ATP-binding cassette sub-family F member 3-like

Overview
NameATP-binding cassette sub-family F member 3-like
Smed IDSMED30025411
Length (bp)2493
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-binding cassette sub-family F member 3-like (SMED30025411) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-binding cassette sub-family F member 3-like (SMED30025411) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-binding cassette sub-family F member 3-like (SMED30025411) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-binding cassette sub-family F member 3-like (SMED30025411) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025411

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025411SMESG000041811.1 dd_Smed_v4_1761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025411SMESG000041811.1 dd_Smed_v4_1761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025411SMESG000041811.1 dd_Smed_v4_1761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025411SMESG000041811.1 dd_Smed_v4_1761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025411SMESG000041811.1 dd_Smed_v4_1761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025411SMESG000041811.1 Contig49115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025411SMESG000041811.1 Contig49115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Human
Match: ABCF3 (ATP binding cassette subfamily F member 3 [Source:HGNC Symbol;Acc:HGNC:72])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 326/702 (46.44%), Postives = 476/702 (67.81%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDA-SKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDK--VILPEN-NREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTL-----LISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR----TRXXXXXXXXNANK-DTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+   SK +      CQ      S+ +     +LL+ PI +  I E       LP    RE+  + N         K L + E R+  K K+++  E  TL     L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV GDDT A+ SVLE+D+VR     R  +   ++ A + + ++ + + EIY KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  +  +   L +S    SRIC+VGENGAGK+T+LK+ L +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+  + GGV++V+HDER IR     LWV E   +  ++G FD YR
Sbjct:    2 ATCAEILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMAEPQSQGNSQ---VLLDAPIQLSKITENYDCGTKLPGLLKREQSSTVNA--------KKLEKAEARL--KAKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFPDGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLESRICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRYGISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCRELWVCEGGGVTRVEGGFDQYR 690          

HSP 2 Score: 55.8398 bits (133), Expect = 3.184e-7
Identity = 56/246 (22.76%), Postives = 95/246 (38.62%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRI-GFFSQHHVDQLNLN------QSSLE------------------FLQTKFPGSE-------------------PEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+               +SLR+    S  HV+Q          QS LE                      +  GSE                   P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  178 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKML------------ATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIK 408          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Human
Match: ABCF3 (ATP binding cassette subfamily F member 3 [Source:HGNC Symbol;Acc:HGNC:72])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 324/705 (45.96%), Postives = 477/705 (67.66%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEI--DASKSEEVYDLCCQIFKLL--VSKTDDDRKPILLNNPICIGDIVEKDK--VILPEN-NREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTL-----LISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR----TRXXXXXXXXNANK-DTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+  D+     +  +C +++  L            +LL+ PI +  I E       LP    RE+  + N         K L + E R+  K K+++  E  TL     L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV GDDT A+ SVLE+D+VR     R  +   ++ A + + ++ + + EIY KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  +  +   L +S    SRIC+VGENGAGK+T+LK+ L +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+  + GGV++V+HDER IR     LWV E   +  ++G FD YR
Sbjct:    2 ATCAEILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLLKREQSSTVNA--------KKLEKAEARL--KAKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFPDGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLESRICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRYGISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCRELWVCEGGGVTRVEGGFDQYR 696          

HSP 2 Score: 55.8398 bits (133), Expect = 3.036e-7
Identity = 56/246 (22.76%), Postives = 95/246 (38.62%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRI-GFFSQHHVDQLNLN------QSSLE------------------FLQTKFPGSE-------------------PEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+               +SLR+    S  HV+Q          QS LE                      +  GSE                   P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  184 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKML------------ATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIK 414          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Human
Match: ABCF1 (ATP binding cassette subfamily F member 1 [Source:HGNC Symbol;Acc:HGNC:70])

HSP 1 Score: 406.371 bits (1043), Expect = 2.426e-131
Identity = 236/549 (42.99%), Postives = 337/549 (61.38%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEY--------------ESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKF--PGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNE-EISNP 2152
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK IA + L +P N+ +LL EQEV+ D+T A+ +VL ADT R +LL+E   L    +  D     R+ ++Y++L    +  A A+A  IL GLGF PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL+ W+K+L++VSHDQ FLD V TDI+ L  Q++  ++ NY  F++  + K    LK+Y              +S  Q  +  +  + R +    +  Q +      ++ P+L    KE  V F FP  P L  P+L    + FGY  ++ + KNL   +   SRICIVG NG GK+TLL +   +L P  G +R +  L+IGFF+Q + +QL + ++  E+LQ  F  P  +    R  LG FG+        I  LSGGQK+RV F  L+ + P+ LILDEPTNNLD+ESI+AL  AI +Y G V++V+HD RLI +TNC LWVVE++++++IDG+F+DY++EVL AL E  +S P
Sbjct:   53 SDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEES----QEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDA---RKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMVSRP 594          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Human
Match: ABCF1 (ATP binding cassette subfamily F member 1 [Source:HGNC Symbol;Acc:HGNC:70])

HSP 1 Score: 405.986 bits (1042), Expect = 1.222e-128
Identity = 234/543 (43.09%), Postives = 334/543 (61.51%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEY--------------ESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKF--PGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNE 2137
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK IA + L +P N+ +LL EQEV+ D+T A+ +VL ADT R +LL+E   L    +  D     R+ ++Y++L    +  A A+A  IL GLGF PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL+ W+K+L++VSHDQ FLD V TDI+ L  Q++  ++ NY  F++  + K    LK+Y              +S  Q  +  +  + R +    +  Q +      ++ P+L    KE  V F FP  P L  P+L    + FGY  ++ + KNL   +   SRICIVG NG GK+TLL +   +L P  G +R +  L+IGFF+Q + +QL + ++  E+LQ  F  P  +    R  LG FG+        I  LSGGQK+RV F  L+ + P+ LILDEPTNNLD+ESI+AL  AI +Y G V++V+HD RLI +TNC LWVVE++++++IDG+F+DY++EVL AL E
Sbjct:  264 SDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEES----QEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQD---ARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGE 799          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Human
Match: ABCF1 (ATP binding cassette subfamily F member 1 [Source:HGNC Symbol;Acc:HGNC:70])

HSP 1 Score: 405.986 bits (1042), Expect = 1.222e-128
Identity = 234/543 (43.09%), Postives = 334/543 (61.51%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEY--------------ESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKF--PGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNE 2137
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK IA + L +P N+ +LL EQEV+ D+T A+ +VL ADT R +LL+E   L    +  D     R+ ++Y++L    +  A A+A  IL GLGF PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL+ W+K+L++VSHDQ FLD V TDI+ L  Q++  ++ NY  F++  + K    LK+Y              +S  Q  +  +  + R +    +  Q +      ++ P+L    KE  V F FP  P L  P+L    + FGY  ++ + KNL   +   SRICIVG NG GK+TLL +   +L P  G +R +  L+IGFF+Q + +QL + ++  E+LQ  F  P  +    R  LG FG+        I  LSGGQK+RV F  L+ + P+ LILDEPTNNLD+ESI+AL  AI +Y G V++V+HD RLI +TNC LWVVE++++++IDG+F+DY++EVL AL E
Sbjct:  264 SDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEES----QEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQD---ARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGE 799          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Celegans
Match: abcf-3 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:Q20306])

HSP 1 Score: 533.872 bits (1374), Expect = 1.173e-179
Identity = 306/717 (42.68%), Postives = 454/717 (63.32%), Query Frame = 2
Query:   47 NSAEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSI-EGILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPEN-NREELVSGNKIMTDEEV----RKNLAEVEERMNK----------KMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGSR-------IPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERT-VIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            N   I   +   +P L  E+  YV +IL EN+D   +  E+ D++ E +   ++        + C Q+ KLL      D  P  +         +E+   +  EN N E L S  K+ T +      +K LA+ E+R             + KKK+N   P+   SQ   ++           + G    +  + + D+S G+K LL  A ++++ GRRYG +GRNG+GKTT+LK I++++LK+PA +S+L VEQEV GDDT  +++VL +DT R  LL   + L +  NKD  + +        + ++Y +++ ++ DKAPARA  +L GLGF+P+ Q   T++FSGGWRMR+ALARALF +PDLLLLDEPTNMLDM+A+ WLE +L+ W+ +++ VSHD+KFL+ + TDI+ L  ++++++K NY +FE+  + KL  Q +EYESQ Q R+H Q FID+FR  A +A  VQSRIKMLEKLP L PV  E  + F+FP C  L +P+LQ DE+ F Y ++   + + L +   ++SRICIVGENGAGKTTLLK+ L +L+P  GL   ++ +RI +F+QHHVDQL++  S++E L    PG   E YR  LG FG+ GD+AL+ +++LSGGQKSR+AF  L++  PN+LILDEPTN+LD+E++EAL  A+  ++GGVV+V+HDE+LI      LWVV+D+ +  ++G  ++YRK+V
Sbjct:    3 NVEAIPGYLTATFPTLPIEIKDYVSAILKENSDEITSLDEVMDAVGEHLQASVENLCEVGAKNACQQLLKLL----HGDNLPKAIKQQEATTKRLEQTVDMAAENQNFEALQSIWKVQTRDTPTTVDKKKLAKAEDRAAAKAEARADAPVERKKKKNE--PSATASQAPIRDSG---------ARGANSKDIKLESVDISIGTKQLLSCADVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGISMLSVEQEVEGDDTLVLDAVLMSDTKRQTLLDREKTLQSRINKDNINDAEKTKWNDELSKLYIEMEALQLDKAPARASSLLYGLGFTPDEQKRPTKEFSGGWRMRVALARALFVKPDLLLLDEPTNMLDMRAVYWLEGHLQGWEGTILTVSHDRKFLNEICTDIVHLHTRRLDHYKGNYDQFEKTMKEKLTQQQREYESQQQLRQHTQEFIDKFRYNAKRAPMVQSRIKMLEKLPVLLPVELESDIHFKFPECEVLSNPVLQLDEVSFRYNEDSPYLFRKLNLGTHANSRICIVGENGAGKTTLLKLLLDDLQPSVGLRNVNRRIRIAYFTQHHVDQLDMETSAIEVLMKNHPGKTQEDYRAALGRFGLAGDMALQSVETLSGGQKSRLAFANLALMQPNYLILDEPTNHLDVETVEALGKALNVFNGGVVLVSHDEQLIELVCKELWVVKDRMVTTLEGGLEEYRKQV 704          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Celegans
Match: abcf-3 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:Q20306])

HSP 1 Score: 533.872 bits (1374), Expect = 1.173e-179
Identity = 306/717 (42.68%), Postives = 454/717 (63.32%), Query Frame = 2
Query:   47 NSAEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSI-EGILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPEN-NREELVSGNKIMTDEEV----RKNLAEVEERMNK----------KMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGSR-------IPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERT-VIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            N   I   +   +P L  E+  YV +IL EN+D   +  E+ D++ E +   ++        + C Q+ KLL      D  P  +         +E+   +  EN N E L S  K+ T +      +K LA+ E+R             + KKK+N   P+   SQ   ++           + G    +  + + D+S G+K LL  A ++++ GRRYG +GRNG+GKTT+LK I++++LK+PA +S+L VEQEV GDDT  +++VL +DT R  LL   + L +  NKD  + +        + ++Y +++ ++ DKAPARA  +L GLGF+P+ Q   T++FSGGWRMR+ALARALF +PDLLLLDEPTNMLDM+A+ WLE +L+ W+ +++ VSHD+KFL+ + TDI+ L  ++++++K NY +FE+  + KL  Q +EYESQ Q R+H Q FID+FR  A +A  VQSRIKMLEKLP L PV  E  + F+FP C  L +P+LQ DE+ F Y ++   + + L +   ++SRICIVGENGAGKTTLLK+ L +L+P  GL   ++ +RI +F+QHHVDQL++  S++E L    PG   E YR  LG FG+ GD+AL+ +++LSGGQKSR+AF  L++  PN+LILDEPTN+LD+E++EAL  A+  ++GGVV+V+HDE+LI      LWVV+D+ +  ++G  ++YRK+V
Sbjct:    3 NVEAIPGYLTATFPTLPIEIKDYVSAILKENSDEITSLDEVMDAVGEHLQASVENLCEVGAKNACQQLLKLL----HGDNLPKAIKQQEATTKRLEQTVDMAAENQNFEALQSIWKVQTRDTPTTVDKKKLAKAEDRAAAKAEARADAPVERKKKKNE--PSATASQAPIRDSG---------ARGANSKDIKLESVDISIGTKQLLSCADVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGISMLSVEQEVEGDDTLVLDAVLMSDTKRQTLLDREKTLQSRINKDNINDAEKTKWNDELSKLYIEMEALQLDKAPARASSLLYGLGFTPDEQKRPTKEFSGGWRMRVALARALFVKPDLLLLDEPTNMLDMRAVYWLEGHLQGWEGTILTVSHDRKFLNEICTDIVHLHTRRLDHYKGNYDQFEKTMKEKLTQQQREYESQQQLRQHTQEFIDKFRYNAKRAPMVQSRIKMLEKLPVLLPVELESDIHFKFPECEVLSNPVLQLDEVSFRYNEDSPYLFRKLNLGTHANSRICIVGENGAGKTTLLKLLLDDLQPSVGLRNVNRRIRIAYFTQHHVDQLDMETSAIEVLMKNHPGKTQEDYRAALGRFGLAGDMALQSVETLSGGQKSRLAFANLALMQPNYLILDEPTNHLDVETVEALGKALNVFNGGVVLVSHDEQLIELVCKELWVVKDRMVTTLEGGLEEYRKQV 704          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Celegans
Match: abcf-3 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:Q20306])

HSP 1 Score: 533.872 bits (1374), Expect = 1.173e-179
Identity = 306/717 (42.68%), Postives = 454/717 (63.32%), Query Frame = 2
Query:   47 NSAEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSI-EGILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPEN-NREELVSGNKIMTDEEV----RKNLAEVEERMNK----------KMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGSR-------IPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERT-VIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            N   I   +   +P L  E+  YV +IL EN+D   +  E+ D++ E +   ++        + C Q+ KLL      D  P  +         +E+   +  EN N E L S  K+ T +      +K LA+ E+R             + KKK+N   P+   SQ   ++           + G    +  + + D+S G+K LL  A ++++ GRRYG +GRNG+GKTT+LK I++++LK+PA +S+L VEQEV GDDT  +++VL +DT R  LL   + L +  NKD  + +        + ++Y +++ ++ DKAPARA  +L GLGF+P+ Q   T++FSGGWRMR+ALARALF +PDLLLLDEPTNMLDM+A+ WLE +L+ W+ +++ VSHD+KFL+ + TDI+ L  ++++++K NY +FE+  + KL  Q +EYESQ Q R+H Q FID+FR  A +A  VQSRIKMLEKLP L PV  E  + F+FP C  L +P+LQ DE+ F Y ++   + + L +   ++SRICIVGENGAGKTTLLK+ L +L+P  GL   ++ +RI +F+QHHVDQL++  S++E L    PG   E YR  LG FG+ GD+AL+ +++LSGGQKSR+AF  L++  PN+LILDEPTN+LD+E++EAL  A+  ++GGVV+V+HDE+LI      LWVV+D+ +  ++G  ++YRK+V
Sbjct:    3 NVEAIPGYLTATFPTLPIEIKDYVSAILKENSDEITSLDEVMDAVGEHLQASVENLCEVGAKNACQQLLKLL----HGDNLPKAIKQQEATTKRLEQTVDMAAENQNFEALQSIWKVQTRDTPTTVDKKKLAKAEDRAAAKAEARADAPVERKKKKNE--PSATASQAPIRDSG---------ARGANSKDIKLESVDISIGTKQLLSCADVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGISMLSVEQEVEGDDTLVLDAVLMSDTKRQTLLDREKTLQSRINKDNINDAEKTKWNDELSKLYIEMEALQLDKAPARASSLLYGLGFTPDEQKRPTKEFSGGWRMRVALARALFVKPDLLLLDEPTNMLDMRAVYWLEGHLQGWEGTILTVSHDRKFLNEICTDIVHLHTRRLDHYKGNYDQFEKTMKEKLTQQQREYESQQQLRQHTQEFIDKFRYNAKRAPMVQSRIKMLEKLPVLLPVELESDIHFKFPECEVLSNPVLQLDEVSFRYNEDSPYLFRKLNLGTHANSRICIVGENGAGKTTLLKLLLDDLQPSVGLRNVNRRIRIAYFTQHHVDQLDMETSAIEVLMKNHPGKTQEDYRAALGRFGLAGDMALQSVETLSGGQKSRLAFANLALMQPNYLILDEPTNHLDVETVEALGKALNVFNGGVVLVSHDEQLIELVCKELWVVKDRMVTTLEGGLEEYRKQV 704          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Celegans
Match: abcf-1 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:Q19554])

HSP 1 Score: 449.514 bits (1155), Expect = 3.541e-148
Identity = 259/608 (42.60%), Postives = 361/608 (59.38%), Query Frame = 2
Query:  407 VRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSK-NINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKD---TADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYRE----HVQVFIDRFRTYASKATQVQSRIKML---------------------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEI 2143
            V +NL EVE    +        E+       Q SK    L   E+ +D          I NFD+S   K+L   AS++I  GRRYG +G NG+GKTT+LK I  ++L +P+++ +L  EQE+  D T AI++V+++D  R  LL+E  +L +  +   T    R+ E+  +L  I +D A  RA  IL GLGFS EMQ      FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL+ YL+TWKK+L++VSHDQ FLD+V TDI+ L NQK+  ++ NY+ F+           K+Y   MQ  E      Q  +   +     A Q + ++K                          P+L    KE  V F+FP   KL  P+L   ++ FGY K+  + K L   V   SRI IVG NG GK+TLLK+ + +++P  G LR H++LRIG+F QH  + LN  Q+ +EFL TKF   + +  R +LG+ G+        I+ LSGGQKSRVA   L++  P+ +ILDEPTNNLD+ESI+AL  AI  ++GGVV+VTHDERL+ +T+C+LWVVE++ I+EIDG+F+DY+KEVL AL E +
Sbjct:   32 VVENLPEVEGDQEEHGGIGSGAELGAHFTVSQLSKTGTQLAQMENSMD--------IKIENFDISAQGKLLFDKASLTIVYGRRYGLVGPNGMGKTTLLKHIGARKLAIPSHIDLLYCEQEIQVDSTSAIDTVVKSDKKRLALLEEEAKLMSEIEEGKTEAAERMKEVADELRDIGADSAEPRARRILAGLGFSKEMQEKPCTDFSGGWRMRISLARALFLEPTLLMLDEPTNHLDLNAVIWLDNYLQTWKKTLLIVSHDQGFLDSVCTDIIHLDNQKLHTYRGNYTLFK-----------KQYAQDMQVHEKNFDQQQKQLKAMKKEGKSAKQAEEQVKQQMANKAKKGGKKNAGKVNDDDDAGAPELLQRRKEYSVKFQFPETTKLNPPVLGLHDVNFGYGKD-VLFKKLNFGVDMDSRIAIVGPNGVGKSTLLKLLIGKIDPNDGELRKHRTLRIGWFDQHANEALNGEQTPVEFLCTKF-NIDYQEARKQLGTTGLAAHAHTVKIKDLSGGQKSRVALCNLALGGPDIIILDEPTNNLDIESIDALAEAIRDFNGGVVMVTHDERLVVRTDCNLWVVENQGIDEIDGDFEDYKKEVLDALGEAL 618          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Celegans
Match: abcf-2 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:G5EFG4])

HSP 1 Score: 371.703 bits (953), Expect = 2.971e-118
Identity = 194/528 (36.74%), Postives = 325/528 (61.55%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEI 2143
            + +  ++F  + ++ D  + ++ GRRYG IG NG GK+T+++AI  KE+ +P +V + LV +E+   +  A+ +V++ D+VR  L    E+L +  D     ++ ++Y++LD +++  A  +A  IL GLGF+  MQ+   + FSGGWRMR+ALARALF +P +LLLDEPTN LD++A +WLE  L  +K++L+VVSH Q F++ V T+I+ L  +++  +  NY +F + R   L NQ K Y  +    +H++ ++ RF   ++K A Q QS+ K + K+      E  V E    F F    ++P P++    + F Y +    I K++   +   +RI +VG NGAGK+TLLK+   ++ P  GL+R H   +IG + QH  ++L L+ S+LEF+  +FP   E E  R  +G +GI G   + P++ LS GQ+ RV+F  L+ + P+ L+LDEPTN+LD+ESI+AL  AI  + GG+++V+HD RL+ Q    +WV +++ I + DG+   +++ +   +++++
Sbjct:   84 VESLTITFHGREIVVDTKLELNRGRRYGLIGLNGSGKSTIIQAIYNKEMPIPESVDMYLVSREMPASEKTALQAVVDVDSVRKELEHLAEQLASQTDEESQDKLMDVYERLDEMDASLAEKKAAEILHGLGFTKTMQMKKCKDFSGGWRMRIALARALFLKPSVLLLDEPTNHLDLEACVWLEEELAQYKRTLLVVSHSQDFMNGVCTNIIHLFQKQLVYYGGNYDQFVKTRLELLENQQKRYNWEQSQLQHMKDYVARFGHGSAKLARQAQSKEKTMAKMIAGGLAEKAVTETVKQFYFFDAGEIPPPVIMVQHVSFRYNENTPWIYKDIDFGIDLDTRIALVGPNGAGKSTLLKLLCTDVMPTDGLIRRHSHCKIGRYHQHLHEELPLDLSALEFMMKEFPDVKEKEEMRKIVGRYGITGREQVCPMKQLSDGQRCRVSFAWLAWQQPHLLLLDEPTNHLDMESIDALAEAINCFPGGMILVSHDFRLVSQVAEEVWVCDNQGILKWDGDIFSFKEHLRKQIDKDV 611          

HSP 2 Score: 77.7962 bits (190), Expect = 1.816e-14
Identity = 62/242 (25.62%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  584 NFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYE 1309
            +F  +  +  + KD    I +  R   +G NG GK+T+LK + T    MP +  I       IG   + ++  L  D      +                  P++ +K ++ +          I+   G +   Q+   +Q S G R R++ A   + QP LLLLDEPTN LDM++I  L   +  +   +I+VSHD + +  VA ++    NQ I  +  +   F+E  R ++   ++  E
Sbjct:  400 SFRYNENTPWIYKDIDFGIDLDTRIALVGPNGAGKSTLLKLLCTD--VMPTDGLIRRHSHCKIGRYHQHLHEELPLDLSALEFMM--------------KEFPDVKEKEEMRK----------IVGRYGITGREQVCPMKQLSDGQRCRVSFAWLAWQQPHLLLLDEPTNHLDMESIDALAEAINCFPGGMILVSHDFRLVSQVAEEVWVCDNQGILKWDGDIFSFKEHLRKQIDKDVRSRE 615          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Fly
Match: CG9330 (gene:FBgn0036888 transcript:FBtr0074940)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 329/701 (46.93%), Postives = 467/701 (66.62%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQ----NGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXX-----XXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKER--TVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            +E  SI+Q ++P +  ELL+YV  +L  + + FE+  +I +++  IL  +D  +SEE     C+ F  ++   + + +  +LN P+ I ++ +  + +  + + + +   NK   ++   K L + E ++ +K +K+Q    +G IP  +  Q  + +     K   +D  G   + +  I NFD++FG K+LL++A++ +S GRRYG +GRNGLGKTT+L+ IA ++L++P+++S+L VEQEV+GDDT A+ SVLE DT RTRLL           N  +D    + + E Y  L  IE+DKA ARA +ILKGLGF  +MQL  T+ FSGGWRMRLALARALFS+PDLLLLDEPTNMLD+KAIIWLE YL+TW  +++VVSHD+ FLD V TDI+ L +Q++E +K NY +FE+ +  KL +Q +EYE+QM +R HVQ FIDRFR  A++A+ VQS+IKMLEKLP+L+PV KE  V  +FP    L  P+L   E+ F Y  E    + K + +S  S SRICIVGENGAGK+TLLKI + +L    G +  H+ LRIG+F+QHHVD LN+N + +  L   FPG   E YR +LGSFGI G +AL+ I SLSGGQKSRVA   + M  PNFL+LDEPTN+LD+E+I+AL  AI  + GGV++V+HDERLI+     LWV  ++ +  I+G  D+Y++EV
Sbjct:    2 SEYTSILQREFPKIDHELLTYVVGVLTGSEEDFESGDDIFEAVGDILQSVDCDRSEESVRTLCEQFLNIMKNNEVNVERKVLNAPVNIEEMAKNMERL--DKDMQSIWVANKDGANKVDSKKLGKAEAKLQQKQEKRQEVNKHGMIPVAVKLQTATASQVTNKKNTKLDQKGLNRSMDIKIENFDLAFGEKVLLQNANLLLSYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHISVLHVEQEVVGDDTPAVESVLECDTERTRLLTREKEILAALNNGVQDATLSNELSETYASLQNIEADKAVARASVILKGLGFDADMQLRPTKSFSGGWRMRLALARALFSKPDLLLLDEPTNMLDIKAIIWLENYLQTWATTILVVSHDRNFLDTVPTDIIHLHSQELEAYKGNYEQFEKTKTEKLKSQRREYEAQMAHRAHVQDFIDRFRYNANRASSVQSKIKMLEKLPELKPVEKETVVTLKFPEVEPLNPPVLAISEVTFRYNPEDPLPIFKGVNLSATSDSRICIVGENGAGKSTLLKIIVGQLSTIHGNIVLHRGLRIGYFAQHHVDHLNMNVTCVGVLAELFPGRPDEEYRRQLGSFGISGPLALQSIASLSGGQKSRVALAKMCMAEPNFLVLDEPTNHLDIETIDALGRAINAFKGGVILVSHDERLIKVVCKELWVCGNRTVRAIEGGLDEYKREV 700          

HSP 2 Score: 62.7734 bits (151), Expect = 9.214e-10
Identity = 60/269 (22.30%), Postives = 109/269 (40.52%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFL-KELEPQSGLLRTH----------------------------------KSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAAGVMD*LIYRFIY 2209
            +L FG   E+ +++N  + +    R  +VG NG GKTTLL++   ++L+  S +   H                                   +L  G       ++L+   +SL+ ++     +        L   G   D+ LRP +S SGG + R+A        P+ L+LDEPTN LD+++I  L   ++ +   +++V+HD   +      +  +  + +    G ++ + K     L  +     A  A    +   I RF Y
Sbjct:  184 DLAFG---EKVLLQNANLLLSYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHISVLHVEQEVVGDDTPAVESVLECDTERTRLLTREKEILAALNNGVQDATLSNELSETYASLQNIEADKAVARASVI---LKGLGFDADMQLRPTKSFSGGWRMRLALARALFSKPDLLLLDEPTNMLDIKAIIWLENYLQTWATTILVVSHDRNFLDTVPTDIIHLHSQELEAYKGNYEQFEKTKTEKLKSQRREYEAQMAHRAHVQDFIDRFRY 446          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Fly
Match: CG1703 (gene:FBgn0030321 transcript:FBtr0343647)

HSP 1 Score: 449.129 bits (1154), Expect = 2.208e-144
Identity = 249/546 (45.60%), Postives = 337/546 (61.72%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQ----MQYREHVQVFIDRFRTYASKATQVQSRIKML-------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAA 2173
            I NF +S     L  +A++ I+ GRRYG +G NG GKTT+L+ IAT+   +P N+ +LL EQEV+  D  AIN++LEAD  RT +LK+ +EL       D      + + + +L  I +  A ARA  IL GLGFS EMQ   T +FSGGWRMR++LARAL+ +P LL+LDEPTN LD+ A+IWL+ YL+ WKK+L++VSHDQ FLD V  +I+ L  +K++ +K NYS F++    K    +KEYE Q     + + H Q      +      T+ Q + K         E   +L    KE  V F FP   +L  PIL    + F +  ++ +   +   +   SR+ IVG NG GK+T LK+ L ELEPQ G  R +  L +G F QH  + L   +S+ E+LQ  F     E  R  LGSFG+V       ++ LSGGQK+RVA   L +  P+ LILDEPTNNLD+ESI+AL  AI +Y+GGV+IV+HDERLIR+T C+L+V+ED+ INEI GEFDDYRKEVL +L E ++NPS VA AA
Sbjct:  354 IENFTISAKGNDLFVNANLLIAHGRRYGLVGPNGHGKTTLLRHIATRAFAIPPNIDVLLCEQEVVATDKTAINTILEADVRRTEMLKKADELEKQFVAGDLTVQEELNDTFAELKAIGAYSAEARARRILAGLGFSKEMQDRPTNKFSGGWRMRVSLARALYLEPTLLMLDEPTNHLDLNAVIWLDNYLQGWKKTLLIVSHDQSFLDNVCNEIIHLDQKKLQYYKGNYSMFKKMYVQKRREMIKEYEKQEKRLRELKAHGQSKKAAEKKQKESLTRKQEKNKSKQQKQDEDEGPQELLARPKEYIVKFRFPEPSQLQPPILGVHNVTFAFPSQKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNHRLHVGRFDQHSGEHLTAEESAAEYLQRLF-NLPHEKARKALGSFGLVSHAHTIKMKDLSGGQKARVALAELCLSAPDVLILDEPTNNLDIESIDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTINEIVGEFDDYRKEVLDSLGEVVNNPSVVANAA 898          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Fly
Match: CG1703 (gene:FBgn0030321 transcript:FBtr0073520)

HSP 1 Score: 449.129 bits (1154), Expect = 2.208e-144
Identity = 249/546 (45.60%), Postives = 337/546 (61.72%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQ----MQYREHVQVFIDRFRTYASKATQVQSRIKML-------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAA 2173
            I NF +S     L  +A++ I+ GRRYG +G NG GKTT+L+ IAT+   +P N+ +LL EQEV+  D  AIN++LEAD  RT +LK+ +EL       D      + + + +L  I +  A ARA  IL GLGFS EMQ   T +FSGGWRMR++LARAL+ +P LL+LDEPTN LD+ A+IWL+ YL+ WKK+L++VSHDQ FLD V  +I+ L  +K++ +K NYS F++    K    +KEYE Q     + + H Q      +      T+ Q + K         E   +L    KE  V F FP   +L  PIL    + F +  ++ +   +   +   SR+ IVG NG GK+T LK+ L ELEPQ G  R +  L +G F QH  + L   +S+ E+LQ  F     E  R  LGSFG+V       ++ LSGGQK+RVA   L +  P+ LILDEPTNNLD+ESI+AL  AI +Y+GGV+IV+HDERLIR+T C+L+V+ED+ INEI GEFDDYRKEVL +L E ++NPS VA AA
Sbjct:  354 IENFTISAKGNDLFVNANLLIAHGRRYGLVGPNGHGKTTLLRHIATRAFAIPPNIDVLLCEQEVVATDKTAINTILEADVRRTEMLKKADELEKQFVAGDLTVQEELNDTFAELKAIGAYSAEARARRILAGLGFSKEMQDRPTNKFSGGWRMRVSLARALYLEPTLLMLDEPTNHLDLNAVIWLDNYLQGWKKTLLIVSHDQSFLDNVCNEIIHLDQKKLQYYKGNYSMFKKMYVQKRREMIKEYEKQEKRLRELKAHGQSKKAAEKKQKESLTRKQEKNKSKQQKQDEDEGPQELLARPKEYIVKFRFPEPSQLQPPILGVHNVTFAFPSQKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNHRLHVGRFDQHSGEHLTAEESAAEYLQRLF-NLPHEKARKALGSFGLVSHAHTIKMKDLSGGQKARVALAELCLSAPDVLILDEPTNNLDIESIDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTINEIVGEFDDYRKEVLDSLGEVVNNPSVVANAA 898          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Fly
Match: CG9281 (gene:FBgn0030672 transcript:FBtr0340308)

HSP 1 Score: 393.275 bits (1009), Expect = 1.977e-126
Identity = 216/539 (40.07%), Postives = 327/539 (60.67%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKL--PKLEPVVKEMKVV-FEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAAG 2176
            I+NF ++F    LL+D  + ++ GRRYG IG NG GK+++L  +  +E+ +P ++ I  + +E+      A+  V+E D  R +L K  EEL  +++     ++ +IY++LD + +D A  +A  IL GLGF   MQ    + FSGGWRMR+ALARALF +P LLLLDEPTN LD+ A +WLE  LKT+K+ L+++SH Q FL+ V T+I+ L+ ++++ +  NY  F   R   L NQ+K+Y  +     H++ +I RF   ++K A Q QS+ K L K+    L   V + KV+ F FPSC K+P P++    + F Y  E   I KNL   +   +R+ +VG NGAGK+TLLK+   +L P SG++R +  LRI  + QH  + L+L+ S LE++   FP   E E  R  +G +G+ G   + PI+ LS GQ+ RV F  L+ + P+ L+LDEPTN+LD+E+I+AL  AI  +DGG+V+V+HD RLI Q    +WV E + + +  G   DY+      L  +I++ +   A AG
Sbjct:   76 IANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPPHIDIFHLTREIPASSKSALQCVMEVDEERIKLEKLAEELAMSEEDDAQEQLIDIYERLDDMSADLAEVKAARILHGLGFDKAMQQKQAKDFSGGWRMRIALARALFVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVLISHSQDFLNGVCTNIIHLTGKRLKYYTGNYEAFVRTRMELLENQMKQYNWEQDQISHMKNYIARFGHGSAKLARQAQSKEKTLAKMVAQGLTEKVSDDKVLNFYFPSCGKVPPPVIMVQNVNFRYNDETPWIYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNSHLRIARYHQHLHELLDLDASPLEYMMRAFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVTKWKGGILDYKDH----LKNKITSENEKKAKAG 610          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Fly
Match: CG9281 (gene:FBgn0030672 transcript:FBtr0074057)

HSP 1 Score: 393.275 bits (1009), Expect = 1.977e-126
Identity = 216/539 (40.07%), Postives = 327/539 (60.67%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKL--PKLEPVVKEMKVV-FEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAAG 2176
            I+NF ++F    LL+D  + ++ GRRYG IG NG GK+++L  +  +E+ +P ++ I  + +E+      A+  V+E D  R +L K  EEL  +++     ++ +IY++LD + +D A  +A  IL GLGF   MQ    + FSGGWRMR+ALARALF +P LLLLDEPTN LD+ A +WLE  LKT+K+ L+++SH Q FL+ V T+I+ L+ ++++ +  NY  F   R   L NQ+K+Y  +     H++ +I RF   ++K A Q QS+ K L K+    L   V + KV+ F FPSC K+P P++    + F Y  E   I KNL   +   +R+ +VG NGAGK+TLLK+   +L P SG++R +  LRI  + QH  + L+L+ S LE++   FP   E E  R  +G +G+ G   + PI+ LS GQ+ RV F  L+ + P+ L+LDEPTN+LD+E+I+AL  AI  +DGG+V+V+HD RLI Q    +WV E + + +  G   DY+      L  +I++ +   A AG
Sbjct:   76 IANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPPHIDIFHLTREIPASSKSALQCVMEVDEERIKLEKLAEELAMSEEDDAQEQLIDIYERLDDMSADLAEVKAARILHGLGFDKAMQQKQAKDFSGGWRMRIALARALFVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVLISHSQDFLNGVCTNIIHLTGKRLKYYTGNYEAFVRTRMELLENQMKQYNWEQDQISHMKNYIARFGHGSAKLARQAQSKEKTLAKMVAQGLTEKVSDDKVLNFYFPSCGKVPPPVIMVQNVNFRYNDETPWIYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNSHLRIARYHQHLHELLDLDASPLEYMMRAFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVTKWKGGILDYKDH----LKNKITSENEKKAKAG 610          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Zebrafish
Match: abcf1 (ATP-binding cassette, sub-family F (GCN20), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-31])

HSP 1 Score: 417.542 bits (1072), Expect = 1.192e-132
Identity = 241/543 (44.38%), Postives = 344/543 (63.35%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKML----------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGR--LGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISN 2149
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK IA + L +P N+ +LL EQEV+ DDT A+ +VL+ADT R +LL+E  +L +  +  D S   R+ ++Y++L  I +  A A+A  IL GL F+PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL++WKK+L++VSHDQ FLD V TDI+ L NQK+  ++ NY  F++    K     K+Y+ Q +  + ++      +    +  +  +R +             +  +L    KE  V F FP+ P L  PIL    + FGY  ++ + KN+   +   SRICIVG NG GK+TLL +   +L P  G +R +  L++GFF+Q + DQLN+++++ E+LQ  F     +Y   R  LG FG+        I  LSGGQK+RV F+ LS + P+ LILDEPTNNLD+ESI+AL  AI +Y G V+IV+HD RLI +T C LWVVED++IN+IDG+F+DY++EVL AL E + N
Sbjct:  314 SDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADDTPAVQAVLKADTRRLKLLEEERQLQSRLEKGDDSVSERLDKVYEELRAIGAAAAEAKARRILAGLSFTPEMQNRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQSWKKTLLIVSHDQSFLDDVCTDIIHLDNQKLYYYRGNYLTFKKMYIQKQKELQKQYDKQEKKLKDLKAGGKSTKQAEKQTKEALTRKQQKGKKKSQEEESHEATELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFGYEGQKPLFKNVDFGIDMESRICIVGPNGVGKSTLLLLLTGKLNPTKGEMRKNHRLKVGFFNQQYADQLNMDEAATEYLQRNF---NLQYQDSRKCLGRFGLESHAHTIQISKLSGGQKARVVFSELSCRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCQLWVVEDQSINQIDGDFEDYKREVLEALGETLVN 853          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Zebrafish
Match: abcf1 (ATP-binding cassette, sub-family F (GCN20), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-31])

HSP 1 Score: 417.542 bits (1072), Expect = 1.453e-132
Identity = 241/543 (44.38%), Postives = 344/543 (63.35%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKML----------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGR--LGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISN 2149
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK IA + L +P N+ +LL EQEV+ DDT A+ +VL+ADT R +LL+E  +L +  +  D S   R+ ++Y++L  I +  A A+A  IL GL F+PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL++WKK+L++VSHDQ FLD V TDI+ L NQK+  ++ NY  F++    K     K+Y+ Q +  + ++      +    +  +  +R +             +  +L    KE  V F FP+ P L  PIL    + FGY  ++ + KN+   +   SRICIVG NG GK+TLL +   +L P  G +R +  L++GFF+Q + DQLN+++++ E+LQ  F     +Y   R  LG FG+        I  LSGGQK+RV F+ LS + P+ LILDEPTNNLD+ESI+AL  AI +Y G V+IV+HD RLI +T C LWVVED++IN+IDG+F+DY++EVL AL E + N
Sbjct:  334 SDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADDTPAVQAVLKADTRRLKLLEEERQLQSRLEKGDDSVSERLDKVYEELRAIGAAAAEAKARRILAGLSFTPEMQNRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQSWKKTLLIVSHDQSFLDDVCTDIIHLDNQKLYYYRGNYLTFKKMYIQKQKELQKQYDKQEKKLKDLKAGGKSTKQAEKQTKEALTRKQQKGKKKSQEEESHEATELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFGYEGQKPLFKNVDFGIDMESRICIVGPNGVGKSTLLLLLTGKLNPTKGEMRKNHRLKVGFFNQQYADQLNMDEAATEYLQRNF---NLQYQDSRKCLGRFGLESHAHTIQISKLSGGQKARVVFSELSCRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCQLWVVEDQSINQIDGDFEDYKREVLEALGETLVN 873          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Zebrafish
Match: abcf2b (ATP-binding cassette, sub-family F (GCN20), member 2b [Source:ZFIN;Acc:ZDB-GENE-050506-58])

HSP 1 Score: 386.341 bits (991), Expect = 1.225e-123
Identity = 210/524 (40.08%), Postives = 332/524 (63.36%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI  +E+ +P ++ I  + +E+   +  A+  V+E D  R +L KE E L A++D+ +  ++ EIY++L+ +++DKA  RA  IL GLGF+P MQ    + FSGGWRMR++LARALF +P +LLLDEPTN LD+ A +WLE  LK++K+ L+++SH Q FL+ V T+I+ L  +K++ +  NY ++ + R     NQ+K Y  +     H++ +I RF   ++K A Q QS+ K L+K+        V+ +  + F FP C  +P P++    + F Y+ +  +I KNL   +   +R+ +VG NGAGK+TLLK+ + EL P  G++R H  ++IG + QH  +QL L+ S LE++   FP   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI +++GG+++V+HD RLI+Q    +WV E + I +  G+   Y++ +
Sbjct:   84 TDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIFHLTREMAPSEKTALQCVMEVDEERIKLEKEAERL-AHEDS-ECEKLMEIYERLEELDADKAEVRASRILFGLGFTPAMQRKKLKDFSGGWRMRVSLARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRYNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTARVMNDKTLSFYFPPCGTIPPPVIMVQNVSFRYSSDTQIIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCFPEIKEKEEMRKIIGCYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWKGDILAYKEHL 605          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Zebrafish
Match: abcf2a (ATP-binding cassette, sub-family F (GCN20), member 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8714])

HSP 1 Score: 378.252 bits (970), Expect = 1.206e-120
Identity = 208/534 (38.95%), Postives = 334/534 (62.55%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISN 2149
            T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI+ +E+ +P ++ I  + +E+   +  A+  V+E D  R +L KE E L A++D+ +  ++ E+Y++L+ +++DKA  RA  IL GLGF+  MQ    + FSGGWRMR+ALARALF +P +LLLDEPTN LD+ A +WLE  L  +K+ L+++SH Q FL+ V T+I+ L  +K++ +  NY ++ + R     NQ+K +  +     H++ +I RF   ++K A Q QS+ K L+K+      E VV +  + F FP C K+P P++    + F Y++    I KNL   +   +R+ +VG NGAGK+TLLK+   EL P  G++R H  ++IG + QH  +QL L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI  ++GG+++V+HD RLI+Q    +WV E + I +   +   Y++ +   +++++ +
Sbjct:   81 TDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAISHREVPIPEHIDIYHLTREMAPSEKTALQCVMEVDEERIKLEKEAERL-AHEDS-ECEKLMELYERLEELDADKASMRASRILHGLGFTTSMQQKKLKDFSGGWRMRVALARALFLKPFMLLLDEPTNHLDLDACVWLEEELSQFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERVVNDKTLSFYFPPCGKIPPPVIMVQNVSFRYSENTPYIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPSDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWSRDILAYKEHLKSKIDKQMHD 612          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Zebrafish
Match: abcf2a (ATP-binding cassette, sub-family F (GCN20), member 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8714])

HSP 1 Score: 378.252 bits (970), Expect = 1.206e-120
Identity = 208/534 (38.95%), Postives = 334/534 (62.55%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISN 2149
            T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI+ +E+ +P ++ I  + +E+   +  A+  V+E D  R +L KE E L A++D+ +  ++ E+Y++L+ +++DKA  RA  IL GLGF+  MQ    + FSGGWRMR+ALARALF +P +LLLDEPTN LD+ A +WLE  L  +K+ L+++SH Q FL+ V T+I+ L  +K++ +  NY ++ + R     NQ+K +  +     H++ +I RF   ++K A Q QS+ K L+K+      E VV +  + F FP C K+P P++    + F Y++    I KNL   +   +R+ +VG NGAGK+TLLK+   EL P  G++R H  ++IG + QH  +QL L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI  ++GG+++V+HD RLI+Q    +WV E + I +   +   Y++ +   +++++ +
Sbjct:   81 TDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAISHREVPIPEHIDIYHLTREMAPSEKTALQCVMEVDEERIKLEKEAERL-AHEDS-ECEKLMELYERLEELDADKASMRASRILHGLGFTTSMQQKKLKDFSGGWRMRVALARALFLKPFMLLLDEPTNHLDLDACVWLEEELSQFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERVVNDKTLSFYFPPCGKIPPPVIMVQNVSFRYSENTPYIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPSDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWSRDILAYKEHLKSKIDKQMHD 612          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 335/706 (47.45%), Postives = 485/706 (68.70%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEEVYDL--CCQIFKLLVSKTDDDRKP----ILLNNPIC---IGDIVEKDK----VILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A  + I++N++P L  ELL YV  IL      FE+ +++ +++  +L ++     ++      C +I++ +    ++ + P    +LL  PI    I D  E D+    V+L + ++   V   ++   E+    L   +E+ +++  +K  G +    + ++ S +     KE+ I+S+G   + +  I NFD+SFG ++LL  A + ++ GRRYG +GRNGLGKTT+LK +A + L++P+++SIL VEQEV GD+T A+ SVLE DT+R RLL+E +ELN   +    DGS   R+ EIY KL+ IE+DKAPARA +IL GLGF   MQ   T++FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+AVATDI+ L +Q++E ++ N+  F + +  +L NQ +EYE+Q QYREH+QVFIDRFR  A++A+QVQS++K+LEKLP+L+PV K+ +V+  FP    K   PILQ DE+ F Y+ ++ V KNL +S    SRIC+VGENGAGK+T+LK+ + EL P  G+   H++L+IG+FSQHHVDQL+LN S++E L  +F G   E YR +LGS+GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDER IR     LWV E+  +  I+G FD+YR
Sbjct:    2 ATFVDILRNEFPQLDAELLQYVTDILDSGRADFESETDLFEAVGELLQDVSRDTKDDDDIRDICQRIYRAM--HLENHQLPAQDQVLLQAPIQLSKISDSYEVDEKIQNVMLLKKDQSSTVDVKRL---EKAEAKLKSKQEKRSERDLQKSTGNV----VMEEASASQAASKKENRIESSGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQVFIDRFRYNANRASQVQSKLKLLEKLPELKPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQPVFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSGKTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEYR 698          

HSP 2 Score: 55.0694 bits (131), Expect = 5.235e-7
Identity = 59/246 (23.98%), Postives = 94/246 (38.21%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRI-GFFSQHHVDQLNLN------QSSLEF-------------LQTKFP-----GSE-------------------PEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   ER ++    + + +  R  +VG NG GKTTLLK+               +SLR+    S  HV+Q          QS LE              L TK       GSE                   P      L   G    +  +  +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + +    G F+ + K
Sbjct:  186 DVSFG---ERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKML------------AGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLK 416          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 311/708 (43.93%), Postives = 458/708 (64.69%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEEVYDL--CCQIFKLLVSKTDDDRKP----ILLNNPIC---IGDIVEKDK----VILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALAR-ALFSQPDLL-LLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A  + I++N++P L  ELL YV  IL      FE+ +++ +++  +L ++     ++      C +I++ +    ++ + P    +LL  PI    I D  E D+    V+L + ++   V   ++   E+    L   +E+ +++  +K  G +    + ++ S +     KE+ I+S+G   + +  I NFD+SFG ++LL  A + ++ GRRYG +GRNGLGKTT+LK +A + L++P+++SIL VEQEV GD+T A+ SVLE DT+R RLL+E +ELN   +    DGS   R+ EIY KL+ IE+DKAPARA +IL GLGF   MQ   T++FSGGWRMRLALAR  LF+   L+ ++ EPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+AVATDI+ L +Q++E ++ N+  F + +  +L NQ +EYE+Q QYREH+Q++                       L KL+PV K+ +V+  FP    K   PILQ DE+ F Y+ ++ V KNL +S    SRIC+VGENGAGK+T+LK+ + EL P  G+   H++L+IG+FSQHHVDQL+LN S++E L  +F G   E YR +LGS+GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDER IR     LWV E+  +  I+G FD+YR
Sbjct:    2 ATFVDILRNEFPQLDAELLQYVTDILDSGRADFESETDLFEAVGELLQDVSRDTKDDDDIRDICQRIYRAM--HLENHQLPAQDQVLLQAPIQLSKISDSYEVDEKIQNVMLLKKDQSSTVDVKRL---EKAEAKLKSKQEKRSERDLQKSTGNV----VMEEASASQAASKKENRIESSGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIY-----------------------LAKLKPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQPVFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSGKTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEYR 677          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 282/578 (48.79%), Postives = 397/578 (68.69%), Query Frame = 2
Query:  413 KNLAEVEERMNKKMKKKQNGEIPTL---LISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALAR-ALFSQPDLL-LLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            K L + E ++  K +K+   ++      ++ ++ S +     KE+ I+S+G   + +  I NFD+SFG ++LL  A + ++ GRRYG +GRNGLGKTT+LK +A + L++P+++SIL VEQEV GD+T A+ SVLE DT+R RLL+E +ELN   +    DGS   R+ EIY KL+ IE+DKAPARA +IL GLGF   MQ   T++FSGGWRMRLALAR  LF+   L+ ++ EPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+AVATDI+ L +Q++E ++ N+  F + +  +L NQ +EYE+Q QYREH+Q++                       L KL+PV K+ +V+  FP    K   PILQ DE+ F Y+ ++ V KNL +S    SRIC+VGENGAGK+T+LK+ + EL P  G+   H++L+IG+FSQHHVDQL+LN S++E L  +F G   E YR +LGS+GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDER IR     LWV E+  +  I+G FD+YR
Sbjct:   31 KRLEKAEAKLKSKQEKRSERDLQKSTGNVVMEEASASQAASKKENRIESSGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIY-----------------------LAKLKPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQPVFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSGKTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEYR 585          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 285/593 (48.06%), Postives = 402/593 (67.79%), Query Frame = 2
Query:  368 ELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTL---LISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALAR-ALFSQPDLL-LLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
             L  GN + +     K L + E ++  K +K+   ++      ++ ++ S +     KE+ I+S+G   + +  I NFD+SFG ++LL  A + ++ GRRYG +GRNGLGKTT+LK +A + L++P+++SIL VEQEV GD+T A+ SVLE DT+R RLL+E +ELN   +    DGS   R+ EIY KL+ IE+DKAPARA +IL GLGF   MQ   T++FSGGWRMRLALAR  LF+   L+ ++ EPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+AVATDI+ L +Q++E ++ N+  F + +  +L NQ +EYE+Q QYREH+Q++                       L KL+PV K+ +V+  FP    K   PILQ DE+ F Y+ ++ V KNL +S    SRIC+VGENGAGK+T+LK+ + EL P  G+   H++L+IG+FSQHHVDQL+LN S++E L  +F G   E YR +LGS+GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDER IR     LWV E+  +  I+G FD+YR
Sbjct:   62 HLFCGNILYSQTVDVKRLEKAEAKLKSKQEKRSERDLQKSTGNVVMEEASASQAASKKENRIESSGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIY-----------------------LAKLKPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQPVFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSGKTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEYR 631          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 284/589 (48.22%), Postives = 401/589 (68.08%), Query Frame = 2
Query:  380 GNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTL---LISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALAR-ALFSQPDLL-LLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            GN + +     K L + E ++  K +K+   ++      ++ ++ S +     KE+ I+S+G   + +  I NFD+SFG ++LL  A + ++ GRRYG +GRNGLGKTT+LK +A + L++P+++SIL VEQEV GD+T A+ SVLE DT+R RLL+E +ELN   +    DGS   R+ EIY KL+ IE+DKAPARA +IL GLGF   MQ   T++FSGGWRMRLALAR  LF+   L+ ++ EPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+AVATDI+ L +Q++E ++ N+  F + +  +L NQ +EYE+Q QYREH+Q++                       L KL+PV K+ +V+  FP    K   PILQ DE+ F Y+ ++ V KNL +S    SRIC+VGENGAGK+T+LK+ + EL P  G+   H++L+IG+FSQHHVDQL+LN S++E L  +F G   E YR +LGS+GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDER IR     LWV E+  +  I+G FD+YR
Sbjct:   92 GNILYSQTVDVKRLEKAEAKLKSKQEKRSERDLQKSTGNVVMEEASASQAASKKENRIESSGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIY-----------------------LAKLKPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQPVFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSGKTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEYR 657          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Mouse
Match: Abcf3 (ATP-binding cassette, sub-family F (GCN20), member 3 [Source:MGI Symbol;Acc:MGI:1351656])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 320/703 (45.52%), Postives = 475/703 (67.57%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEI--DASKSEEVYDLCCQIFKLL--VSKTDDDRKPILLNNPICIGDIVEK---DKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEI---PTLLISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR-----TRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+  D+     +  +C +++  L      +     +LL+ PI +  I+E    D  +     RE+  + N         K L + E R+  K +K+   E       L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV GDDT A+ SVLE+DTVR           L       + ++ +++ EIY KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  + ++   L +S    SRIC+VGENGAGK+T+LK+ + +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+  + GGV++V+HDER IR     LWV E+ ++  ++G FD YR
Sbjct:    2 ATCADILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQNQGNSQVLLDAPIQLSKIMENYDCDTKLPGLLKREQSSTVNA--------KKLEKAEARLKAKQEKRSEKETLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVLKFPDGFEKFSPPILQLDEVDFYYDPKHSIFSRLSVSADLESRICVVGENGAGKSTMLKLLMGDLSPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGLPEEEYRHQLGRYGISGELAMRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGQALNNFRGGVILVSHDERFIRLVCKELWVCENGSVTRVEGGFDQYR 696          

HSP 2 Score: 56.9954 bits (136), Expect = 9.167e-8
Identity = 55/237 (23.21%), Postives = 95/237 (40.08%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIF-------------------------------LKELEPQSGLLRTHK--SLRI--GFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+                                L+    +  LLR  +  SLRI  G        QL      LE ++       P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  184 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEAD---KAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIK 414          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Mouse
Match: Abcf3 (ATP-binding cassette, sub-family F (GCN20), member 3 [Source:MGI Symbol;Acc:MGI:1351656])

HSP 1 Score: 500.36 bits (1287), Expect = 3.542e-168
Identity = 259/587 (44.12%), Postives = 389/587 (66.27%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDA-SKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEK---DKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEI---PTLLISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR-----TRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFP 1771
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+   SK +      CQ    +    +     +LL+ PI +  I+E    D  +     RE+  + N         K L + E R+  K +K+   E       L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV GDDT A+ SVLE+DTVR           L       + ++ +++ EIY KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  + ++   L +S    SRIC+VGENGAGK+T+LK+ + +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFP
Sbjct:    2 ATCADILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQ---RMAEPQNQGNSQVLLDAPIQLSKIMENYDCDTKLPGLLKREQSSTVNA--------KKLEKAEARLKAKQEKRSEKETLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVLKFPDGFEKFSPPILQLDEVDFYYDPKHSIFSRLSVSADLESRICVVGENGAGKSTMLKLLMGDLSPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFP 577          

HSP 2 Score: 57.7658 bits (138), Expect = 5.381e-8
Identity = 55/237 (23.21%), Postives = 95/237 (40.08%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIF-------------------------------LKELEPQSGLLRTHK--SLRI--GFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+                                L+    +  LLR  +  SLRI  G        QL      LE ++       P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  178 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEAD---KAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIK 408          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Mouse
Match: Abcf1 (ATP-binding cassette, sub-family F (GCN20), member 1 [Source:MGI Symbol;Acc:MGI:1351658])

HSP 1 Score: 404.445 bits (1038), Expect = 7.375e-128
Identity = 236/547 (43.14%), Postives = 336/547 (61.43%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEY--------------ESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKF--PGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISN 2149
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK IA + L +P N+ +LL EQEV+ D+T A+ +VL ADT R RLL+E   L    +  D     ++ ++Y++L    +  A A+A  IL GLGF PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL+ W+K+L++VSHDQ FLD V TDI+ L  Q++  ++ NY  F++  + K    LK+Y              +S  Q  +  +  + R +    +  Q +      ++ P+L    KE  V F FP  P L  P+L    + FGY  ++ + KNL   +   SRICIVG NG GK+TLL +   +L P +G +R +  L+IGFF+Q + +QL++ ++  E+LQ  F  P  +    R  LG FG+        I  LSGGQK+RV F  L+ + P+ LILDEPTNNLD+ESI+AL  AI  Y G V++V+HD RLI +TNC LWVVE++ +++IDG+FDDY++EVL AL E + N
Sbjct:  294 SDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLRLLEEERRLQGQLEQGDDTAAEKLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDTQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEVLTRKQQKCRRKNQDEES----QEPPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYEGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTNGEMRKNHRLKIGFFNQQYAEQLHMEETPTEYLQRSFNLPYQD---ARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINDYKGAVIVVSHDARLITETNCQLWVVEEQGVSQIDGDFDDYKREVLEALGEVMVN 833          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Mouse
Match: Abcf2 (ATP-binding cassette, sub-family F (GCN20), member 2 [Source:MGI Symbol;Acc:MGI:1351657])

HSP 1 Score: 388.652 bits (997), Expect = 2.463e-124
Identity = 214/531 (40.30%), Postives = 334/531 (62.90%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEE 2140
            T+  I N  ++F  + LL D  + ++ GRRYG IG NG+GK+ +L AI  +E+ +P ++ I  + +E+   +   +  V+E DT R  L +E E L A++D A+  ++ E+Y++L+ +++DKA  RA  IL GLGF+P MQ    + FSGGWRMR+ALARALF +P +LLLDEPTN LD+ A +WLE  LKT+K+ L++VSH Q FL+ V T+I+ + N+K++ +  NY ++ + R     NQ+K +  +     H++ +I RF   ++K A Q QS+ K L+K+      E VV +  + F FP C K+P P++    + F YTK+   I  NL   +   +R+ +VG NGAGK+TLLK+   EL P  G++R H  ++IG + QH  +QL+L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV    L+ +NP+ L LDEPTN+LD+E+I+AL  AI +++GG+++V+HD RLI+Q    +WV E + I +  G+   Y++ +   L +E
Sbjct:   89 TDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSEKTPLQCVMEVDTERAMLEREAERL-AHED-AECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDE 617          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Mouse
Match: Abcf3 (ATP-binding cassette, sub-family F (GCN20), member 3 [Source:MGI Symbol;Acc:MGI:1351656])

HSP 1 Score: 224.942 bits (572), Expect = 4.481e-68
Identity = 106/218 (48.62%), Postives = 156/218 (71.56%), Query Frame = 2
Query: 1079 DEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLN 1729
            DEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE                           VGENGAGK+T+LK+ + +L P  G+   H++L+IG+FSQHHV+QL+
Sbjct:    2 DEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVLKFPDGFEKFSPPILQLDE---------------------------VGENGAGKSTMLKLLMGDLSPVRGIRHAHRNLKIGYFSQHHVEQLD 192          
BLAST of ATP-binding cassette sub-family F member 3-like vs. UniProt/SwissProt
Match: sp|Q8K268|ABCF3_MOUSE (ATP-binding cassette sub-family F member 3 OS=Mus musculus OX=10090 GN=Abcf3 PE=1 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 320/703 (45.52%), Postives = 475/703 (67.57%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEI--DASKSEEVYDLCCQIFKLL--VSKTDDDRKPILLNNPICIGDIVEK---DKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEI---PTLLISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR-----TRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+  D+     +  +C +++  L      +     +LL+ PI +  I+E    D  +     RE+  + N         K L + E R+  K +K+   E       L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV GDDT A+ SVLE+DTVR           L       + ++ +++ EIY KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  + ++   L +S    SRIC+VGENGAGK+T+LK+ + +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+  + GGV++V+HDER IR     LWV E+ ++  ++G FD YR
Sbjct:    2 ATCADILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQNQGNSQVLLDAPIQLSKIMENYDCDTKLPGLLKREQSSTVNA--------KKLEKAEARLKAKQEKRSEKETLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVLKFPDGFEKFSPPILQLDEVDFYYDPKHSIFSRLSVSADLESRICVVGENGAGKSTMLKLLMGDLSPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGLPEEEYRHQLGRYGISGELAMRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGQALNNFRGGVILVSHDERFIRLVCKELWVCENGSVTRVEGGFDQYR 696          

HSP 2 Score: 56.9954 bits (136), Expect = 6.412e-7
Identity = 55/237 (23.21%), Postives = 95/237 (40.08%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIF-------------------------------LKELEPQSGLLRTHK--SLRI--GFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+                                L+    +  LLR  +  SLRI  G        QL      LE ++       P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  184 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEAD---KAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIK 414          
BLAST of ATP-binding cassette sub-family F member 3-like vs. UniProt/SwissProt
Match: sp|Q66H39|ABCF3_RAT (ATP-binding cassette sub-family F member 3 OS=Rattus norvegicus OX=10116 GN=Abcf3 PE=2 SV=1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 319/703 (45.38%), Postives = 474/703 (67.43%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEI--DASKSEEVYDLCCQIFKLL--VSKTDDDRKPILLNNPICIGDIVEK---DKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEI---PTLLISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR-----TRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+  D+     +  +C +++  L      +     +LL+ PI +  I+E    D  +     RE+  + N         K L + E R+  K +K+   E     + L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV GDDT A+ SVLE+DT+R           L+      + ++ + + E+Y KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  +  +   L +S    SRIC+VGENGAGK+T+LK+ + +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+  + GGVV+V+HDER IR     LWV E  ++  ++G FD YR
Sbjct:    2 ATCADILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQNQGNNQVLLDAPIQLSKIMENYDCDTKLPGLLKREQSSTVNA--------KKLEKAEARLKAKQEKRSEKETLKTSSPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTIREDLLRQERGLSLKIAAGRAEGSEAALLAEVYTKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVLKFPDGFEKFSPPILQLDEVDFYYDPKHIIFSRLSVSADLESRICVVGENGAGKSTMLKLLMGDLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRYGISGELAMRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGHALNNFRGGVVLVSHDERFIRLVCKELWVCEKGSVTRVEGGFDQYR 696          

HSP 2 Score: 56.6102 bits (135), Expect = 7.807e-7
Identity = 56/246 (22.76%), Postives = 96/246 (39.02%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRI-GFFSQHHVDQLN---------------------LNQS---SLEFLQTKFPGSE-------------------PEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+               +SLR+    S  HV+Q                       L Q    SL+    +  GSE                   P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  184 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKML------------ATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTIREDLLRQERGLSLKIAAGRAEGSEAALLAEVYTKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIK 414          
BLAST of ATP-binding cassette sub-family F member 3-like vs. UniProt/SwissProt
Match: sp|Q9NUQ8|ABCF3_HUMAN (ATP-binding cassette sub-family F member 3 OS=Homo sapiens OX=9606 GN=ABCF3 PE=1 SV=2)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 324/705 (45.96%), Postives = 477/705 (67.66%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEI--DASKSEEVYDLCCQIFKLL--VSKTDDDRKPILLNNPICIGDIVEKDK--VILPEN-NREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTL-----LISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR----TRXXXXXXXXNANK-DTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+  D+     +  +C +++  L            +LL+ PI +  I E       LP    RE+  + N         K L + E R+  K K+++  E  TL     L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV GDDT A+ SVLE+D+VR     R  +   ++ A + + ++ + + EIY KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+ATDI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  +  +   L +S    SRIC+VGENGAGK+T+LK+ L +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+  + GGV++V+HDER IR     LWV E   +  ++G FD YR
Sbjct:    2 ATCAEILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLLKREQSSTVNA--------KKLEKAEARL--KAKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFPDGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLESRICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRYGISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCRELWVCEGGGVTRVEGGFDQYR 696          

HSP 2 Score: 55.8398 bits (133), Expect = 1.458e-6
Identity = 56/246 (22.76%), Postives = 95/246 (38.62%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRI-GFFSQHHVDQLNLN------QSSLE------------------FLQTKFPGSE-------------------PEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+               +SLR+    S  HV+Q          QS LE                      +  GSE                   P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  184 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKML------------ATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIK 414          
BLAST of ATP-binding cassette sub-family F member 3-like vs. UniProt/SwissProt
Match: sp|Q5R9Z5|ABCF3_PONAB (ATP-binding cassette sub-family F member 3 OS=Pongo abelii OX=9601 GN=ABCF3 PE=2 SV=1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 322/705 (45.67%), Postives = 474/705 (67.23%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEI--DASKSEEVYDLCCQIFKLL--VSKTDDDRKPILLNNPICIGDIVEKDK--VILPEN-NREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTL-----LISQQFSKNINLYDKEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVR----TRXXXXXXXXNANK-DTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A    I+++++P +  ++  YV  +L   +  FE+  ++ +++  +L E+  D+     +  +C +++  L            +LL+ PI +  I E       LP    RE+  + N         K L + E R+  K K+++  E  TL     L+ ++ S +     KE  ++S+G   +  V I NFD+SFG ++LL  A ++++ GRRYG +GRNGLGKTT+LK +AT+ L++PA++S+L VEQEV  DDT A+ SVLE+D+VR     R  +    + A + + ++ + + EIY KL+ IE+DKAPARA +IL GLGF+P+MQ   TR+FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW  +++VVSHD+ FL+A+A DI+ L +Q+++ ++ ++  F ++++ +L+NQ +EYE+Q QYR+H+QVFIDRFR  A++A+QVQS++KMLEKLP+L+PV KE +VV +FP    K   PILQ DE+ F Y  +  +   L +S    SRIC+VGENGAGK+T+LK+ L +L P  G+   H++L+IG+FSQHHV+QL+LN S++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  A+  + GGV++V+HDER IR     LWV E   +  ++G FD YR
Sbjct:    2 ATCAEILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLLKREQSSTVNA--------KKLEKAEARL--KAKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAEDDTPALQSVLESDSVREDLLRRERELSAHIAAGRVEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIAADIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKFPDGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLESRICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRYGISGELAMRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCRELWVCEGGGVTRVEGGFDQYR 696          

HSP 2 Score: 56.225 bits (134), Expect = 1.062e-6
Identity = 56/246 (22.76%), Postives = 95/246 (38.62%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRI-GFFSQHHVDQ------LNLNQSSLE------------------FLQTKFPGSE-------------------PEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   +R ++    +++    R  +VG NG GKTTLLK+               +SLR+    S  HV+Q          QS LE                      +  GSE                   P      L   G    +  +P +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+F+ + K
Sbjct:  184 DVSFG---DRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKML------------ATRSLRVPAHISLLHVEQEVAEDDTPALQSVLESDSVREDLLRRERELSAHIAAGRVEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIAADIIHLHSQRLDGYRGDFETFIK 414          
BLAST of ATP-binding cassette sub-family F member 3-like vs. UniProt/SwissProt
Match: sp|O59672|YB89_SCHPO (Uncharacterized ABC transporter ATP-binding protein C29A3.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A3.09c PE=3 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 2.005e-162
Identity = 250/539 (46.38%), Postives = 366/539 (67.90%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEAD-------------TVRTRXXXXXXXXNANKDTADGS--------------RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            I   D++F    +L  AS++++ GRRYG  GRNG+GK+T+L+A++ +E+ +P +++IL VEQE+ GDDT A+ SVL+AD             T R   +++  E  +   TAD +              R+ +I  KL  ++SD+A +RA  IL GLGF+ EMQ  +T+ FSGGWRMRL+LARALF QPDLLLLDEP+NMLD+ +I +L  YL+T+K  ++VVSHD+ FL+ VATDI+   +++++ +K N+S+F   R  +  NQL+EYE QM+YR+H+Q FID+FR  A+K+++ QSRIK LEKLP LE    E +V FEFP   K+  PILQ  ++ F Y     ++K++ I V   SRI +VG NGAGK+T+LK+ +++L P SG++  H  LRI +F+QHHVD L+LN ++L FL   FPG   E YR  LG+FG+ G +AL+ + +LSGGQKSRVAF  L ++NP+ LILDEPTN+LD+ES++AL  A++++ GGV++V+HD   + +T  S+W  +   +++ DG    Y+K
Sbjct:  185 IDGIDLAFAGHRILTGASLTLAQGRRYGLTGRNGIGKSTLLRALSRREIAIPTHITILHVEQEMTGDDTPALQSVLDADVWRKYLIQDQEKITNRLSTIEKELEELSKDQTADQAISRRLERERDELDLRLLDIQNKLSEMDSDRAESRAATILAGLGFTQEMQSHATKTFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAFLSEYLQTYKNIVLVVSHDRSFLNEVATDIIHQHSERLDYYKGNFSQFYATREERCKNQLREYEKQMEYRKHLQSFIDKFRYNAAKSSEAQSRIKKLEKLPILEKPQTEEEVEFEFPPVEKISPPILQMSDVNFEYVPGHPILKHVDIDVQMDSRIGVVGPNGAGKSTMLKLLIEQLHPTSGIVSRHPRLRIAYFAQHHVDTLDLNLNALSFLAKTFPGKGEEEYRRHLGAFGVSGPLALQKMITLSGGQKSRVAFACLGLQNPHILILDEPTNHLDMESMDALTRAVKRFQGGVILVSHDVDFLDKTCTSIWQCDHNVVSKFDGTISQYKK 723          
BLAST of ATP-binding cassette sub-family F member 3-like vs. TrEMBL
Match: A0A1S3JSX4 (ATP-binding cassette sub-family F member 3-like OS=Lingula unguis OX=7574 GN=LOC106175845 PE=4 SV=1)

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 354/710 (49.86%), Postives = 499/710 (70.28%), Query Frame = 2
Query:   62 LSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSE-EVYDLCCQIFKLLVSKTDDDRKPI-------LLNNPICIGDIVE--KDKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGE-IPTLLIS----QQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRT------RXXXXXXXXNANKDTADG--SRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            +S+I   +P ++ ELL YV S+L  +   FE+  ++ +++  +L+E+D  KSE EV D+C ++F +L  K D+D K         +L+ P+ +G +VE   DK I  E N       +  + D+   K L + E ++ +K +K+ + E +P ++ S    Q  S +     K+   DS+G   + +  I NFD+S+GS +L+K ASI+++ GRRYG +G+NG GKTT+L+ IA+++LK+ ++++IL VEQEV+GDDT A++SVL++D  R       R +       +   T DG  +R+ E+Y +L+ +E++KAPARA +IL GLGF+P+MQ  +T++FSGGWRMRLALARALF++PDLLLLDEPTNMLDMKAIIWLE YL+TW  +++VVSHD++FL++VATDI+ L +Q+I+ +K N+  F + R  K+ NQ KEYE+QMQYREHVQVFID+FR  A +A+ VQS+IK+LEKLP L+PV KE  +VF FP    L  PILQ DE+ F YTKE+ + KN+ +S    SRIC+VGENGAGKTTLLKI L +L P  G    H++L+IG+FSQHHVDQL++NQ S+E L +K+PG   E YR +LGSFG+ GD+A++P+ SLSGGQKSRVAF +L+M NPNF ILDEPTN+LD+E+IEAL  AI K+ GGVV+V+HDERLIR     LWV     +  ++G FD+Y+K V
Sbjct:    5 ISVITEHFPLIEGELLQYVTSVLEGSQADFESNEDVYEAVGPVLSEVDQDKSEDEVQDICDKLFHML--KGDEDEKDSRKNGPHRILDAPVHLGKLVEDSADKDI-QEANIWIAKKADSTIVDQ---KKLEKAEAKLKQKQEKRSDQESVPRVISSDDLLQAASASQQTNRKDVKFDSSGANRSYDIRIDNFDISYGSLVLIKGASINMAFGRRYGLVGKNGKGKTTLLRMIASRQLKIASHITILHVEQEVVGDDTIAVDSVLQSDEKRESLLREEREITAKINSTSPNSTEDGLSTRLTEVYAQLEAMEAEKAPARAAMILSGLGFTPQMQRSTTKEFSGGWRMRLALARALFAKPDLLLLDEPTNMLDMKAIIWLENYLQTWPTTILVVSHDREFLNSVATDIMHLFSQEIDCYKGNFENFVKTRTEKIKNQRKEYEAQMQYREHVQVFIDKFRYNAKRASLVQSKIKLLEKLPVLKPVEKETDIVFRFPDVESLSPPILQLDEVDFYYTKEKIIFKNVCVSADMESRICVVGENGAGKTTLLKILLGDLSPTKGFRHIHRNLKIGYFSQHHVDQLDMNQCSVEVLASKYPGRNTEEYRHQLGSFGLSGDLAMQPVVSLSGGQKSRVAFALLAMGNPNFFILDEPTNHLDMETIEALGNAINKFKGGVVLVSHDERLIRMICKELWVCGKGTVKSLEGGFDEYKKIV 708          

HSP 2 Score: 63.5438 bits (153), Expect = 1.734e-6
Identity = 54/235 (22.98%), Postives = 100/235 (42.55%), Query Frame = 2
Query:  608 KMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGD--DTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARAC----LILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQ 1294
            K++ K+  +S  +  R   +G NG GKTT+LK              ILL      GD   TK    +     +       +++L+ N+ + +             + + K P R        L   G S ++ +      SGG + R+A A      P+  +LDEPTN LDM+ I  L   +  +K  +++VSHD++ +  +  ++       +++ +  + E+++    +L  Q
Sbjct:  514 KIIFKNVCVSADMESRICVVGENGAGKTTLLK--------------ILL------GDLSPTKGFRHIHRNLKIGYFSQHHVDQLDMNQCSVE-------------VLASKYPGRNTEEYRHQLGSFGLSGDLAMQPVVSLSGGQKSRVAFALLAMGNPNFFILDEPTNHLDMETIEALGNAINKFKGGVVLVSHDERLIRMICKELWVCGKGTVKSLEGGFDEYKKIVEAELAAQ 715          
BLAST of ATP-binding cassette sub-family F member 3-like vs. TrEMBL
Match: A0A336K328 (CSON012859 protein OS=Culicoides sonorensis OX=179676 GN=CSON012859 PE=4 SV=1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 349/695 (50.22%), Postives = 491/695 (70.65%), Query Frame = 2
Query:   68 IIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSE-EVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPENNREELVSGNKIMTDEEVRKN---LAEVEERMNKKMKKKQNGEIP-TLLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNA--NKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            +++  +P ++ EL  YV SIL   +D FE++ EI D+I GIL+E+   KSE E+  LC Q   L+           +L+ P+ +G +  +      EN  EE  S   +  D+ ++ +   L + + ++ +K +K+Q  ++P +  + QQ S +  +  K++ ++S G   + +  I NFD+SFG K+LL++A ++++ GRRYGF+GRNGLGKTT+L+ I++K L++P++++IL VEQEV+GDDT A+ SVLE DTVR  LL+  +E+N+  +  TAD S    + EIY  L  IE+DKAPARA +IL GLGF+ EMQ   TR+FSGGWRMRLALARALFS+PDLLLLDEPTNMLD+KAIIWLE YL+ W  +L+VVSHD+ FLD V TDIL+L +Q+IE +K NY +FE+ +  K  +Q +EYE+Q+ +R+HVQ FIDRFR  A++A  VQS+IKMLEKLP+L+PV KE++V  +FP    + + +LQ +E+ F Y   +T+   + +S    SRICIVGENGAGKTTLLKI +  LEP SGL+ TH++LR+ +F+QHHVD L++N +S+E LQ++FPG   E YR +LGSFG+ GD+AL+ + SLSGGQKSRVAF  + M+ PNFL+LDEPTN+LD+E+IEAL  AI  Y GGV++V+HDERLIR     LW+  +  +  IDG FD+YRK V
Sbjct:    7 LLKKSFPKIEGELQDYVSSILENGSDEFESSDEIYDAIGGILHEVATDKSENEIKSLCEQFLGLMQQTKVKSTGRKILDAPVNLGSMAGQ-----FENGDEEHKSIWVVSRDDSLKVDSKKLEKAKAKLEQKKEKRQEFKVPASAPVLQQASASQVISKKDNKLESKGNNRSMDIRIENFDVSFGEKVLLQNADLTLAYGRRYGFVGRNGLGKTTLLRMISSKHLQIPSHITILHVEQEVVGDDTIALESVLECDTVRHNLLQREKEINSLISSGTADPSLSAELSEIYVNLQNIEADKAPARASIILNGLGFNKEMQQRKTREFSGGWRMRLALARALFSKPDLLLLDEPTNMLDIKAIIWLENYLQNWPTTLLVVSHDRNFLDTVPTDILYLHSQRIETYKGNYEQFEKTKTEKHKSQRREYEAQLAHRQHVQEFIDRFRYNANRAASVQSKIKMLEKLPELKPVEKEVEVTLKFPEVEPINATMLQLNEVGFKYNDTKTIFNIVNLSANLESRICIVGENGAGKTTLLKIVMGMLEPTSGLMTTHRALRMAYFAQHHVDSLDMNVNSVELLQSEFPGKTVEEYRRQLGSFGVSGDLALQVVASLSGGQKSRVAFAKMCMQQPNFLVLDEPTNHLDIETIEALGHAINAYKGGVILVSHDERLIRMVCKELWICGEGTVRSIDGGFDEYRKIV 696          
BLAST of ATP-binding cassette sub-family F member 3-like vs. TrEMBL
Match: A0A1A8HSD7 (ATP-binding cassette, sub-family F (GCN20), member 3 OS=Nothobranchius kuhntae OX=321403 GN=ABCF3 PE=4 SV=1)

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 345/707 (48.80%), Postives = 491/707 (69.45%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDA-SKSEE-VYDLCCQIFKLLVSKTDDDRKP----ILLNNPICIGDI------VEKD--KVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNAN--KDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A  + I++ ++P +  EL  Y+  +L      FE + E+ D+I G+L ++ A SK+E+ + D+C Q+F  L       + P    +LL+ P+ +  +        KD   + + + ++   V   K+   E+    L    ER N++  +K +G     L+ ++ S +     K++ +D +G   + +  I NFD+SFG + LL+ A + ++ GRRYG IGRNGLGKTTMLK +A++ L++PA++SIL VEQEV GD+T A+ SVLE+DT+R  LL E   LNA     TA+G    R+ EIY KL+ IE+DKAPARA +IL GLGFSP MQ  +T++FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW+ +++VVSHD+ FL+AVATDI+ L +Q++++++ +Y  F + +  +L NQ +E+E+QMQYR+H+QVFIDRFR  A++A QVQS+IK+LEKLP+L+P+ KE +V   FP +  KL  PILQ DE+ F Y+ ++ +   L +S    SRICIVGENGAGKTT+LK+ + EL P SG+ + H++L+IG+FSQHHVDQL+LN  ++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M +PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDERLIR     LWV E  N+  IDG FD+YR
Sbjct:    2 AAYVDILKKEFPEIDAELFHYITGVLDSGGADFEDSEEVFDAIGGVLQDVSADSKNEDDIRDICLQMFNTLKLNNHHHQHPPQKQVLLDAPVQLSQMSAGSGSATKDVHGIWMIKRSQNTTVDAKKL---EKAEAKLKAKNERRNERESQKTSGP----LVLEEASASQASSKKDNRVDQSGKNRSYDIRIENFDISFGERCLLQGAELCLASGRRYGLIGRNGLGKTTMLKMLASRNLRVPAHISILHVEQEVAGDETMALQSVLESDTLREELLNEERRLNARIASGTAEGMESVRLSEIYAKLEEIEADKAPARASIILAGLGFSPRMQQQATKEFSGGWRMRLALARALFARPDLLLLDEPTNMLDIRAILWLENYLQTWQSTILVVSHDRNFLNAVATDIIHLHSQRLDSYRGDYENFLKTKEDRLKNQHREFEAQMQYRQHIQVFIDRFRYNANRAAQVQSKIKLLEKLPELKPIQKESEVSLRFPDNFEKLSPPILQLDEVEFYYSPDQPLFSGLNLSADLESRICIVGENGAGKTTVLKLLMDELTPVSGVRQAHRNLKIGYFSQHHVDQLDLNVCAVELLLHKFPGRTEEEYRHQLGGYGITGELAVRPVASLSGGQKSRVAFAQMTMPSPNFYILDEPTNHLDMETIEALAKALNKFKGGVILVSHDERLIRLVCKELWVCESGNVRRIDGGFDEYR 701          

HSP 2 Score: 64.6994 bits (156), Expect = 8.949e-7
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 2
Query:  956 LKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEE 1267
            L G G + E+ +      SGG + R+A A+     P+  +LDEPTN LDM+ I  L   L  +K  +I+VSHD++ +  V  ++    +  +      + E+ +
Sbjct:  599 LGGYGITGELAVRPVASLSGGQKSRVAFAQMTMPSPNFYILDEPTNHLDMETIEALAKALNKFKGGVILVSHDERLIRLVCKELWVCESGNVRRIDGGFDEYRD 702          
BLAST of ATP-binding cassette sub-family F member 3-like vs. TrEMBL
Match: A0A1A8R911 (ATP-binding cassette, sub-family F (GCN20), member 3 OS=Nothobranchius pienaari OX=704102 GN=ABCF3 PE=4 SV=1)

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 345/707 (48.80%), Postives = 492/707 (69.59%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDA-SKSEE-VYDLCCQIFKLLVSKTDDDRKP----ILLNNPICIGDI------VEKD--KVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNAN--KDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A  + I++ ++P +  EL  Y+  +L      FE + E+ D+I G+L ++ A SK+E+ + D+C Q+F  L       + P    +LL+ P+ +  +        KD   + + + ++   V   K+   E+    L    ER N++  +K +G     L+ ++ S +     K++ +D +G   + +  I NFD+SFG + LL+ A + ++ GRRYG IGRNGLGKTTMLK +A++ L++PA++SIL VEQEV GD+T A+ SVLE+DT+R  LL E   LNA     TA+G    R+ EIY KL+ IE+DKAPARA +IL GLGFSP MQ  +T++FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW+ +++VVSHD+ FL+AVATDI+ L +Q++++++ +Y  F +++  +L NQ +E+E+QMQYR+H+QVFIDRFR  A++A QVQS+IK+LEKLP+L+PV KE +V   FP +  KL  PILQ DE+ F Y+ ++ +   L +S    SRICIVGENGAGKTT+LK+ + EL P SG+ + H++L+IG+FSQHHVDQL+LN  ++E L  KFPG   E YR +LG +GI G++A+RP+ SLSGGQKSRVAF  ++M +PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDERLIR     LWV E  N+  +DG FD+YR
Sbjct:    2 AAYVDILKKEFPEIDAELFHYITGVLDSGGADFEDSEEVFDAIGGVLQDVSADSKNEDDIRDICLQMFNTLKLNNHHHQHPPQKQVLLDAPVQLSQMSAGSGSATKDVHGIWMIKRSQNTTVDAKKL---EKAEAKLKAKNERRNERESQKTSGP----LVLEEASASQASSKKDNRVDQSGKNRSYDIRIENFDISFGERCLLQGAELCLASGRRYGLIGRNGLGKTTMLKMLASRNLRVPAHISILHVEQEVAGDETMALQSVLESDTLREELLNEERRLNARIASGTAEGMESVRLSEIYAKLEEIEADKAPARASIILAGLGFSPRMQQQATKEFSGGWRMRLALARALFARPDLLLLDEPTNMLDIRAILWLENYLQTWQSTILVVSHDRNFLNAVATDIIHLHSQRLDSYRGDYENFLKSKEDRLKNQHREFEAQMQYRQHIQVFIDRFRYNANRAAQVQSKIKLLEKLPELKPVQKESEVSLRFPDNFEKLSPPILQLDEVEFYYSPDQPLFSGLNLSADLESRICIVGENGAGKTTVLKLLMDELTPVSGVRQAHRNLKIGYFSQHHVDQLDLNVCAVELLLHKFPGRTEEEYRHQLGGYGITGELAVRPVASLSGGQKSRVAFAQMTMPSPNFYILDEPTNHLDMETIEALAKALNKFKGGVILVSHDERLIRLVCKELWVCESGNVRRVDGGFDEYR 701          

HSP 2 Score: 64.3142 bits (155), Expect = 1.044e-6
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 2
Query:  956 LKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEE 1267
            L G G + E+ +      SGG + R+A A+     P+  +LDEPTN LDM+ I  L   L  +K  +I+VSHD++ +  V  ++    +  +      + E+ +
Sbjct:  599 LGGYGITGELAVRPVASLSGGQKSRVAFAQMTMPSPNFYILDEPTNHLDMETIEALAKALNKFKGGVILVSHDERLIRLVCKELWVCESGNVRRVDGGFDEYRD 702          
BLAST of ATP-binding cassette sub-family F member 3-like vs. TrEMBL
Match: U5EXM4 (Putative transporter abc superfamily (Fragment) OS=Corethrella appendiculata OX=1370023 PE=2 SV=1)

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 349/721 (48.40%), Postives = 487/721 (67.55%), Query Frame = 2
Query:   68 IIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEEVYDLCCQIFKLL-----------VSKTDDDRKPILLNNPICIGDIVEKDKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLIS-----QQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRT----RXXXXXXXXNANK-DTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVA 2164
            +++ ++P +  EL  YVE IL+  AD FE + EI ++I  IL+EI     +++ +LC +   ++            +   +     +LN P+ + D+      I+  +N + +    +  + +   K L + E +  +K++K+Q  EI T L +     Q  S +  +  K++ ++S GT  + +  I NFD+SFG ++LL++A + ++ GRRYG +GRNGLGKTT+L+ I+ K+L++P+++S+L VEQEV+GD T A++SVLE DTVRT    R  +  + +N+   D    + + EIYQ L LIE+DKAPARA +IL GLGFS EMQ  +T+ FSGGWRMRLALARALFS+PDLLLLDEPTNMLD+KAIIWLE YL+ W  +L+VVSHD+ FLD+V TDIL+L +Q+IE F+ NY +F++ R  K   Q +EYE+QM YR HVQ FIDRFR  A++A  VQS+IKM+EKLP+L+PV KE++VV +FP    L  P+L   E+ F Y  E+ +   + +S    SRICIVGENGAGKTTLLKI +  L+P SGL+  H+ LRIG+FSQHHVDQL +N +S+E LQ  FPG   E YR +LGSFG+ GD+AL+ + SLSGGQKSRVAF  + M+ PNFL+LDEPTN+LD+E+IEAL  AI K+ GGV++V+HDERLIR     LWV  +  +  IDG FD+YRK     +  E+S  +A A
Sbjct:    5 MLKQEFPKIDAELQKYVEDILVGGADDFEDSEEIYEAIAPILHEISEKTEDDIKELCLRFLHVMKPNLISSSSSTATAATNKSGLTILNAPVHLKDMTSNSIDIV--DNIQSIWIATRDDSLKVDSKKLEKAEAKRQQKLEKRQ--EIKTNLAAAPPVLQTASASQVISKKDNKLESKGTNRSMDIRIENFDVSFGDRVLLQNADLILANGRRYGLVGRNGLGKTTLLRMISCKQLQIPSHISVLHVEQEVVGDGTLALDSVLECDTVRTTLLNREKELTQLINSGTLDAKLNTELSEIYQHLQLIEADKAPARASIILNGLGFSKEMQARATQTFSGGWRMRLALARALFSKPDLLLLDEPTNMLDIKAIIWLENYLQNWPTTLLVVSHDRNFLDSVPTDILYLHSQRIEAFRGNYEQFDKTRTEKYKAQRREYEAQMAYRSHVQEFIDRFRYNANRAASVQSKIKMMEKLPELKPVEKEVEVVLKFPDVEPLNPPVLTLSEVGFKYNPEKVIFTTVNLSASLDSRICIVGENGAGKTTLLKIVVTLLDPTSGLMHAHRGLRIGYFSQHHVDQLEMNVNSVELLQHAFPGKTVEEYRRQLGSFGVSGDLALQVVASLSGGQKSRVAFAKMCMRRPNFLVLDEPTNHLDIETIEALGKAINKFVGGVILVSHDERLIRLICKELWVCGNGTVKSIDGGFDEYRK----IIERELSEAAAAA 717          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Cavefish
Match: abcf3 (ATP binding cassette subfamily F member 3 [Source:NCBI gene;Acc:103024060])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 343/698 (49.14%), Postives = 491/698 (70.34%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEE-VYDLCCQIFKLL-VSKTDDDRKPILLNNPICIGDIVEKDKVILPENNREE--LVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPT-LLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNAN--KDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A  + I+++++P +  E+  Y+  +L      FE   E+ ++I G+L E+ A K+E+ V D+C Q+F  L +S  + + + +LL+ P+ +  I   D      N+ +   +V  N+  T +  +   AE + R   + + +++ + P+  L+ ++ S +     KE  +D +G   + +  I NFD+SFG + LL+ A + ++ GRRYG +GRNGLGKTT+LK +A++ L++PA++SIL VEQEV GDDT A+ SVLE+DTVR  LL E  +LNA+    TADGS   R+ EIY +L+ IE+DKAPARA +IL GLGFSP+MQ  +T++FSGGWRMRLALARALF++PDLLLLDEPTNMLD++AI+WLE YL+TW+ +++VVSHD+ FL+AVATDI+ L  Q++++++ +Y  F + +  +L NQ +EYE+Q+QYREH+QVFIDRFR  A++A QVQS++K+LEKLP+L+P+ KE  VV  FP +  KL  PILQ DE+ F Y+ +  +   L +S    SRICIVGENGAGK+TLLK+ + +L P SG    H++L+IG+FSQHHVDQL+LN  S+E L +KFPG   E YR +LG +GI G++A RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL  ++  + GGVV+V+HDERLIR     LWV E   ++ IDG FD+Y+
Sbjct:    2 ATYVDILKSEFPEIDTEVFDYITGVLDSGGSDFEDGEEVFEAIGGVLQEVAAEKNEDDVRDICLQLFNTLKLSNCNSNPRQVLLDAPVQLSQI-SVDSAGSATNDVQGIWMVKRNQSTTVDAKKLEKAEAKLRAKHERRNEKDSQKPSNPLVLEEASASQASSKKESRVDMSGKNRSYDIRIENFDVSFGERSLLQGAELCLASGRRYGLVGRNGLGKTTLLKMLASRSLRVPAHISILHVEQEVAGDDTPALQSVLESDTVREELLTEERKLNAHIANGTADGSESVRLSEIYARLEEIEADKAPARASVILAGLGFSPKMQQQTTKEFSGGWRMRLALARALFAKPDLLLLDEPTNMLDVRAILWLENYLQTWQSTILVVSHDRNFLNAVATDIIHLHTQRLDSYRGDYENFIKTKEDRLKNQQREYEAQLQYREHIQVFIDRFRYNANRAAQVQSKLKLLEKLPELKPIDKESVVVLCFPDNFEKLSPPILQLDEVEFSYSPDIHLFTGLCVSADLESRICIVGENGAGKSTLLKLLMGDLTPISGTRHAHRNLKIGYFSQHHVDQLDLNVCSVELLLSKFPGLTEEEYRRQLGRYGISGELATRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALAKSLNTFKGGVVLVSHDERLIRLVCKELWVCEAGRVHRIDGGFDEYK 698          

HSP 2 Score: 63.5438 bits (153), Expect = 6.947e-10
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  968 GFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEE 1267
            G S E+        SGG + R+A A+     P+  +LDEPTN LDM+ I  L   L T+K  +++VSHD++ +  V  ++      ++      + E+++
Sbjct:  600 GISGELATRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALAKSLNTFKGGVVLVSHDERLIRLVCKELWVCEAGRVHRIDGGFDEYKD 699          

HSP 3 Score: 55.0694 bits (131), Expect = 2.810e-7
Identity = 56/246 (22.76%), Postives = 96/246 (39.02%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRI-GFFSQHHVDQLNLN------QSSLE------------------FLQTKFPGSE-------------------PEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   ER++++   + + S  R  +VG NG GKTTLLK+               +SLR+    S  HV+Q          QS LE                         GSE                   P      L   G    +  +  +  SGG + R+A        P+ L+LDEPTN LD+ +I  L   ++ +   +++V+HD   +      +  +  + ++   G+++++ K
Sbjct:  186 DVSFG---ERSLLQGAELCLASGRRYGLVGRNGLGKTTLLKML------------ASRSLRVPAHISILHVEQEVAGDDTPALQSVLESDTVREELLTEERKLNAHIANGTADGSESVRLSEIYARLEEIEADKAPARASVILAGLGFSPKMQQQTTKEFSGGWRMRLALARALFAKPDLLLLDEPTNMLDVRAILWLENYLQTWQSTILVVSHDRNFLNAVATDIIHLHTQRLDSYRGDYENFIK 416          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Cavefish
Match: abcf3 (ATP binding cassette subfamily F member 3 [Source:NCBI gene;Acc:103024060])

HSP 1 Score: 511.146 bits (1315), Expect = 1.785e-171
Identity = 303/682 (44.43%), Postives = 436/682 (63.93%), Query Frame = 2
Query:   98 DELLSYVESILIENADT-FETASEIQDSIEGILNEIDASKSEE-VYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDI-VEKDKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPT-LLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNAN--KDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            +EL+ +  S L+++  + FE   E+ ++I G+L E+ A K+E+ V D+C Q+F  L        K +LL+ P+ +  I V+  K I+  +     +   ++ T +  +   AE + R   + + +++ + P+  L+ ++ S +     KE  +D +G   + +  I NFD+SFG + LL+ A + ++ GRRYG +GRNGLGKTT+LK +A++ L++PA++SIL VEQEV GDDT A+ SVLE+DTVR  LL E  +LNA+    TADGS   R+ EIY +L+ IE+DKAPAR                                       PDLLLLDEPTNMLD++AI+WLE YL+TW+ +++VVSHD+ FL+AVATDI+ L  Q++++++ +Y  F + +  +L NQ +EYE+Q+QYREH+QVFIDRFR  A++A QVQS++K+LEKLP+L+P+ KE  VV  FP +  KL  PILQ DE+ F Y+ +  +   L +S    SRICIVGENGAGK+TLLK+ + +L P SG    H++L+IG+FSQHHVDQL+LN  S+E L +KFPG   E YR +LG +GI G++A RP+ SLSGGQKSRVAF  ++M  PNF ILDEPTN+LD+E+IEAL   +   +           LIR     LWV E   ++ IDG FD+Y+
Sbjct:   17 NELIYFTFSKLLDSGGSDFEDGEEVFEAIGGVLQEVAAEKNEDDVRDICLQLFNTL--------KQVLLDAPVQLSQISVDSGKSIIQSS-----LFFIQVFTVDAKKLEKAEAKLRAKHERRNEKDSQKPSNPLVLEEASASQASSKKESRVDMSGKNRSYDIRIENFDVSFGERSLLQGAELCLASGRRYGLVGRNGLGKTTLLKMLASRSLRVPAHISILHVEQEVAGDDTPALQSVLESDTVREELLTEERKLNAHIANGTADGSESVRLSEIYARLEEIEADKAPAR---------------------------------------PDLLLLDEPTNMLDVRAILWLENYLQTWQSTILVVSHDRNFLNAVATDIIHLHTQRLDSYRGDYENFIKTKEDRLKNQQREYEAQLQYREHIQVFIDRFRYNANRAAQVQSKLKLLEKLPELKPIDKESVVVLCFPDNFEKLSPPILQLDEVEFSYSPDIHLFTGLCVSADLESRICIVGENGAGKSTLLKLLMGDLTPISGTRHAHRNLKIGYFSQHHVDQLDLNVCSVELLLSKFPGLTEEEYRRQLGRYGISGELATRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALRGLLNTME-----------LIRLVCKELWVCEAGRVHRIDGGFDEYK 635          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Cavefish
Match: abcf1 (ATP binding cassette subfamily F member 1 [Source:NCBI gene;Acc:103030134])

HSP 1 Score: 414.075 bits (1063), Expect = 5.448e-131
Identity = 241/542 (44.46%), Postives = 340/542 (62.73%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXX-XNANKDTADG--SRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKML----------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKF--PGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEIS 2146
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK I+ + L +P N+ +LL EQEVI DDT A+ +VL+ADT R +LL+E ++  N  +   DG   R+ ++Y++L  I +  A A+A  IL GL F+PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL+ WKK+L++VSHDQ FLD V TDI+ L NQK+  ++ NY  F++    K    LK+YE Q +  + ++      +    +  +  +R +             + P+L    KE  V F FP+ P L  PIL    + FGY  ++ + KN+   +   SRICIVG NG GK+TLL +   +L P  G +R +  L++GFF+Q + DQL + ++  E+LQ  F  P  +    R  LG FG+        I  LSGGQK+RV F  LS + P+ LILDEPTNNLD+ESI+AL  AI +Y G V+IV+HD RLI +T C LWVVED+ +N+IDG+F+DY++EVL AL E ++
Sbjct:  361 SDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHISNRALSIPPNIDVLLCEQEVIADDTPAVQAVLKADTRRLKLLEEEKQLQNRLEKGEDGVSERLEKVYEELRAIGAAAAEAKARRILAGLSFTPEMQNRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWKKTLLIVSHDQSFLDDVCTDIIHLDNQKLYYYRGNYLTFKKMYVQKQKELLKQYEKQEKKLKDLKAGGKSTKQAEKQTKEALTRKQQKGKKKGQEEESHEAPELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFGYEGQKPLFKNVDFGIDMESRICIVGPNGVGKSTLLLLLTGKLTPTKGEMRKNHRLKVGFFNQQYADQLIMEEAPTEYLQRNFNLPYQD---SRKCLGRFGLESHAHTIQISKLSGGQKARVVFAELSCRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCHLWVVEDQTVNQIDGDFEDYKREVLEALGETLA 899          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Cavefish
Match: abcf2b (ATP-binding cassette sub-family F member 2 [Source:NCBI gene;Acc:103022164])

HSP 1 Score: 385.956 bits (990), Expect = 1.406e-123
Identity = 205/524 (39.12%), Postives = 328/524 (62.60%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI  +E+ +P ++ I  + +E+   +  A+  V+E D  + R+  E E      + ++  ++ EIY++L+ +++DKA  RA  IL GLGF+P MQ    + FSGGWRMR++LARALF +P +LLLDEPTN LD+ A +WLE  LK++K+ L+++SH Q FL+ + T+I+ L  +K++ +  NY ++ + R     NQ+K Y  +     H++ +I RF   ++K A Q QS+ K L+K+        VV +  + F FP C K+P P++    + F Y+++   I KNL   +   +R+ +VG NGAGK+TLLK+ + EL P  G++R H  ++IG + QH  +QL L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI  ++GG+++V+HD RLI+Q    +WV E + I + +G+   Y++ +
Sbjct:   82 TDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSEKTALECVMEVD--KERIELEKEAERLAHEDSECEKLMEIYERLEELDADKAQVRASRILYGLGFTPAMQRKKLKDFSGGWRMRVSLARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGICTNIIHLHQRKLKYYTGNYDQYVKTRLEVEENQMKRYNWEQDQISHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTSRVVSDKTLSFYFPPCGKIPPPVIMVQNVSFRYSEDTPCIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNGDILAYKEHL 603          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Cavefish
Match: abcf2a (ATP-binding cassette sub-family F member 2 [Source:NCBI gene;Acc:103039473])

HSP 1 Score: 374.015 bits (959), Expect = 4.617e-119
Identity = 207/524 (39.50%), Postives = 330/524 (62.98%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI  +E+ +P ++ I  + +E+   +  A+  V+E D  R +L KE+E L A++D+ +  ++ ++Y++L+ +++ KA  RA  IL GLGF+  MQ    + FSGGWRMR+ALARALF +P +LLLDEPTN LD+ A +WLE  LK +K+ L+++SH Q FL+ V T+I+ L  +K++ +  NY ++ + R     NQ+K +  +     H++ +I RF   ++K A Q QS+ K L+K+      E VV +  + F FP C K+P P++    + F Y+ E  +I K+L   +   +R+ +VG NGAGK+TLLK+   EL P  G++R H  ++IG + QH  +QL L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI +++GG+++V+HD RLI+Q    +WV E + I +   +   Y++ +
Sbjct:   80 TDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGYREVPIPEHIDIYHLTREMPPSEKTALQCVMEVDDERIQLEKEVERL-AHEDS-ECEKLMDLYERLEELDAAKAEVRASRILHGLGFTAAMQKKKLKDFSGGWRMRVALARALFLKPFMLLLDEPTNHLDLDACVWLEEELKQFKRILVLISHSQDFLNGVCTNIINLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERVVNDKTLSFYFPPCGKIPPPVIMVQNVSFRYSDETPIIYKSLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINEFEGGLMLVSHDFRLIQQVAQEIWVCEKQTITKWKKDILAYKEHL 601          

HSP 2 Score: 61.6178 bits (148), Expect = 2.767e-9
Identity = 57/234 (24.36%), Postives = 101/234 (43.16%), Query Frame = 2
Query:  584 NFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKL 1285
            +F  S  + ++ K     I +  R   +G NG GK+T+LK +  +   +P +  I       IG   + +   LE D      + +                PEI +K ++ +          I+   G + + Q+   R  S G + R+  A   +  P +L LDEPTN LD++ I  L   +  ++  L++VSHD + +  VA +I     Q I  +K +   ++E  + K+
Sbjct:  398 SFRYSDETPIIYKSLEFGIDLDTRVALVGPNGAGKSTLLKLLTGE--LLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKC--------------YPEIKEKEEMRK----------IIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINEFEGGLMLVSHDFRLIQQVAQEIWVCEKQTITKWKKDILAYKEHLKSKI 605          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Sea Lamprey
Match: abcf2a (ATP-binding cassette, sub-family F (GCN20), member 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8714])

HSP 1 Score: 390.193 bits (1001), Expect = 6.236e-126
Identity = 215/520 (41.35%), Postives = 329/520 (63.27%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            I N  ++F  + LL D  + ++ GRRYG IG NG GK+ +L  I T+EL +P ++ I  + +E+   D  A+  V+E DT R  L KE E L A++D+ +  ++ EIY++L+ +++ KA  RA  IL GLGFSP MQ    + FSGGWRMR+AL+RALF +P +LLLDEPTN LD+ A +WLE  LKT+K+ LIV+SH Q FL+ V T+I+ L N+K++ F  NY ++ + R     +Q+K++  +     H++ +I RF   ++K A Q QS+ K L+K+      E +V +  + F FP+C K+P P++    + F YT++  +I K L   +   SR+ +VG NGAGK+TLLK+   EL P  G++R H  ++IG + QH  +QL+L+ S L+++   +P   E E  R  +G +G+ G   + PI+SLS GQK RV F  L+ + P+ L LDEPTN+LD+E+I+AL  AI +++GG+++V+HD RLI+Q    +WV E   I +  G    Y++ +
Sbjct:   80 IINMSLTFHGQELLSDTQLELNSGRRYGLIGLNGTGKSMLLSTIGTRELPIPEHIDIYHLTREMAPSDKTALQCVMEVDTERIVLEKEAERL-AHEDS-ESEKLMEIYERLEELDASKAEMRAARILHGLGFSPAMQRKKMKDFSGGWRMRVALSRALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILIVISHSQDFLNGVCTNIIHLHNRKLKVFTGNYDQYVKTRLELEDHQMKKFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERIVNDKTLSFFFPACGKIPPPVIMVQHVSFKYTEDGPLIYKALEFGIDLDSRVALVGPNGAGKSTLLKLLAGELLPTDGMIRKHSHVKIGRYHQHLTEQLDLDLSPLDYMMKCYPDVKEKEDMRKIIGRYGLTGKQQVSPIRSLSDGQKCRVCFAWLAWQTPHMLFLDEPTNHLDMETIDALAEAINEFEGGMMLVSHDFRLIQQVAQEIWVCEHATITKWKGGIQAYKEHL 597          

HSP 2 Score: 61.6178 bits (148), Expect = 5.395e-10
Identity = 33/113 (29.20%), Postives = 58/113 (51.33%), Query Frame = 2
Query:  953 ILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVN 1291
            I+   G + + Q+   R  S G + R+  A   +  P +L LDEPTN LDM+ I  L   +  ++  +++VSHD + +  VA +I    +  I  +K     ++E  + K+V+
Sbjct:  491 IIGRYGLTGKQQVSPIRSLSDGQKCRVCFAWLAWQTPHMLFLDEPTNHLDMETIDALAEAINEFEGGMMLVSHDFRLIQQVAQEIWVCEHATITKWKGGIQAYKEHLKNKVVD 603          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007174.1 (pep scaffold:Pmarinus_7.0:GL490431:841:5388:1 gene:ENSPMAG00000006481.1 transcript:ENSPMAT00000007174.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 8.280e-48
Identity = 91/188 (48.40%), Postives = 127/188 (67.55%), Query Frame = 2
Query:  764 EVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWL-EMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQ 1315
            EV+ D T A+ +VL AD  R  LL+E  +L A  ++ D   G R+ ++ ++L  + +D A A+A  IL GLGF+PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL + YL TW+K+L++VSHDQ FLD V TDI+ L  QK+  ++ NY  F++    K     K Y+ Q
Sbjct:    1 EVVADSTPAVQAVLRADVRRGVLLQEESKLQARLESGDDSVGPRLEKVIEELRAMGADAAEAKARRILAGLGFTPEMQGRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNKYYLLTWRKTLLIVSHDQSFLDDVCTDIIHLDYQKLFYYRGNYLTFKKMYVQKQKELQKLYDKQ 188          

HSP 2 Score: 49.6766 bits (117), Expect = 5.945e-7
Identity = 26/82 (31.71%), Postives = 42/82 (51.22%), Query Frame = 2
Query: 1802 LGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKY-----DGGVVIVTHDERLI 2032
            L   G   ++  RP +  SGG + RV+        P  L+LDEPTN+LDL ++    + + KY        ++IV+HD+  +
Sbjct:   68 LAGLGFTPEMQGRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAV----IWLNKYYLLTWRKTLLIVSHDQSFL 145          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007172.1 (pep scaffold:Pmarinus_7.0:GL490431:841:5397:1 gene:ENSPMAG00000006481.1 transcript:ENSPMAT00000007172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 5.147e-47
Identity = 89/188 (47.34%), Postives = 127/188 (67.55%), Query Frame = 2
Query:  764 EVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTAD---GSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWL-EMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQ 1315
            EV+ D T A+ +VL AD  R  LL+E  +L A  ++ D   G R+ ++ ++L  + +D A A+A  IL GLGF+PEMQ   T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL + ++ TW+K+L++VSHDQ FLD V TDI+ L  QK+  ++ NY  F++    K     K Y+ Q
Sbjct:    1 EVVADSTPAVQAVLRADVRRGVLLQEESKLQARLESGDDSVGPRLEKVIEELRAMGADAAEAKARRILAGLGFTPEMQGRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNKFFMLTWRKTLLIVSHDQSFLDDVCTDIIHLDYQKLFYYRGNYLTFKKMYVQKQKELQKLYDKQ 188          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009626.1 (pep scaffold:Pmarinus_7.0:GL487706:825:5638:1 gene:ENSPMAG00000008701.1 transcript:ENSPMAT00000009626.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 4.661e-41
Identity = 77/171 (45.03%), Postives = 109/171 (63.74%), Query Frame = 2
Query: 1661 GLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKF--PGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAA 2167
            G  R +  L+IGFF+Q + DQL + +++ E+LQ  F  P  E    R RLG FG+        I  LS G +       L+++     I DEPTNNLD+ESI+AL  AI +Y GGVVIV+HD RLI +TNC LWVVE+  +N+++G+F+DY++EVL +L E+I   ++V A
Sbjct:    2 GERRKNHRLKIGFFNQQYADQLAMEETATEYLQRCFNLPYQEA---RKRLGRFGLESHAHTIQINKLSAGVEWHRHSAGLTIRRLQVHIQDEPTNNLDIESIDALGEAINQYKGGVVIVSHDARLITETNCQLWVVEESTVNQVEGDFEDYKREVLESLGEKIIATASVTA 169          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005077.1 (pep scaffold:Pmarinus_7.0:GL479589:38272:41290:-1 gene:ENSPMAG00000004621.1 transcript:ENSPMAT00000005077.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 3.107e-32
Identity = 53/93 (56.99%), Postives = 73/93 (78.49%), Query Frame = 2
Query: 1835 LRPIQSLSGGQKSRVAFTILSM-KNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            +RP+ SLSGGQKSRVAF  +++  +PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDERLIR     LWV E++ +  +DG FD+Y+
Sbjct:    1 VRPVASLSGGQKSRVAFAQMTICPSPNFYILDEPTNHLDMETIEALGCALNKFKGGVILVSHDERLIRTVCRELWVCEERGVRRVDGGFDEYK 93          

HSP 2 Score: 55.8398 bits (133), Expect = 5.433e-10
Identity = 27/88 (30.68%), Postives = 47/88 (53.41%), Query Frame = 2
Query: 1007 FSGGWRMRLALAR-ALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEE 1267
             SGG + R+A A+  +   P+  +LDEPTN LDM+ I  L   L  +K  +I+VSHD++ +  V  ++     + +      + E++ 
Sbjct:    7 LSGGQKSRVAFAQMTICPSPNFYILDEPTNHLDMETIEALGCALNKFKGGVILVSHDERLIRTVCRELWVCEERGVRRVDGGFDEYKH 94          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Yeast
Match: GCN20 (Positive regulator of the Gcn2p kinase activity; forms a complex with Gcn1p; proposed to stimulate Gcn2p activation by an uncharged tRNA [Source:SGD;Acc:S000001905])

HSP 1 Score: 490.345 bits (1261), Expect = 5.632e-163
Identity = 271/642 (42.21%), Postives = 396/642 (61.68%), Query Frame = 2
Query:  377 SGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKED-----------GIDSNGTVLTNFVISNFDMSFG-SKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSR-----------------------IPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKI-----ENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAAGVM 2182
            +G K+ T  +++K LA+ E+++ KK+ K+ N       +  + SK IN   +ED              S+     +  I  FD+  G  + +L +A +++S G RYG +G+NG+GK+T+L+A++ +EL +P +VSIL VEQE+ GDDTKA+ SVL+AD  R +LL E  ++N      D  R                       + +I  KL  +ESDKA ARA  IL GLGFS E Q   T  FSGGWRMRL+LARALF QPDLLLLDEP+NMLD+ +I +L  YLKT+  +++ VSHD+ FL+ VATDI++  N+++     ++F   Y+  EE R+    N  +EY++QM YR+H+Q FID++R  A+K+ + QSRIK LEKLP LEP  ++  + F+FP C KL  PI+Q  ++ FGY +   ++K++ + V   SRI +VG NG GKTTLLKI +++L P  G +  +  LRIG+F+QHHVD ++L  S+++++   FPG   E YR  LGSFGI G + L+ +Q LSGGQKSRVAF  L + NP+ L+LDEP+N+LD   ++AL  A++ ++GGV++V+HD  +I      +WV E   +   +G   DYR  +L +           A AAGV+
Sbjct:  129 TGRKMETRVDLKK-LAKAEQKIAKKVAKRNNK-----FVKYEASKLINDQKEEDYDSFFLQINPLEFGSSAGKSKDIHIDTFDLYVGDGQRILSNAQLTLSFGHRYGLVGQNGIGKSTLLRALSRRELNVPKHVSILHVEQELRGDDTKALQSVLDADVWRKQLLSEEAKINERLKEMDVLRQEFEEDSLEVKKLDNEREDLDNHLIQISDKLVDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTYPNTVLTVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYTTKEERRK----NAQREYDNQMVYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEQDKTIDFKFPECDKLSPPIIQLQDVSFGYDENNLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLRIGYFTQHHVDSMDLTTSAVDWMSKSFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVEALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTIYDYRDYILQS-----------ADAAGVV 749          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Yeast
Match: ARB1 (ATPase of the ATP-binding cassette (ABC) family; involved in 40S and 60S ribosome biogenesis, has similarity to Gcn20p; shuttles from nucleus to cytoplasm, physically interacts with Tif6p, Lsg1p; human homolog ABCF2 can complement yeast ARB1 mutant [Source:SGD;Acc:S000000838])

HSP 1 Score: 394.43 bits (1012), Expect = 9.257e-128
Identity = 198/521 (38.00%), Postives = 329/521 (63.15%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGY--TKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFP--GSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            +S+  + F  K+L++D+ + ++ GRRYG +G NG GK+T LKA+AT+E  +P ++ I L+++     +  A++ V+       + +++L E    +D  +   +  +Y+++D ++ D   +RA +IL GLGF+ +  L  T+  SGGW+MR+ALA+ALF +P LLLLD+PT  LD++A +WLE YLK + ++L++VSH Q FL+ V T+++ +  QK+  +  NY  + + R     NQ+K+Y  Q +  +H++ FI    TYA+   Q +SR K+L+K+     ++PVV +    F FP   +LP P+L  D++ F Y       + ++L   V   SRI +VG NG GK+TLLKI   EL PQSG +  H  +++G +SQH  DQL+L +S+LEF++ K+     + +++RG+LG +G+ G+     + +LS GQ+SRV F +L+++ PN L+LDEPTN LD+ +I++L  AI +++GGVV+V+HD RL+ +    ++VVE+K     DG    Y+ ++
Sbjct:   84 LSSVSLLFHGKVLIQDSGLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHELKRIEDLVEKTILEDGPESELLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLVSHSQDFLNGVCTNMIDMRAQKLTAYGGNYDSYHKTRSELETNQMKQYNKQQEEIQHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLVQPVVPDKVFSFRFPQVERLPPPVLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVVENKTATRWDGSILQYKNKL 604          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Yeast
Match: NEW1 (ATP binding cassette protein; cosediments with polysomes and is required for biogenesis of the small ribosomal subunit; Asn/Gln-rich rich region supports [NU+] prion formation and susceptibility to [PSI+] prion induction [Source:SGD;Acc:S000006147])

HSP 1 Score: 168.318 bits (425), Expect = 2.380e-43
Identity = 123/433 (28.41%), Postives = 205/433 (47.34%), Query Frame = 2
Query:  488 LISQQFSKNIN--LYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYL-KTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEF-EEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLN--QSSLEFLQTKF 1768
             + Q F  N+    Y +++  D +  +    V ++F +++GS+MLL   ++ +  G RYG  GRNG GK+T+++AIA  +L                       +   + DT+RT       E     +  D   +  I    +L  + +    A L  + +GF  E +  +    SGGW+M+L LARA+  + D+LLLDEPTN LD+  + WLE YL +    + ++VSHD  FLD V TDI+   N+K+  +K N + F E+    K    L +  +QM++                  T V+S  + + K+           V F +P   K PS                  + ++  S+   SR+  +G NGAGK+TL+K+   EL P  G +  H +LRIG+ +QH +  +N +  +++ ++LQ ++
Sbjct:  544 FVKQDFIHNLRALFYQEKERADEDEGI--EIVNTDFSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQL-----------------------DGFPDKDTLRT----CFVEHKLQGEEGDLDLVSFIALDEELQSTSREEIAAAL--ESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDSNAQMRFPP------------PGILTGVKSNTRAVAKM---------TDVTFSYPGAQK-PS------------------LSHVSCSLSLSSRVACLGPNGAGKSTLIKLLTGELVPNEGKVEKHPNLRIGYIAQHALQHVNEHKEKTANQYLQWRY 905          

HSP 2 Score: 72.0182 bits (175), Expect = 2.439e-13
Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 2
Query: 1841 PIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVED 2068
            P+ SLSGGQ  +V        NP+ L+LDEPTN LD +S+ AL VAI  + GGVV+++H+   +       W+VE+
Sbjct: 1029 PLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVEN 1104          

HSP 3 Score: 58.151 bits (139), Expect = 4.340e-9
Identity = 45/173 (26.01%), Postives = 89/173 (51.45%), Query Frame = 2
Query: 1007 FSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKI---ENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYAS-KATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPK-LPSPILQADE 1510
             SGG  +++ +A A+++ P LL+LDEPTN LD  ++  L + ++ W   ++++SH+ +F+ A+  +   + N K+    + + + S+FE+      V         ++     +  +D   + A+ K  Q + R+   EK  KL+   + ++ + E+ S PK  P P+   DE
Sbjct: 1033 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVENGKMVQKGSAQVDQSKFEDGGNADAVG--------LKASNLAKPSVDDDDSPANIKVKQRKKRLTRNEK--KLQAERRRLRYI-EWLSSPKGTPKPVDTDDE 1194          

HSP 4 Score: 53.5286 bits (127), Expect = 1.268e-7
Identity = 48/163 (29.45%), Postives = 81/163 (49.69%), Query Frame = 2
Query: 1580 RICIVGENGAGKTTLLK-IFLKELE--PQSGLLRTHKSLRIGFFSQHHV--DQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEAL-CVAIEKYDGGVVIVTHDERLIRQTNCS 2050
            R  + G NGAGK+TL++ I   +L+  P    LRT        F +H +  ++ +L+  S   L  +   +  E     L S G   +   + + SLSGG K ++      ++  + L+LDEPTN+LD+ +++ L    +E  D   +IV+HD   +  T C+
Sbjct:  599 RYGLCGRNGAGKSTLMRAIANGQLDGFPDKDTLRT-------CFVEHKLQGEEGDLDLVSFIALDEELQSTSREEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEHTDITSLIVSHDSGFL-DTVCT 753          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Yeast
Match: HEF3 (Translational elongation factor EF-3; member of the ABC superfamily; stimulates EF-1 alpha-dependent binding of aminoacyl-tRNA by the ribosome; normally expressed in zinc deficient cells; HEF3 has a paralog, YEF3, that arose from the whole genome duplication [Source:SGD;Acc:S000004959])

HSP 1 Score: 166.777 bits (421), Expect = 7.246e-43
Identity = 129/430 (30.00%), Postives = 199/430 (46.28%), Query Frame = 2
Query:  518 NLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELK-MPAN--VSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYE---SQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQH---HVDQLNLNQSSLEFLQTKFPGSE 1780
            N  D+ED     G  L N     F +++G+K+LL    + +  GRRYG  G NG GK+T++++IA  ++   P       + VE ++  D+T +  SVL+               + N  T D            +I S          LK  GFS EM  M     SGGW+M+LALARA+    D+LLLDEPTN LD   + WL  YL T   + ++VSHD  FLD V   I+     K+  +K N SEF +    K       YE   S ++++     +++  +T                   K + +VK   + F++P                 G TK +  + ++       SRI ++G NGAGK+TL+ +   EL P SG + TH++ RI +  QH   H++  +L+++  E++Q +F   E
Sbjct:  420 NFQDEED----EGEDLCN---CEFSLAYGAKILLNKTQLRLKRGRRYGLCGPNGAGKSTLMRSIANGQVDGFPTQDECRTVYVEHDI--DNTHSDMSVLD------------FVYSGNVGTKD------------VITSK---------LKEFGFSDEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDTVNVEWLVNYLNTCGITSVIVSHDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVQ----KCPTAQSYYELGASDLEFQFPTPGYLEGVKT-------------------KQKAIVKVSNMTFQYP-----------------GTTKPQ--VSDVTFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTHENCRIAYIKQHAFAHIES-HLDKTPSEYIQWRFQTGE 764          

HSP 2 Score: 70.4774 bits (171), Expect = 8.282e-13
Identity = 47/147 (31.97%), Postives = 76/147 (51.70%), Query Frame = 2
Query: 1580 RICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHD 2020
            R  + G NGAGK+TL++        Q     T    R   + +H +D  + + S L+F+ +   G++ +    +L  FG   ++   PI SLSGG K ++A     +K+ + L+LDEPTN+LD  ++E L   +       VIV+HD
Sbjct:  458 RYGLCGPNGAGKSTLMRSIANG---QVDGFPTQDECRT-VYVEHDIDNTHSDMSVLDFVYSGNVGTK-DVITSKLKEFGFSDEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDTVNVEWLVNYLNTCGITSVIVSHD 599          

HSP 3 Score: 70.4774 bits (171), Expect = 8.282e-13
Identity = 29/75 (38.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1844 IQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVED 2068
            I+ LSGGQK ++     + + P+ ++LDEPTN LD +S+ AL  A++ ++GGV+I+TH     +     +W V+D
Sbjct:  894 IRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKNLTDEVWAVKD 968          

HSP 4 Score: 55.0694 bits (131), Expect = 4.390e-8
Identity = 29/97 (29.90%), Postives = 53/97 (54.64%), Query Frame = 2
Query:  965 LGFSPEMQLMS-TRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNY 1252
            LG   E+   S  R  SGG +++L LA   + +P L++LDEPTN LD  ++  L   LK ++  +I+++H  +F   +  ++  + + K+     N+
Sbjct:  882 LGLDSELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKNLTDEVWAVKDGKMTPSGHNW 978          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Yeast
Match: YEF3 (Translation elongation factor 3; contains two ABC cassettes; binds and hydrolyzes ATP; YEF3 has a paralog, HEF3, that arose from the whole genome duplication [Source:SGD;Acc:S000004239])

HSP 1 Score: 160.999 bits (406), Expect = 5.256e-41
Identity = 122/410 (29.76%), Postives = 191/410 (46.59%), Query Frame = 2
Query:  587 FDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELK-MPAN--VSILLVEQEVIG--DDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYE----SQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQH---HVDQLNLNQSSLEFLQTKFPGSE 1780
            F +++G+K+LL    + +   RRYG  G NG GK+T+++AIA  ++   P       + VE ++ G   DT  ++ V E+  V T+         A KD               LIE               GF+ EM  M     SGGW+M+LALARA+    D+LLLDEPTN LD   + WL  YL T   + I +SHD  FLD V   I+     K+  +K N++EF     +K     K YE    + ++++     +++  +T                   K + +VK   + F++P                 G +K +    N   S+   SRI ++G NGAGK+TL+ +   EL P SG + TH++ RI +  QH   H++  +L+++  E++Q +F   E
Sbjct:  436 FSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQVDGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFESG-VGTK--------EAIKD--------------KLIE--------------FGFTDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEGLKLRKYKGNFTEF-----VKKCPAAKAYEELSNTDLEFKFPEPGYLEGVKT-------------------KQKAIVKVTNMEFQYP-----------------GTSKPQITDINFQCSLS--SRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTHENCRIAYIKQHAFAHIES-HLDKTPSEYIQWRFQTGE 764          

HSP 2 Score: 69.707 bits (169), Expect = 1.479e-12
Identity = 29/75 (38.67%), Postives = 49/75 (65.33%), Query Frame = 2
Query: 1844 IQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVED 2068
            I+ LSGGQK ++     + + P+ ++LDEPTN LD +S+ AL  A+++++GGV+I+TH     +     +W V+D
Sbjct:  894 IRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEVWAVKD 968          

HSP 3 Score: 69.3218 bits (168), Expect = 1.815e-12
Identity = 52/191 (27.23%), Postives = 91/191 (47.64%), Query Frame = 2
Query: 1580 RICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLA-LNEEISN 2149
            R  I G NG GK+TL++        Q     T +  R   + +H +D  + + S L+F+     G++ E  + +L  FG   ++   PI +LSGG K ++A     ++N + L+LDEPTN+LD  ++  L   +       + ++HD   +      +   E   + +  G F ++ K+   A   EE+SN
Sbjct:  458 RYGICGPNGCGKSTLMRAIANG---QVDGFPTQEECRT-VYVEHDIDGTHSDTSVLDFVFESGVGTK-EAIKDKLIEFGFTDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSN 643          

HSP 4 Score: 56.9954 bits (136), Expect = 1.087e-8
Identity = 29/97 (29.90%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  965 LGFSPEMQLMS-TRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNY 1252
            LG  PE+   S  R  SGG +++L LA   + +P L++LDEPTN LD  ++  L   LK ++  +I+++H  +F   +  ++  + + ++     N+
Sbjct:  882 LGLDPEIVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEVWAVKDGRMTPSGHNW 978          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Nematostella
Match: EDO36317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ11])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 286/539 (53.06%), Postives = 399/539 (74.03%), Query Frame = 2
Query:  530 KEDGIDSNGTVLTNFV-ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDT----ADG----SRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            +E  ++S+GT  +  + I NFD+++G++ LLK A+++I+ GRRYG +GRNG+GKTT+L+ ++ +EL + +N+SIL VEQEV+GD+T A+ SVLE DT R  LLKE + L A+  +    A+G     R+ +IY +L+ IE+DKAPARA  IL GLGF+P+MQ   T++FSGGWRMRLALARALFS+PDLLLLDEPTNMLD+KA++WLE YL+ W  +++VVSHD+ FLD V TDIL + +QK++ +K NY  F++ R  KL+NQ +EYE+Q  YR+H+Q FID+FR  A +A+  QS+IK+LEKLP L+PV ++   +  FP C KL  P+LQ DE+ F Y+ +R +   + IS  + SRI +VG+NG+GKTTLLKI L ELEP  G+   H++L+IG+FSQHHVDQL + Q ++EFL ++FPG   E YR +LG +G+ G++A RPI SLSGGQKSRV F  ++M  PN L+LDEPTN+LD+E+IEAL  A+ ++ GGVV+V+HDERL+R     +W+     +  I+G FD Y+K V
Sbjct:   96 REQKMESSGTNKSQDIRIENFDLAYGNRSLLKGANLAIAFGRRYGLVGRNGIGKTTLLRTLSKRELFVASNISILYVEQEVVGDETPALESVLECDTERFNLLKEEKALAASTSSKSPDANGDKTSKRLAQIYSRLEEIEADKAPARASTILAGLGFTPKMQTQFTKEFSGGWRMRLALARALFSKPDLLLLDEPTNMLDLKAVMWLEGYLQQWPTTILVVSHDRNFLDTVTTDILHMHSQKLDYYKGNYENFQKTREEKLLNQQREYEAQQMYRQHLQAFIDKFRYNAKRASLAQSKIKILEKLPVLQPVERDPPAILRFPECEKLSPPVLQLDEVMFHYSPDRVIFSKVDISANNESRIAVVGDNGSGKTTLLKILLGELEPVKGIRHYHRNLKIGYFSQHHVDQLQMTQCAIEFLASRFPGMNTEAYRHQLGRYGVSGELATRPIISLSGGQKSRVVFASMTMGGPNLLVLDEPTNHLDMETIEALAKALRQFKGGVVLVSHDERLVRNVCNEVWLCGQGTVRSIEGGFDMYKKIV 634          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Nematostella
Match: EDO34786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNE4])

HSP 1 Score: 441.425 bits (1134), Expect = 5.976e-146
Identity = 243/543 (44.75%), Postives = 349/543 (64.27%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKML-------------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSG-LLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPS 2155
            +  F +S   K L  +A+++I+ GRRYG +G NG+GKTT+L  IA ++L +P N+ +LL EQ+V  D++ A + VL+AD  R  LL+E + L A  +T D S   ++ E+Y +++ I +  A +RA  IL GLGF+ EMQ      FSGGWRMR++LARALF +P  L+LDEPTN LD+ A+IWL+ YL+ WKK+L+VVSHDQ FLD++ TDI+ L  QK+  ++ NY++F++  + KL  Q K +  Q +  + ++    + +  A + T+ Q   K                +  +L    KE  V F FP+ P L  PIL   ++ FGY  +  + KN+   V  +SRI +VG NG GKTT LK+    L P  G L+R H+ LR+GF+SQH  DQLNL +SS+E+LQ+K+   + +  R  LG FG+        I+ LSGGQKSRVAF  +++ NP+ +ILDEPTNNLD+ESI+AL  AI ++ GGV++V+HD RLI +T C LWVVE+K INE++G+FDDYR+E+L  L EE+   S
Sbjct:   28 VEKFSISARGKELFVNATLNITNGRRYGLVGPNGMGKTTLLTHIAERKLAIPPNIDVLLCEQDVKADNSPAFDVVLKADKKRLHLLEEEKRLIALSETGDESANEKLKEVYVEMEAIGAASAESRARRILSGLGFTTEMQQRPVNHFSGGWRMRVSLARALFLEPTFLMLDEPTNHLDLNAVIWLDNYLQNWKKTLLVVSHDQYFLDSICTDIIHLDMQKLSYYRGNYAQFKKMYKQKLKEQEKAFHKQEKQLKDMKA-SGQSKKQAEEKTKAQQGRKNKKGGKKGADAEEDDRQTVELLKKPKEYVVKFSFPNPPPLNPPILGLKDVVFGYPDQPILFKNIDFGVDMNSRIALVGNNGVGKTTFLKLLCGNLNPLQGELIRNHR-LRLGFYSQHSADQLNLEESSVEYLQSKY-NLDYQSSRKHLGRFGLASHAHTIRIKDLSGGQKSRVAFADMALSNPDVVILDEPTNNLDIESIDALAAAINEFTGGVILVSHDARLILETECQLWVVENKEINEVEGDFDDYRQEILDKLGEEMVGKS 567          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Nematostella
Match: EDO37542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE5])

HSP 1 Score: 388.652 bits (997), Expect = 1.489e-125
Identity = 207/520 (39.81%), Postives = 319/520 (61.35%), Query Frame = 2
Query:  578 ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            I NF ++F    LL DA + ++ GR+YG IG NG GK+TML AI  +E+ +P +  I  +  E+   D  A+  V+E D  R RL +E EEL+   D     R+ E++++L+ +++  A  RA  IL GLGF+  MQ   T+ FSGGWRMR++LARALF +P +LLLDEPTN LD+ A +WLE  LK +K+ L++VSH Q FL+ V T+I+ ++ +K+  +  NY  + + R     NQ+K+Y  +    +H++ +I RF   ++K A Q QS+ K+L K+      + VVK+  + F F  C  L  P++Q   + F Y  ++ +I KN+   +   SR+ +VG NGAGK+TLLK+    L P  G++R H  L+I  + QH  D L L+ S+++F+   FP   E E  R  +G +G+ G   + P+++LS GQ+ RV F  L+ + P+ L+LDEPTN+LD+E+I+AL  AI  +DGG+++V+HD RLI Q    +WV E + +    G+   Y++E+
Sbjct:   48 IDNFSITFHGVELLTDAKLELNTGRKYGLIGLNGCGKSTMLTAIGKREIPIPEHFDIFHLTSEIEASDKTALQCVMEVDKERHRLEEEAEELSKMGDEGH-DRLTEVFERLEELDAAHAEVRAAEILHGLGFTGAMQQTQTKDFSGGWRMRISLARALFVRPTILLLDEPTNHLDLDACVWLEQELKEYKRILVIVSHSQDFLNGVCTNIIHMALKKLTYYGGNYDSYVKTREELEENQMKQYNREQDQIKHMKEYIARFGHGSAKLARQAQSKEKVLAKMKANGLTDKVVKDKVLTFYFNDCGTLAPPVVQVQHMSFQYAPDKPLIYKNVEFGLDLESRVALVGPNGAGKSTLLKLIEGLLSPTEGIVRRHSHLKICRYHQHLQDILELDMSAMKFMMKCFPEIKEQEDMRRIIGRYGLTGKQQICPMRNLSDGQRCRVVFAWLAFQTPHMLLLDEPTNHLDMETIDALADAINDFDGGMILVSHDFRLINQVAKEIWVCERQTVTPWKGDILSYKEEL 566          

HSP 2 Score: 73.9442 bits (180), Expect = 1.187e-13
Identity = 59/235 (25.11%), Postives = 101/235 (42.98%), Query Frame = 2
Query:  584 NFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLV 1288
            +F  +    ++ K+    + +  R   +G NG GK+T+LK I  + L  P    +       I    + +  +LE D    + + +                PEI ++ D+            I+   G + + Q+   R  S G R R+  A   F  P +LLLDEPTN LDM+ I  L   +  +   +I+VSHD + ++ VA +I     Q +  +K +   ++E  R K+ 
Sbjct:  363 SFQYAPDKPLIYKNVEFGLDLESRVALVGPNGAGKSTLLKLI--EGLLSPTEGIVRRHSHLKICRYHQHLQDILELDMSAMKFMMKC--------------FPEIKEQEDMRR----------IIGRYGLTGKQQICPMRNLSDGQRCRVVFAWLAFQTPHMLLLDEPTNHLDMETIDALADAINDFDGGMILVSHDFRLINQVAKEIWVCERQTVTPWKGDILSYKEELRRKIA 571          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Nematostella
Match: EDO25928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDC3])

HSP 1 Score: 82.8037 bits (203), Expect = 3.123e-18
Identity = 58/173 (33.53%), Postives = 88/173 (50.87%), Query Frame = 2
Query: 1541 VIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQH-HVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAI----EKYDGGVVIVTHDERLIRQTN 2044
            V+ ++ +SV     + ++G NGAGKTTL++  L  L+P +G +     LRIG+  Q  HVD   L  S L FL+   PG      +  L   G    V   P+QS+SGG+  RV      ++ P  L+LDEP   +D+     L   I    +++  GV++V+HD  L+  T 
Sbjct:    1 VLDDVQLSVKPGEIVTLIGPNGAGKTTLVRAVLGLLKPDTGSVWRKAKLRIGYMPQKLHVDA-TLPLSVLRFLRL-VPGVTRTDVQAALAEVG-AEQVIDSPLQSISGGELQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYRLITQLRDRHGCGVLMVSHDLHLVMSTT 170          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Nematostella
Match: EDO26874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAU4])

HSP 1 Score: 61.6178 bits (148), Expect = 6.854e-12
Identity = 29/81 (35.80%), Postives = 53/81 (65.43%), Query Frame = 2
Query: 1853 LSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGE 2095
            LSGG+++R+A   L ++  N LI+DEPTN+LD+ S   L  A++++ G +++V+HD   ++    +++  +DK I E  G+
Sbjct:    1 LSGGERNRLALCKLLLQPFNVLIMDEPTNHLDIASKNVLKEALKQFKGTLILVSHDREFLQGLTTTVYGFKDKVIKEYLGD 81          

HSP 2 Score: 60.8474 bits (146), Expect = 1.280e-11
Identity = 31/78 (39.74%), Postives = 50/78 (64.10%), Query Frame = 2
Query: 1007 FSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENF 1240
             SGG R RLAL + L    ++L++DEPTN LD+ +   L+  LK +K +LI+VSHD++FL  + T +    ++ I+ +
Sbjct:    1 LSGGERNRLALCKLLLQPFNVLIMDEPTNHLDIASKNVLKEALKQFKGTLILVSHDREFLQGLTTTVYGFKDKVIKEY 78          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Medaka
Match: abcf3 (ATP binding cassette subfamily F member 3 [Source:NCBI gene;Acc:101159646])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 345/704 (49.01%), Postives = 490/704 (69.60%), Query Frame = 2
Query:   53 AEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEI--DASKSEEVYDLCCQIFKLL-VSKTDDDRKPILLNNPICIGDI------VEKD--KVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLT-NFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNAN--KDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFP-SCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYR 2110
            A  + I+++++P +  EL  Y+ ++L      FE + E+ ++I G+L E+  D+   EEV D+C Q+F  L +S   D ++ +LL+ P+ +  I        KD   + + +  +  +V   K+   E   K  A+ E R  K  +K  N      L+ ++ S +     KE+ +D +G   + +  I NFD+SFG + LL+ A +S++ GRRYG IGRNGLGKTT+LK +A++ L++PA++SIL VEQEV GDDT A+ SVL++D++R  LL E + LNA     TADG    R+ EIY KL+ IE+DKAPARA +IL GLGFSP MQ  +TR+FSGGWRMRLALAR+LF++PDLLLLDEPTNMLD+KAI+WLE YL+TW+ +++VVSHD+ FL+AV TDI+ L +Q++++++ +Y  F + +  +L NQ +EYE+Q+QYR+H+QVFIDRFR  A++A QVQS++K+L+KLP+L+P+ KE +V   FP +  KL  PILQ DE+ F Y+ ++ +   L +S    SRICIVGENG GKTT+LK+ + EL P +G+ + H++L+IG+FSQHHVDQL+LN  S+E L  KFPG   E YR +LG +GI G++A RP+ SLSGGQKSRVAF  ++M +PNF ILDEPTN+LD+E+IEAL  A+ K+ GGV++V+HDERLIR     LWV E   +  IDG FD+YR
Sbjct:   13 ASYVEILKSEFPAMDRELFDYITAVLDGGGTDFEGSEEVFEAIGGVLQEVSADSKNEEEVRDICVQMFNTLQLSNHRDPQRQVLLDAPVQLSQISAESGPAAKDVQGIWMMKRPQNTMVDAKKLEKAEAKLK--AKNERRSEKDSQKASNP-----LVLEEASASQASSKKENRVDQSGKNRSYDIRIENFDISFGERCLLQGAELSLASGRRYGLIGRNGLGKTTLLKMLASRNLRVPAHISILHVEQEVAGDDTMALQSVLQSDSLREGLLNEEKMLNARIANGTADGMESVRLSEIYMKLEEIEADKAPARASVILAGLGFSPRMQQQATREFSGGWRMRLALARSLFARPDLLLLDEPTNMLDVKAIVWLENYLQTWQSTILVVSHDRNFLNAVVTDIIHLHSQRLDSYRGDYENFLKTKEDRLKNQQREYEAQLQYRQHIQVFIDRFRYNANRAAQVQSKLKLLDKLPELKPLEKETEVTLRFPDNFEKLSPPILQLDEVEFYYSPDQPLFSGLNLSADLESRICIVGENGTGKTTILKLLMGELTPLNGVRQAHRNLKIGYFSQHHVDQLDLNVCSVELLLNKFPGRTEEEYRHQLGGYGITGELATRPVASLSGGQKSRVAFAQMTMPSPNFYILDEPTNHLDMETIEALAKALNKFKGGVILVSHDERLIRSVCKELWVCEGGKVWRIDGGFDEYR 709          

HSP 2 Score: 65.4698 bits (158), Expect = 1.650e-10
Identity = 32/104 (30.77%), Postives = 53/104 (50.96%), Query Frame = 2
Query:  956 LKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEE 1267
            L G G + E+        SGG + R+A A+     P+  +LDEPTN LDM+ I  L   L  +K  +I+VSHD++ + +V  ++      K+      + E+ +
Sbjct:  607 LGGYGITGELATRPVASLSGGQKSRVAFAQMTMPSPNFYILDEPTNHLDMETIEALAKALNKFKGGVILVSHDERLIRSVCKELWVCEGGKVWRIDGGFDEYRD 710          

HSP 3 Score: 60.077 bits (144), Expect = 7.277e-9
Identity = 51/235 (21.70%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1508 ELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIF-------------------------------LKELEPQSGLLRTHKSL--RIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRK 2113
            ++ FG   ER +++   +S+ S  R  ++G NG GKTTLLK+                                L+    + GLL   K L  RI   +   ++ + L++  ++  + +     P      L   G    +  +  +  SGG + R+A        P+ L+LDEPTN LD+++I  L   ++ +   +++V+HD   +      +  +  + ++   G+++++ K
Sbjct:  197 DISFG---ERCLLQGAELSLASGRRYGLIGRNGLGKTTLLKMLASRNLRVPAHISILHVEQEVAGDDTMALQSVLQSDSLREGLLNEEKMLNARIANGTADGMESVRLSEIYMKLEEIE-ADKAPARASVILAGLGFSPRMQQQATREFSGGWRMRLALARSLFARPDLLLLDEPTNMLDVKAIVWLENYLQTWQSTILVVSHDRNFLNAVVTDIIHLHSQRLDSYRGDYENFLK 427          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Medaka
Match: abcf1 (ATP binding cassette subfamily F member 1 [Source:NCBI gene;Acc:101173319])

HSP 1 Score: 417.542 bits (1072), Expect = 2.828e-133
Identity = 242/546 (44.32%), Postives = 345/546 (63.19%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGS---RIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKML-----------EKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKF--PGSEPEYYRGR--LGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISN 2149
            ++  +  F +S   K L  +A + I  GRRYG +G NG GKTT+LK IA + L +P N+ +LL EQEV+ DDT A+ +VL+ADT R +LL+E ++L AN +  + S   R+ ++Y++L +I +  A A+A  IL GL F+PEMQ  +T++FSGGWRMR++LARALF +P LL+LDEPTN LD+ A+IWL  YL+ WKK+L++VSHDQ FLD V TDI+ L NQK+  ++ NY  F++    K     K+Y+ Q +  + ++      +    +  +V +R +              +  +L    KE  V F FP+ P L  PIL    + F Y  ++ + KN+   +   SRICIVG NG GK+TLL +   +L P  G +R +  L++GFF+Q + DQLN+ +++ E+L   F  P     Y  GR  LG FG+        I  LSGGQK+RV F  L+ + P+ LILDEPTNNLD+ESI+AL  AI +Y G V+IV+HD RLI +T C+LWVVED++I +IDG+FDDY++EVL AL E + N
Sbjct:  275 SDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADDTPAVQAVLKADTRRLKLLEEEKQLQANLEKGEDSVAERLEKVYEELRVIGAAAAEAKARRILAGLSFTPEMQNRATKRFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWKKTLLIVSHDQSFLDEVCTDIIHLDNQKLYYYRGNYLTFKKMYVQKQKELQKQYDKQEKKLKDLKAGGKSTKQAEKQTKEVLTRKQQKGKKKGGQDEESHEATELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFCYDSQKPLFKNVDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTKGEMRKNHRLKVGFFNQQYADQLNMEETATEYLMRNFNLP-----YQDGRKCLGRFGLESHAHTIQISKLSGGQKARVVFAELACRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCTLWVVEDRSIIQIDGDFDDYKREVLEALGETMVN 815          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Medaka
Match: abcf2b (ATP binding cassette subfamily F member 2 [Source:NCBI gene;Acc:101162792])

HSP 1 Score: 387.882 bits (995), Expect = 2.056e-124
Identity = 213/524 (40.65%), Postives = 331/524 (63.17%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI  +E+ +P ++ I  + +E+   D  A+  V+E D  R  L KE E L A++D+ +  ++ E+Y++L+ +++DKA  RA  IL GLGFSP MQ    R FSGGWRMR+ALARALF +P +LLLDEPTN LD+ A +WLE  LK++K+ L+++SH Q FL+ V T+I+ L  +K++ +  NY ++ + R     NQ+K +  +     H++ +I RF   ++K A Q QS+ K L+K+      E VV +  + F FP C K+P P++    + F Y+     I KNL   +   +R+ +VG NGAGK+TLLK+ + EL P  G++R H  ++IG + QH  +QL L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI +++GG+++V+HD RLI+Q    +WV E + I + + +   Y++ +
Sbjct:   79 TDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSDKTALQCVMEVDEQRIMLEKEAERL-AHEDS-ECEKLMELYERLEELDADKAQMRASRILHGLGFSPAMQQKKLRDFSGGWRMRVALARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTEKVVNDKTLSFYFPPCGKIPPPVIMVQNVSFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNRDILAYKEHL 600          

HSP 2 Score: 60.077 bits (144), Expect = 6.625e-9
Identity = 56/237 (23.63%), Postives = 101/237 (42.62%), Query Frame = 2
Query:  584 NFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQ 1294
            +F  S  +  + K+    I +  R   +G NG GK+T+LK +  +   +P +  I       IG   + +   LE D      + +                PEI +K ++ +          I+   G + + Q+   R  S G + R+  A   +  P +L LDEPTN LD++ I  L   +  ++  +++VSHD + +  VA +I     Q I  +  +   ++E  + K+  Q
Sbjct:  397 SFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGE--LLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKC--------------YPEIKEKEEMRK----------IIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNRDILAYKEHLKSKIEKQ 607          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Medaka
Match: abcf2b (ATP binding cassette subfamily F member 2 [Source:NCBI gene;Acc:101162792])

HSP 1 Score: 387.882 bits (995), Expect = 2.056e-124
Identity = 213/524 (40.65%), Postives = 331/524 (63.17%), Query Frame = 2
Query:  566 TNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEV 2119
            T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI  +E+ +P ++ I  + +E+   D  A+  V+E D  R  L KE E L A++D+ +  ++ E+Y++L+ +++DKA  RA  IL GLGFSP MQ    R FSGGWRMR+ALARALF +P +LLLDEPTN LD+ A +WLE  LK++K+ L+++SH Q FL+ V T+I+ L  +K++ +  NY ++ + R     NQ+K +  +     H++ +I RF   ++K A Q QS+ K L+K+      E VV +  + F FP C K+P P++    + F Y+     I KNL   +   +R+ +VG NGAGK+TLLK+ + EL P  G++R H  ++IG + QH  +QL L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI +++GG+++V+HD RLI+Q    +WV E + I + + +   Y++ +
Sbjct:   79 TDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSDKTALQCVMEVDEQRIMLEKEAERL-AHEDS-ECEKLMELYERLEELDADKAQMRASRILHGLGFSPAMQQKKLRDFSGGWRMRVALARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTEKVVNDKTLSFYFPPCGKIPPPVIMVQNVSFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNRDILAYKEHL 600          

HSP 2 Score: 60.077 bits (144), Expect = 6.625e-9
Identity = 56/237 (23.63%), Postives = 101/237 (42.62%), Query Frame = 2
Query:  584 NFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQ 1294
            +F  S  +  + K+    I +  R   +G NG GK+T+LK +  +   +P +  I       IG   + +   LE D      + +                PEI +K ++ +          I+   G + + Q+   R  S G + R+  A   +  P +L LDEPTN LD++ I  L   +  ++  +++VSHD + +  VA +I     Q I  +  +   ++E  + K+  Q
Sbjct:  397 SFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGE--LLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKC--------------YPEIKEKEEMRK----------IIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNRDILAYKEHLKSKIEKQ 607          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Medaka
Match: abcf2b (ATP binding cassette subfamily F member 2 [Source:NCBI gene;Acc:101162792])

HSP 1 Score: 377.096 bits (967), Expect = 7.091e-120
Identity = 209/506 (41.30%), Postives = 322/506 (63.64%), Query Frame = 2
Query:  539 GIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQ 2038
            G+ ++    T+  IS+  ++F  + LL D S+ ++ GRRYG IG NG GK+ +L AI  +E+ +P ++ I  + +E+   D  A+  V+E D  R  L KE E L A++D+ +  ++ E+Y++L+ +++DKA  RA  IL GLGFSP MQ    R FSGGWRMR+ALARALF +P +LLLDEPTN LD+ A +WLE  LK++K+ L+++SH Q FL+ V T+I+ L  +K++ +  NY ++ + R     NQ+K +  +     H++ +I RF   ++K A Q QS+ K L+K+      E VV +  + F FP C K+P P++    + F Y+     I KNL   +   +R+ +VG NGAGK+TLLK+ + EL P  G++R H  ++IG + QH  +QL L+ S LE++   +P   E E  R  +G +G+ G   + PI++LS GQK RV F  L+ +NP+ L LDEPTN+LD+E+I+AL  AI +++GG+++V+HD RLI+Q
Sbjct:   70 GVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSDKTALQCVMEVDEQRIMLEKEAERL-AHEDS-ECEKLMELYERLEELDADKAQMRASRILHGLGFSPAMQQKKLRDFSGGWRMRVALARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTEKVVNDKTLSFYFPPCGKIPPPVIMVQNVSFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQ 573          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Planmine SMEST
Match: SMESG000035959.1 (SMESG000035959.1)

HSP 1 Score: 1319.29 bits (3413), Expect = 0.000e+0
Identity = 662/695 (95.25%), Postives = 678/695 (97.55%), Query Frame = 2
Query:   38 MTNNSAEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVE-DKNINEIDGEFDDYRKEV 2119
            MTNNSAEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRLLKELEELNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTN+LD+++I AL  AI+K++GGV++V+HDERLI      LW+VE + N++ +DG    YR+ V
Sbjct:    1 MTNNSAEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEGILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKDKVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTLLISQQFSKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRLLKELEELNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNHLDMQTIGALGEAIKKFEGGVILVSHDERLINNVCEELWLVEKNGNVSIVDGGISKYREMV 695          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Planmine SMEST
Match: SMESG000041811.1 (SMESG000041811.1)

HSP 1 Score: 494.967 bits (1273), Expect = 6.522e-166
Identity = 279/613 (45.51%), Postives = 395/613 (64.44%), Query Frame = 2
Query:  437 RMNKKMKKKQNGEIPTLLISQQFSKNINLYDKED--GIDSNGTVLTNFV---------ISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADT------VRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQV-------QSRIKMLEKLPKLEPV-----VKEMKVVFEFPSCPKLPSPILQADELCFGYT-KERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAAGVMD 2185
            ++ ++ KKKQ        + Q+F+KN    D +D      + TV+ N V         I  F +S   K L K+A + I+ GR+YG IG NG GKTT+L+ IA ++L +P+N+ +LL EQ+V+ DDT A++ VL++D+       +   LK   E++ + + A  +++ + Y +L+ + S  + ++A  IL GLGF+ +M +  T+ FSGGWRMR++LARALF +P LLLLDEPTN LD+ A+IWL+ YL+ WKK++++VSHDQ FLD V TDI+ L+ +K++ +K NYS F+E    K+V   K+Y+ Q   ++ ++  I + ++      Q+       Q++    ++  ++EP+      KE +V F+FP+  KL   IL    + F Y     T+   +   +  +SR+ IVG NG GK+T LK+   E+EP  G    +  +++G ++QH  DQLN+ ++ +E+L+  F     E  R  LG FG+       P  SLSGGQ++RVAF  L++  P+ LILDEPTNNLDLESIEALCVAIEKY+GGVVIVTHDERLIRQTNC LWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAAGVMD
Sbjct:    8 KLTRREKKKQQ-------LEQKFNKNNASSDSDDLNQFALSQTVINNNVLQDNAIDIKIEKFGISAAGKELFKNACLHITKGRKYGLIGPNGHGKTTLLRHIANRKLHIPSNIDLLLCEQDVVADDTIALDYVLKSDSKMMDLLSKVEKLKVEVEIDVSSNEA-INKLNDTYDELNAMGSSASESKARRILAGLGFTEKMMMKPTKDFSGGWRMRVSLARALFIEPTLLLLDEPTNHLDLNAVIWLDNYLQRWKKTILIVSHDQSFLDNVCTDIIHLNRKKLDYYKGNYSMFKEMFIQKMVQDRKKYDQQ---QKDLKDMIKKGQSKKEAEKQLKDDLYKKQAKSSRKKEEQEIEPIELLEKPKEYQVKFDFPNPQKLNGLILSLTNVSFSYAGTNNTLFTKVDFVLDMNSRVSIVGPNGVGKSTFLKLLTGEIEPTIGERSINHRIKLGKYNQHSRDQLNMKETPVEYLRRLFNLQYQEA-RQNLGRFGLEKHAHEIPNSSLSGGQRARVAFAELALMKPDLLILDEPTNNLDLESIEALCVAIEKYEGGVVIVTHDERLIRQTNCLLWVVEDKNINEIDGEFDDYRKEVLLALNEEISNPSAVAAAAGVMD 608          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Planmine SMEST
Match: SMESG000071613.1 (SMESG000071613.1)

HSP 1 Score: 396.356 bits (1017), Expect = 2.484e-127
Identity = 205/551 (37.21%), Postives = 339/551 (61.52%), Query Frame = 2
Query:  506 SKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNEE 2140
            S+ ++ Y    G+ S+     +   SN  ++F  + +L D ++ ++ GRRYGFIG NG GK+++   +A  EL +P+++   L+++E+   D  A+ +V+EAD  + RL KE E L    DT    R+ E+Y++LD +++++A  RA  IL GLGF+ +MQ    + FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A +WLE  L  + + LI++SH + FL+ V T+I+ + ++K+  +  NY ++   +     NQ+K+Y+ +     H++ +I RF   + K A Q QS+ K L+K+      + V ++  +VF FPSC ++P P++Q   + F Y + + +I  N+   +   +R+ +VG NGAGK+TLLK+   ELEP  GL+R H   RIG + QH  + L+LN S ++++   FP   E +  R +LG +G+ G   + PI+SLS GQ+ R+ F  L+   P+ L+LDEPTN+LDLE+I++L  AI +++GG+++V+HD RLI +    +WV     + + DG+   Y+  ++  + +E
Sbjct:   84 SEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLVKEIEQE 634          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Planmine SMEST
Match: SMESG000049803.1 (SMESG000049803.1)

HSP 1 Score: 358.607 bits (919), Expect = 3.728e-114
Identity = 185/510 (36.27%), Postives = 300/510 (58.82%), Query Frame = 2
Query:  563 LTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINS-VLEADTVRTRXXXXXXXXNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEID 2089
            +T+F I + +M+   K+L KD+SI+I  G+RYG IG NG GK+ + KAI       P + ++ +VE+E + D TK +   V +A+     +     +  A         +P++   LD                GLGF+ E         SGGWRM+++LA  L ++PDLLLLDEPTNMLD + I WL  +LK WK +L  +SHD+ FL  VATD+L + N+ + ++ C Y E+   + +   N  K+ E Q   +  +  +I   +   +K  +V ++   ++ LP ++  + E + ++ FP+C K+    ++  E+ F Y+  + +++N+ + V   S+ICI+G+NG GKTTLLK+F+K L+P +G +  +    +G+FSQH+VD L +++S++E +Q + P  + E Y+  L  FGI  +    P++ LS GQKSRVAF+I+ M+ PNFLI DEPT++LD +  EAL  A+ K+ GGV+IVTHD RL+      LW ++++ ++ I+
Sbjct:   43 MTSFAIEDLNMTILEKVLFKDSSITIEHGKRYGLIGSNGSGKSILFKAIHMGLFDFPKDYTVGIVEEECLADGTKVVECFVPKAEVDDFMITFADVKSRAVNKKNKNVEVPKLITVLD----------------GLGFTAEKMTDHVGNLSGGWRMKISLATVLMAEPDLLLLDEPTNMLDDRTIQWLSGFLKEWKTNLFFISHDRSFLSNVATDLLSIENKTVVHYACKYYEWLRNQELDRENVRKQIEEQKAEKAVMMEYIK--KFEKTKKKEVAAKRLAIKNLPVIDESILEPREIWRFPACLKIKCATIETSEMGFSYSHTKEILRNITLRVEPDSKICILGDNGCGKTTLLKLFMKILKPTNGNMFLNDKTNVGYFSQHYVDHLEMDKSAIEIMQMRIPNCKIETYQNHLEKFGITSEDWNIPVRCLSSGQKSRVAFSIIYMQKPNFLIFDEPTSHLDKDGTEALEDALRKFKGGVIIVTHDGRLMTNVCNDLWYIQNRTLSTIE 534          
BLAST of ATP-binding cassette sub-family F member 3-like vs. Planmine SMEST
Match: SMESG000049901.1 (SMESG000049901.1)

HSP 1 Score: 357.066 bits (915), Expect = 1.317e-113
Identity = 184/511 (36.01%), Postives = 303/511 (59.30%), Query Frame = 2
Query:  563 LTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRXXXXXXXXN--ANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQVQSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEKYDGGVVIVTHDERLIRQTNCSLWVVEDKNINEID 2089
            + +F + N +M+   K+LLKD++I+I  G+RYG IG NG GK+ + KAI       P N +I +VE+E + D TK +   +  D V   ++K  +      NK   D   +P++ +                IL G+GF+ E         SGGWRM+++LA  L ++PDLLLLDEPTNMLD + I WL  +LK WK +L  +SHD  FL  VATD+L + N+ + ++ C Y E+   + +   N  K+ E Q   +  +  +I +     +K  +V ++ + ++K+P ++  + E + ++ FP+C K+    ++ +E+ F +   + + +N+ + V   S+ICI+G+NG GKTTLLKIF+K L+P +G +  +    +G+FSQH+VD L +++S++E +Q + P  + E Y+  L  FGI  +    P++ LS GQKSRVAF+ + M+ PNFLI DEPT++LD +  EAL  A+ K+ GGV++VTHD R++      LW ++++ ++ ++
Sbjct:   43 MKSFALENLNMTILEKVLLKDSTITIEHGKRYGLIGSNGSGKSILFKAIQMGLFDFPDNYTIGIVEEECLADGTKVVECFVGKDEVEDFMVKFADVKGRAVNKKNKD-VEVPKLVK----------------ILDGMGFTSEKMNDHVGNLSGGWRMKISLATVLMAEPDLLLLDEPTNMLDDRTIKWLSGFLKEWKTNLFFISHDGGFLSNVATDLLSIENKTVVHYACKYYEWLRNQELDRDNVRKQIEEQKAQKAELMEYIKK--FEKTKKKEVAAKRQQIKKMPVIDESILEPREIWRFPACLKIKCATIETNEMGFSFGPAKEIFRNITLRVQPDSKICILGDNGCGKTTLLKIFMKILKPTNGNMFLNDRTNVGYFSQHYVDHLEMDKSAIEIMQIRVPNCKLETYQSHLLKFGITSEDWNIPVRCLSSGQKSRVAFSTIYMQKPNFLIFDEPTSHLDKDGTEALEDALRKFKGGVIVVTHDGRMMSNVCKDLWYIQNRTVSVVE 534          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCF33.184e-746.44ATP binding cassette subfamily F member 3 [Source:... [more]
ABCF33.036e-745.96ATP binding cassette subfamily F member 3 [Source:... [more]
ABCF12.426e-13142.99ATP binding cassette subfamily F member 1 [Source:... [more]
ABCF11.222e-12843.09ATP binding cassette subfamily F member 1 [Source:... [more]
ABCF11.222e-12843.09ATP binding cassette subfamily F member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf-31.173e-17942.68ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-31.173e-17942.68ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-31.173e-17942.68ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-13.541e-14842.60ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-22.971e-11836.74ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG93309.214e-1046.93gene:FBgn0036888 transcript:FBtr0074940[more]
CG17032.208e-14445.60gene:FBgn0030321 transcript:FBtr0343647[more]
CG17032.208e-14445.60gene:FBgn0030321 transcript:FBtr0073520[more]
CG92811.977e-12640.07gene:FBgn0030672 transcript:FBtr0340308[more]
CG92811.977e-12640.07gene:FBgn0030672 transcript:FBtr0074057[more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf11.192e-13244.38ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf11.453e-13244.38ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf2b1.225e-12340.08ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf2a1.206e-12038.95ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf2a1.206e-12038.95ATP-binding cassette, sub-family F (GCN20), member... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
matn15.235e-747.45matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn10.000e+043.93matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn10.000e+048.79matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn10.000e+048.06matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn10.000e+048.22matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcf39.167e-845.52ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf33.542e-16844.12ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf17.375e-12843.14ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf22.463e-12440.30ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf34.481e-6848.62ATP-binding cassette, sub-family F (GCN20), member... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K268|ABCF3_MOUSE6.412e-745.52ATP-binding cassette sub-family F member 3 OS=Mus ... [more]
sp|Q66H39|ABCF3_RAT7.807e-745.38ATP-binding cassette sub-family F member 3 OS=Ratt... [more]
sp|Q9NUQ8|ABCF3_HUMAN1.458e-645.96ATP-binding cassette sub-family F member 3 OS=Homo... [more]
sp|Q5R9Z5|ABCF3_PONAB1.062e-645.67ATP-binding cassette sub-family F member 3 OS=Pong... [more]
sp|O59672|YB89_SCHPO2.005e-16246.38Uncharacterized ABC transporter ATP-binding protei... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JSX41.734e-649.86ATP-binding cassette sub-family F member 3-like OS... [more]
A0A336K3280.000e+050.22CSON012859 protein OS=Culicoides sonorensis OX=179... [more]
A0A1A8HSD78.949e-748.80ATP-binding cassette, sub-family F (GCN20), member... [more]
A0A1A8R9111.044e-648.80ATP-binding cassette, sub-family F (GCN20), member... [more]
U5EXM40.000e+048.40Putative transporter abc superfamily (Fragment) OS... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf36.947e-1049.14ATP binding cassette subfamily F member 3 [Source:... [more]
abcf31.785e-17144.43ATP binding cassette subfamily F member 3 [Source:... [more]
abcf15.448e-13144.46ATP binding cassette subfamily F member 1 [Source:... [more]
abcf2b1.406e-12339.12ATP-binding cassette sub-family F member 2 [Source... [more]
abcf2a4.617e-11939.50ATP-binding cassette sub-family F member 2 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf2a6.236e-12641.35ATP-binding cassette, sub-family F (GCN20), member... [more]
ENSPMAT00000007174.18.280e-4848.40pep scaffold:Pmarinus_7.0:GL490431:841:5388:1 gene... [more]
ENSPMAT00000007172.15.147e-4747.34pep scaffold:Pmarinus_7.0:GL490431:841:5397:1 gene... [more]
ENSPMAT00000009626.14.661e-4145.03pep scaffold:Pmarinus_7.0:GL487706:825:5638:1 gene... [more]
ENSPMAT00000005077.13.107e-3256.99pep scaffold:Pmarinus_7.0:GL479589:38272:41290:-1 ... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GCN205.632e-16342.21Positive regulator of the Gcn2p kinase activity; f... [more]
ARB19.257e-12838.00ATPase of the ATP-binding cassette (ABC) family; i... [more]
NEW12.380e-4328.41ATP binding cassette protein; cosediments with pol... [more]
HEF37.246e-4330.00Translational elongation factor EF-3; member of th... [more]
YEF35.256e-4129.76Translation elongation factor 3; contains two ABC ... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO363170.000e+053.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347865.976e-14644.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375421.489e-12539.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259283.123e-1833.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268746.854e-1235.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf31.650e-1049.01ATP binding cassette subfamily F member 3 [Source:... [more]
abcf12.828e-13344.32ATP binding cassette subfamily F member 1 [Source:... [more]
abcf2b2.056e-12440.65ATP binding cassette subfamily F member 2 [Source:... [more]
abcf2b2.056e-12440.65ATP binding cassette subfamily F member 2 [Source:... [more]
abcf2b7.091e-12041.30ATP binding cassette subfamily F member 2 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 3-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035959.10.000e+095.25SMESG000035959.1[more]
SMESG000041811.16.522e-16645.51SMESG000041811.1[more]
SMESG000071613.12.484e-12737.21SMESG000071613.1[more]
SMESG000049803.13.728e-11436.27SMESG000049803.1[more]
SMESG000049901.11.317e-11336.01SMESG000049901.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025411 ID=SMED30025411|Name=ATP-binding cassette sub-family F member 3-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2493bp
AAACAATTTGCATGATTTATTTTCAAGTTATTAAGTTATGACTAACAATT
CAGCAGAAATATTATCAATTATTCAGAATAAATATCCCAATCTCCAAGAT
GAGTTATTAAGTTATGTAGAAAGTATTTTAATCGAAAATGCAGACACATT
TGAAACTGCTTCAGAAATCCAGGATTCAATTGAAGGAATTTTGAATGAGA
TCGATGCATCAAAATCAGAAGAAGTTTATGATTTATGTTGTCAAATATTC
AAGTTACTTGTATCTAAAACTGACGATGATCGTAAACCCATTTTATTAAA
CAATCCTATTTGTATTGGAGATATAGTTGAAAAGGACAAAGTTATTTTAC
CTGAAAATAATCGCGAAGAATTGGTAAGTGGAAATAAAATAATGACTGAT
GAGGAAGTTAGGAAAAATTTGGCTGAAGTTGAAGAACGAATGAATAAAAA
AATGAAAAAGAAACAAAATGGCGAAATTCCTACACTTTTAATTAGCCAAC
AATTTAGTAAGAATATAAATCTTTATGATAAAGAGGATGGAATTGATAGT
AATGGAACGGTTCTTACAAATTTTGTCATCAGTAATTTTGATATGAGTTT
TGGTAGTAAAATGCTTTTAAAAGATGCTTCAATATCAATTTCAATTGGTA
GACGTTATGGATTTATTGGAAGAAATGGTTTAGGTAAAACTACAATGTTA
AAAGCAATTGCAACAAAAGAATTGAAAATGCCCGCCAATGTTTCTATTCT
CTTAGTTGAACAAGAAGTTATCGGAGATGATACTAAAGCTATCAATAGTG
TTTTAGAAGCAGATACAGTTCGCACTCGATTATTAAAAGAATTGGAAGAG
TTAAATGCAAATAAAGATACAGCTGATGGTTCTAGAATACCTGAAATATA
TCAAAAATTAGACTTAATTGAATCTGACAAAGCTCCTGCTCGTGCCTGTC
TAATTTTAAAAGGTTTAGGATTTTCTCCAGAAATGCAACTTATGTCTACT
CGTCAGTTTTCTGGAGGTTGGAGAATGAGATTAGCTCTTGCTCGTGCATT
ATTTTCTCAGCCAGATTTATTACTTCTCGATGAACCTACAAACATGTTAG
ACATGAAAGCAATAATATGGTTGGAAATGTATTTAAAAACTTGGAAAAAG
AGTCTAATTGTCGTATCCCACGATCAAAAATTTCTTGATGCAGTTGCTAC
GGATATTTTATTTCTCAGTAACCAAAAAATCGAAAATTTCAAGTGCAATT
ACAGTGAATTTGAGGAAGCCCGTCGAATGAAACTCGTAAATCAACTAAAA
GAATATGAATCACAAATGCAATATAGGGAACATGTCCAAGTTTTTATTGA
CCGATTTAGAACATACGCCAGCAAAGCTACTCAGGTTCAGAGTCGAATTA
AAATGCTGGAAAAACTCCCCAAATTAGAACCGGTTGTCAAAGAAATGAAA
GTGGTTTTTGAGTTTCCATCTTGTCCAAAATTGCCGTCACCGATTTTGCA
AGCCGATGAGCTGTGCTTCGGTTATACAAAAGAACGGACAGTGATAAAGA
ATCTTGTAATTTCTGTTGGAAGTCATTCGAGGATTTGCATTGTAGGAGAA
AATGGGGCCGGTAAAACGACTCTTCTCAAGATATTTCTCAAAGAACTCGA
GCCGCAAAGTGGATTACTGCGCACGCACAAAAGTCTACGAATCGGATTTT
TCTCACAGCATCATGTCGATCAATTAAATCTGAATCAGAGTAGCTTAGAG
TTCTTGCAGACGAAATTCCCGGGATCCGAGCCCGAATATTATCGAGGTAG
ACTGGGAAGTTTTGGAATCGTGGGAGATGTTGCATTAAGGCCGATTCAAA
GTCTCTCTGGAGGCCAGAAATCTCGAGTTGCGTTCACCATTCTATCGATG
AAGAATCCGAATTTCTTGATTCTCGATGAACCGACCAATAATTTGGATCT
GGAATCGATCGAGGCTCTTTGCGTTGCCATAGAGAAATACGACGGCGGAG
TTGTCATTGTGACTCATGACGAGAGGCTTATCAGACAGACAAATTGCTCG
CTCTGGGTTGTCGAGGACAAGAATATCAATGAAATCGATGGCGAGTTCGA
CGATTACAGAAAGGAGGTTTTGTTGGCTCTCAATGAGGAGATTTCTAATC
CGTCCGCTGTTGCTGCTGCAGCTGGCGTTATGGATTGATTGATTTATCGG
TTTATTTATCGATTTATTGATCTCGGTGATATTTTCTGTTTGGAAATAAA
TATTTGACAGTCAGATTTTGCTGACTTTTCGTGTCCTTTAAATATAAGTG
AAGAAAATGTGTCAGAGTTGTAAGAGATCAAACAGCTATGATCTCTCAAG
AGAAATTGTTTAATTTCTACATCAGTGTATTTTGTATACACAGTAAGCAG
ACATTTCTAGTCTATGATGTAAGTATTAAATCAACTTCGTCTTATATAAA
AGACCAGTATTTTTAAAAAGTATTCTTAATAAATTGTTGAGAA
back to top

protein sequence of SMED30025411-orf-1

>SMED30025411-orf-1 ID=SMED30025411-orf-1|Name=SMED30025411-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=717bp
MTNNSAEILSIIQNKYPNLQDELLSYVESILIENADTFETASEIQDSIEG
ILNEIDASKSEEVYDLCCQIFKLLVSKTDDDRKPILLNNPICIGDIVEKD
KVILPENNREELVSGNKIMTDEEVRKNLAEVEERMNKKMKKKQNGEIPTL
LISQQFSKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASIS
ISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTK
AINSVLEADTVRTRLLKELEELNANKDTADGSRIPEIYQKLDLIESDKAP
ARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEP
TNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIEN
FKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASKATQV
QSRIKMLEKLPKLEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKER
TVIKNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSL
RIGFFSQHHVDQLNLNQSSLEFLQTKFPGSEPEYYRGRLGSFGIVGDVAL
RPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNNLDLESIEALCVAIEK
YDGGVVIVTHDERLIRQTNCSLWVVEDKNINEIDGEFDDYRKEVLLALNE
EISNPSAVAAAAGVMD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR032781ABC_tran_Xtn
IPR017871ABC_transporter_CS
Vocabulary: molecular function
TermDefinition
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..75
e-value: 4.5E-8
score: 34.6
NoneNo IPR availablePANTHERPTHR19211:SF102coord: 1..69
NoneNo IPR availablePANTHERPTHR19211ATP-BINDING TRANSPORT PROTEIN-RELATEDcoord: 1..69
NoneNo IPR availableCOILSCoilCoilcoord: 262..282
NoneNo IPR availableCOILSCoilCoilcoord: 406..426
NoneNo IPR availableCOILSCoilCoilcoord: 121..141
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 450..633
e-value: 6.0E-31
score: 109.6
coord: 158..433
e-value: 2.8E-50
score: 172.9
NoneNo IPR availablePANTHERPTHR19211:SF45ATP-BINDING CASSETTE SUB-FAMILY F MEMBER 3coord: 22..633
NoneNo IPR availablePANTHERPTHR19211ATP-BINDING TRANSPORT PROTEIN-RELATEDcoord: 22..633
NoneNo IPR availableCDDcd03221ABCF_EF-3coord: 181..397
e-value: 4.09939E-43
score: 149.521
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 203..397
e-value: 2.3E-10
score: 50.4
coord: 512..625
e-value: 15.0
score: 1.8
IPR032781ABC-transporter extension domainPFAMPF12848ABC_tran_Xtncoord: 393..471
e-value: 6.7E-21
score: 74.1
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 194..352
e-value: 7.3E-20
score: 71.9
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 504..633
e-value: 3.9E-19
score: 69.5
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 179..420
score: 14.733
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 324..338
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 180..420
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 461..633