAT
CCTAAATGGAGGATAATTATATTCAGCCTTTGCTTACAGATTATTATCAA
ATCAGTATGTCGTATGCATATTGGAAATCCGGGAAAACTTCTGATACTGC
CGTTTTTGATTTGTATTTTCGTAAAAACCCATTCAAAGGTGAATACACGA
TTTTTACTGGCTTGGAAAATTGTTTGACTTTGATCAAGAAGTTCAAATAT
TCAGAAAACGATATTGAATACCTTCGTAAAATTATGCCAAATGATGTCGA
TGAAAATTTTTTTGTATACCTTAAGCATTTGAACGCTAATGATATCACTT
TAATTTCATTGCCTGAAGGTTCTGTGGTTTTTCCAAAGGTCCCTTTAATG
ATTGTCGAGGGACCACTAATTATCTGTCAATTACTAGAAACTGGGCTTTT
GAATTTGGTTAATTTCTCAAGCTTAGTAGCGACAAATGCCGCTAGATTCA
GACAAGCTGCTGGGGAAAATAAACAGTTACTGGAATTTGGTTTGAGGCGG
TCTCAAGGACCAGATGGTGGGATGTCCGCCAGTAGAAATTGCTTCCTTGG
AGGATTCAATGCAACCAGTAATGTCCTTGCAGGCAAAATATACAACATAC
CAATCAAGGGTACCCATGCTCACGCATATGTCACATCATACAGTAAGCTC
GGTGAATTGAAACAATCGACAATGAAAACATCAGATCAAACGACAACTGT
TGATTTCCTTGATTTGTGCAAGAAGTGGCATAAGAAAGTGACTAATATCC
TTGGTGTTTTGCCGGATCAAACCAATGAAGGAGAATTCGCCTCATTTATC
AGTTATGCTCTTGCATTTCCCAGCACATTTTTGTGTCTCGTCGACACGTA
CGATGTAATCAAATCTGGAATTCCAAACTTCATCTCCGTGTCTTTGGCAT
TGAACGAATGTGGATACAAAGCTGTTGGCGTCAGAATCGACAGCGGAGAC
TTGGCTTATTTGTCACACGAGATCCGGAAAAGATTCCATATAATATCAAC
CGAATTCGATTTGTCTTGGTTTCGTTCCTTGACGATTGTGGCCAGTAACG
ACATAAACGAGGACACCCTTCATTCTCTCAATCAACAGGAGAATGGAACT
AGAAATGGTGTATTGCAATATGCAGCGCTGTACAGTGGCATGTGCAACAA
GTGCATTCACACTGGGCCCAAAAATTCGCAAATTGTTTCTTTCTATCAGG
GCCATTCAATAGATTCATTCGGTATCGGTACTCATTTGGTAACTTGTCAG
AAGCAGCCTGCCCTAGGATGTGTTTATAAGCTGGTGGAAATAAACGGGCA
GGCCACAATAAAACTGAGTGAAGACATCGACAAGATGACGATCCCTGGTA
AGAAGGCCATTTACCGACTATTTGGGAAAGACGGTCTTGCATTGACGGAT
TATCTGACGTGCAGCAACGAGCCGATGCCTGACAAAAACACGAGATTGCT
CTGTCGGCACCCGTCAGATGCGTCCAAGCGCGCCTATGTCAACCCGTCAT
TGATTGAAGTGATCCACAAGGTCTACTGGAAGGATGGTCAGCAACTCGTG
GAAATTCCATCCCTATTGGAAATGAAGGATCACGCCAGGCGCTCACTGCT
CTCGATTCGGCCGGATCACAAGCGGGCACTGAATCCGACCCCTTACAAAG
TGTCTGTCTCATCGAATTTGTATGATTTCACCCAGGAAATGTGGCTCAAA
TCCGCTCCAATCGGGGAGTTGTCCTGAGCCGTCTCTAGCGGCCCTCATGT
AGCCATAGTTAAATCATCTAGATCAGTCGTGTATACTATAGCTATTATAT
TAGAGTATTTCCGTCGAATATGGTTTCAATCTAGTCTTGATAGTTTATTG
CCAGTGCTCCGATAATTATGACGTCATTTATATATCAAAAAGATATCTTA
GATAAACAAATATTAAATTATTATGCAATAAATATTTATAATTATTTACT
AAATGAGGCGGCGTCCATATTTCAATGATTACGTAATGAAATTTAACTTT
TTGATTTATCCGATGATTACGCAATGAAATTTCCTTTTTGATTTATCCGA
TGATTGCGCAATGAAATTTCACTTTTTGCTTTATCTCACGATTACGCAAT
AATTTAAAATTTGTTTTTATTCATTTCTTGTTTTAATGAAAATTTT
back to top

protein sequence of SMED30025412-orf-1

>SMED30025412-orf-1 ID=SMED30025412-orf-1|Name=SMED30025412-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=574bp
MEDNYIQPLLTDYYQISMSYAYWKSGKTSDTAVFDLYFRKNPFKGEYTIF
TGLENCLTLIKKFKYSENDIEYLRKIMPNDVDENFFVYLKHLNANDITLI
SLPEGSVVFPKVPLMIVEGPLIICQLLETGLLNLVNFSSLVATNAARFRQ
AAGENKQLLEFGLRRSQGPDGGMSASRNCFLGGFNATSNVLAGKIYNIPI
KGTHAHAYVTSYSKLGELKQSTMKTSDQTTTVDFLDLCKKWHKKVTNILG
VLPDQTNEGEFASFISYALAFPSTFLCLVDTYDVIKSGIPNFISVSLALN
ECGYKAVGVRIDSGDLAYLSHEIRKRFHIISTEFDLSWFRSLTIVASNDI
NEDTLHSLNQQENGTRNGVLQYAALYSGMCNKCIHTGPKNSQIVSFYQGH
SIDSFGIGTHLVTCQKQPALGCVYKLVEINGQATIKLSEDIDKMTIPGKK
AIYRLFGKDGLALTDYLTCSNEPMPDKNTRLLCRHPSDASKRAYVNPSLI
EVIHKVYWKDGQQLVEIPSLLEMKDHARRSLLSIRPDHKRALNPTPYKVS
VSSNLYDFTQEMWLKSAPIGELS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016874ligase activity
GO:0004514nicotinate-nucleotide diphosphorylase (carboxylating) activity
GO:0004516nicotinate phosphoribosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0019363pyridine nucleotide biosynthetic process
GO:0009435NAD biosynthetic process
GO:0019358nicotinate nucleotide salvage
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR041619NAPRTase_C
IPR006405Nic_PRibTrfase_pncB
IPR040727NAPRTase_N
IPR013785Aldolase_TIM
IPR036068Nicotinate_pribotase-like_C
IPR007229Nic_PRibTrfase-Fam
IPR002638Quinolinate_PRibosylTrfase_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041619Nicotinate phosphoribosyltransferase C-terminal domainPFAMPF17956NAPRTase_Ccoord: 449..558
e-value: 6.2E-32
score: 110.3
NoneNo IPR availableGENE3DG3DSA:3.20.140.10coord: 403..568
e-value: 5.9E-55
score: 188.3
coord: 2..156
e-value: 2.6E-59
score: 202.7
NoneNo IPR availablePANTHERPTHR11098:SF1NICOTINATE PHOSPHORIBOSYLTRANSFERASEcoord: 398..565
coord: 2..364
NoneNo IPR availableCDDcd01570NAPRTase_Acoord: 8..427
e-value: 4.88427E-167
score: 475.525
NoneNo IPR availableSUPERFAMILYSSF54675Nicotinate/Quinolinate PRTase N-terminal domain-likecoord: 3..140
IPR007229Nicotinate phosphoribosyltransferase familyPIRSFPIRSF000484NAPRTcoord: 1..569
e-value: 2.2E-144
score: 479.1
IPR007229Nicotinate phosphoribosyltransferase familyPANTHERPTHR11098NICOTINATE PHOSPHORIBOSYLTRANSFERASEcoord: 398..565
coord: 2..364
IPR006405Nicotinate phosphoribosyltransferase pncB-typeTIGRFAMTIGR01513TIGR01513coord: 8..362
e-value: 3.7E-112
score: 373.5
IPR040727Nicotinate phosphoribosyltransferase, N-terminal domainPFAMPF17767NAPRTase_Ncoord: 9..136
e-value: 8.8E-35
score: 119.8
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 157..254
e-value: 1.6E-21
score: 79.1
coord: 255..365
e-value: 1.0E-32
score: 115.6
IPR036068Nicotinate phosphoribosyltransferase-like, C-terminalSUPERFAMILYSSF51690Nicotinate/Quinolinate PRTase C-terminal domain-likecoord: 141..570