SEC7 domain-containing protein

Overview
NameSEC7 domain-containing protein
Smed IDSMED30025408
Length (bp)1542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SEC7 domain-containing protein (SMED30025408) t-SNE clustered cells

Violin plots show distribution of expression levels for SEC7 domain-containing protein (SMED30025408) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SEC7 domain-containing protein (SMED30025408) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SEC7 domain-containing protein (SMED30025408) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025408

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30025408h1SMcG0021927 dd_Smed_v4_11644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025408h1SMcG0021927 dd_Smed_v4_11644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SEC7 domain-containing protein vs. Ensembl Human
Match: IQSEC3 (IQ motif and Sec7 domain ArfGEF 3 [Source:HGNC Symbol;Acc:HGNC:29193])

HSP 1 Score: 155.221 bits (391), Expect = 8.610e-40
Identity = 97/336 (28.87%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLL----LVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGN---NTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  + +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLL    L  K+KS   Y F + + L G++ +LF  EYY HG+ L+  L G+     +HF         K   DL   I E+ +LE
Sbjct:  348 RKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELE 682          
BLAST of SEC7 domain-containing protein vs. Ensembl Human
Match: IQSEC3 (IQ motif and Sec7 domain ArfGEF 3 [Source:HGNC Symbol;Acc:HGNC:29193])

HSP 1 Score: 155.221 bits (391), Expect = 8.610e-40
Identity = 97/336 (28.87%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLL----LVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGN---NTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  + +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLL    L  K+KS   Y F + + L G++ +LF  EYY HG+ L+  L G+     +HF         K   DL   I E+ +LE
Sbjct:  348 RKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELE 682          
BLAST of SEC7 domain-containing protein vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 154.451 bits (389), Expect = 2.172e-39
Identity = 93/347 (26.80%), Postives = 179/347 (51.59%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KG+ +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL  ++ G +    I+FN  +   + K   DL   I E+ ++E +
Sbjct:  402 RKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKH 748          
BLAST of SEC7 domain-containing protein vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 154.066 bits (388), Expect = 2.348e-39
Identity = 93/347 (26.80%), Postives = 179/347 (51.59%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KG+ +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL  ++ G +    I+FN  +   + K   DL   I E+ ++E +
Sbjct:  402 RKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKH 748          
BLAST of SEC7 domain-containing protein vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 154.066 bits (388), Expect = 3.709e-39
Identity = 93/347 (26.80%), Postives = 179/347 (51.59%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KG+ +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL  ++ G +    I+FN  +   + K   DL   I E+ ++E +
Sbjct:  525 RKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKH 871          
BLAST of SEC7 domain-containing protein vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 104.76 bits (260), Expect = 8.963e-24
Identity = 82/352 (23.30%), Postives = 161/352 (45.74%), Query Frame = 1
Query:  367 PFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLL-NSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNE-NTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKC---IYEE---EIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG-------IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            P   + + ER+R   +  N FN+   +G+  L     ++  P+S+  LL    G+S  + GEY+   ++         +   I  +   ++  LR+      +P E++ +  I++ F+  Y   NP  +S  +   +TI +L++ I+ML+T +H+     K ++T+  F+   +    I  E   E I+   L  +Y+ +K+ ++    D   QV+ +  ++ G+    L +  R+ +C     ++    K+  S +  R ++LFND+++V K   +G        Y  K+   L G  V  F    Y  GL +  T    + IHFN ++   +    +D++  I E  ++E
Sbjct:   72 PPRQMTDQERKRQYRIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNV--KQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGKDKPRLTETPRRLVCYCRLQQVSDPTKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLLGAHVTEFQRGQYEFGLTI--TCPNKDKIHFNARNFEDRCHFVADVTESIREATEME 419          
BLAST of SEC7 domain-containing protein vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 104.76 bits (260), Expect = 9.769e-24
Identity = 82/352 (23.30%), Postives = 161/352 (45.74%), Query Frame = 1
Query:  367 PFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLL-NSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNE-NTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKC---IYEE---EIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG-------IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            P   + + ER+R   +  N FN+   +G+  L     ++  P+S+  LL    G+S  + GEY+   ++         +   I  +   ++  LR+      +P E++ +  I++ F+  Y   NP  +S  +   +TI +L++ I+ML+T +H+     K ++T+  F+   +    I  E   E I+   L  +Y+ +K+ ++    D   QV+ +  ++ G+    L +  R+ +C     ++    K+  S +  R ++LFND+++V K   +G        Y  K+   L G  V  F    Y  GL +  T    + IHFN ++   +    +D++  I E  ++E
Sbjct:   77 PPRQMTDQERKRQYRIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNV--KQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGKDKPRLTETPRRLVCYCRLQQVSDPTKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLLGAHVTEFQRGQYEFGLTI--TCPNKDKIHFNARNFEDRCHFVADVTESIREATEME 424          
BLAST of SEC7 domain-containing protein vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 104.76 bits (260), Expect = 1.218e-23
Identity = 82/352 (23.30%), Postives = 161/352 (45.74%), Query Frame = 1
Query:  367 PFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLL-NSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNE-NTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKC---IYEE---EIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG-------IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            P   + + ER+R   +  N FN+   +G+  L     ++  P+S+  LL    G+S  + GEY+   ++         +   I  +   ++  LR+      +P E++ +  I++ F+  Y   NP  +S  +   +TI +L++ I+ML+T +H+     K ++T+  F+   +    I  E   E I+   L  +Y+ +K+ ++    D   QV+ +  ++ G+    L +  R+ +C     ++    K+  S +  R ++LFND+++V K   +G        Y  K+   L G  V  F    Y  GL +  T    + IHFN ++   +    +D++  I E  ++E
Sbjct:  136 PPRQMTDQERKRQYRIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNV--KQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGKDKPRLTETPRRLVCYCRLQQVSDPTKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLLGAHVTEFQRGQYEFGLTI--TCPNKDKIHFNARNFEDRCHFVADVTESIREATEME 483          
BLAST of SEC7 domain-containing protein vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 104.375 bits (259), Expect = 1.921e-23
Identity = 82/352 (23.30%), Postives = 161/352 (45.74%), Query Frame = 1
Query:  367 PFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLL-NSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNE-NTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKC---IYEE---EIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG-------IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            P   + + ER+R   +  N FN+   +G+  L     ++  P+S+  LL    G+S  + GEY+   ++         +   I  +   ++  LR+      +P E++ +  I++ F+  Y   NP  +S  +   +TI +L++ I+ML+T +H+     K ++T+  F+   +    I  E   E I+   L  +Y+ +K+ ++    D   QV+ +  ++ G+    L +  R+ +C     ++    K+  S +  R ++LFND+++V K   +G        Y  K+   L G  V  F    Y  GL +  T    + IHFN ++   +    +D++  I E  ++E
Sbjct:  215 PPRQMTDQERKRQYRIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNV--KQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGKDKPRLTETPRRLVCYCRLQQVSDPTKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLLGAHVTEFQRGQYEFGLTI--TCPNKDKIHFNARNFEDRCHFVADVTESIREATEME 562          
BLAST of SEC7 domain-containing protein vs. Ensembl Celegans
Match: grp-1 (GTP exchange factor for ARFs 1 [Source:UniProtKB/Swiss-Prot;Acc:P34512])

HSP 1 Score: 85.5001 bits (210), Expect = 8.514e-18
Identity = 55/197 (27.92%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  391 ERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLLNS-EGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDIT 978
            E  +++  G+  FN++  K + +L   N++ +DP+++   + + EG+S    GE L   N   A  T +++ K+    D  I   LR+     R+PGESQ +  ILE F++ Y  QNP       N +    +AY  +M++T +HN     KDK + E ++ + + + E+  I  + L E+YE+V   +  +  +++
Sbjct:   59 EYHKIVVNGRKKFNQDPWKALDWLASRNVVAKDPQALALWMKAGEGLSKSAIGEILGD-NRPFALETLDRFTKEHKLHDVPIVPALRQYLFSFRLPGESQKINRILEKFAEVYANQNPSYG----NADQAHTVAYSCIMVNTLLHNPNV--KDKPSLEKYIEMNEQLLEKGAITIEQLTEVYESVSVTQFKIPDEVS 248          
BLAST of SEC7 domain-containing protein vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0078289)

HSP 1 Score: 158.303 bits (399), Expect = 6.797e-41
Identity = 99/334 (29.64%), Postives = 172/334 (51.50%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEA 1380
            R+R   +G N+FN+   KGI++LI+   +E  P+ + R L+  +G+S  + GEYL    N    A  + +  ++      ++  LR+  +  R+PGE+Q +  ++E FS  Y   N  I  +L++ +TI +LA+ I+ML+T +H      + ++  E F+   + I +   I+ D L  +Y+ VK  +    SD   QV  +  ++ G+ P +L   +R+ +C     EI  +NKK     H R ++LFNDLL++T    K+K+   Y F+    L G  V L     Y   ++L + + G   I FN ++E  + K   DL   I E+ ++E+
Sbjct:  766 RKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSDHVTQVMKVQATIVGKKP-NLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDGKILITFNARNEHDRCKFAEDLKESISEMDEMES 1098          
BLAST of SEC7 domain-containing protein vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0111038)

HSP 1 Score: 157.918 bits (398), Expect = 1.094e-40
Identity = 99/334 (29.64%), Postives = 172/334 (51.50%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEA 1380
            R+R   +G N+FN+   KGI++LI+   +E  P+ + R L+  +G+S  + GEYL    N    A  + +  ++      ++  LR+  +  R+PGE+Q +  ++E FS  Y   N  I  +L++ +TI +LA+ I+ML+T +H      + ++  E F+   + I +   I+ D L  +Y+ VK  +    SD   QV  +  ++ G+ P +L   +R+ +C     EI  +NKK     H R ++LFNDLL++T    K+K+   Y F+    L G  V L     Y   ++L + + G   I FN ++E  + K   DL   I E+ ++E+
Sbjct:  651 RKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSDHVTQVMKVQATIVGKKP-NLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDGKILITFNARNEHDRCKFAEDLKESISEMDEMES 983          
BLAST of SEC7 domain-containing protein vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0301602)

HSP 1 Score: 157.532 bits (397), Expect = 1.183e-40
Identity = 99/334 (29.64%), Postives = 172/334 (51.50%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEA 1380
            R+R   +G N+FN+   KGI++LI+   +E  P+ + R L+  +G+S  + GEYL    N    A  + +  ++      ++  LR+  +  R+PGE+Q +  ++E FS  Y   N  I  +L++ +TI +LA+ I+ML+T +H      + ++  E F+   + I +   I+ D L  +Y+ VK  +    SD   QV  +  ++ G+ P +L   +R+ +C     EI  +NKK     H R ++LFNDLL++T    K+K+   Y F+    L G  V L     Y   ++L + + G   I FN ++E  + K   DL   I E+ ++E+
Sbjct:  661 RKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSDHVTQVMKVQATIVGKKP-NLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDGKILITFNARNEHDRCKFAEDLKESISEMDEMES 993          
BLAST of SEC7 domain-containing protein vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0078290)

HSP 1 Score: 157.532 bits (397), Expect = 1.333e-40
Identity = 99/334 (29.64%), Postives = 172/334 (51.50%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEA 1380
            R+R   +G N+FN+   KGI++LI+   +E  P+ + R L+  +G+S  + GEYL    N    A  + +  ++      ++  LR+  +  R+PGE+Q +  ++E FS  Y   N  I  +L++ +TI +LA+ I+ML+T +H      + ++  E F+   + I +   I+ D L  +Y+ VK  +    SD   QV  +  ++ G+ P +L   +R+ +C     EI  +NKK     H R ++LFNDLL++T    K+K+   Y F+    L G  V L     Y   ++L + + G   I FN ++E  + K   DL   I E+ ++E+
Sbjct:  754 RKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSDHVTQVMKVQATIVGKKP-NLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDGKILITFNARNEHDRCKFAEDLKESISEMDEMES 1086          
BLAST of SEC7 domain-containing protein vs. Ensembl Fly
Match: step (gene:FBgn0086779 transcript:FBtr0085910)

HSP 1 Score: 88.1965 bits (217), Expect = 1.811e-18
Identity = 56/217 (25.81%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  358 LDDPFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLL-NSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMS 1005
            LD P D   +  + + +++G+  FN +  KGI +L+++ ++  DP+ +   L   EG++    G+YL + N+      K  ++    F +  + + LR+     R+PGE+Q +  ++E F+  Y   NP I     N +T  +L++ I+ML+T +HN   + KDK T + F+ + + I     +    L  LYE+++ +   +  D  + + + F +
Sbjct:   67 LDVPEDC-KHSNKDKQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLK-AFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDI---FTNTDTCYVLSFAIIMLNTSLHN--PSVKDKPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFN 276          
BLAST of SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 166.392 bits (420), Expect = 2.261e-43
Identity = 101/353 (28.61%), Postives = 181/353 (51.27%), Query Frame = 1
Query:  382 NNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYFSQENT*EKQE 1416
            N+  +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  L   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   YY HG+RL   + G      I FN   +  + +  SDL   I E+  +E Y   E+  EKQ+
Sbjct:  719 NDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-LSLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIAEVQDMEKY-RVESELEKQK 1069          
BLAST of SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 160.614 bits (405), Expect = 1.648e-41
Identity = 96/338 (28.40%), Postives = 173/338 (51.18%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  L   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   YY HG+RL   + G      I FN   +  + +  SDL   I E+  +E Y
Sbjct:  585 QRRHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-LSLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIAEVQDMEKY 921          
BLAST of SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 160.614 bits (405), Expect = 1.885e-41
Identity = 96/338 (28.40%), Postives = 173/338 (51.18%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  L   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   YY HG+RL   + G      I FN   +  + +  SDL   I E+  +E Y
Sbjct:  723 QRRHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-LSLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIAEVQDMEKY 1059          
BLAST of SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 159.073 bits (401), Expect = 5.529e-41
Identity = 96/338 (28.40%), Postives = 173/338 (51.18%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  L   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   YY HG+RL   + G      I FN   +  + +  SDL   I E+  +E Y
Sbjct:  581 QRRHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-LSLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIAEVQDMEKY 917          
BLAST of SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 159.073 bits (401), Expect = 5.640e-41
Identity = 96/338 (28.40%), Postives = 173/338 (51.18%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  L   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   YY HG+RL   + G      I FN   +  + +  SDL   I E+  +E Y
Sbjct:  586 QRRHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-LSLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIAEVQDMEKY 922          
BLAST of SEC7 domain-containing protein vs. Ensembl Xenopus
Match: abo.2 (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) gene 2 [Source:Xenbase;Acc:XB-GENE-969944])

HSP 1 Score: 155.992 bits (393), Expect = 2.570e-40
Identity = 97/336 (28.87%), Postives = 167/336 (49.70%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLV----TKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNN---TIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L            +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP I  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  D +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLLL+     K+K+   Y F R + L GL+  L+  EYY HG+ L+  L  +     +HF         K   DL   I E+ ++E
Sbjct:  318 RKRLYRIGLNLFNVNPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNHDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEIVQQFHNPDTIFILAFAIILLNTDMYSPSIKPDRKMMLEDFIRNLRGVDDGADIPKDMVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKSVLSVPHRRLVCCSRLFEVTDVNKVQKQAAHQREVFLFNDLLLILKLCPKKKTSSTYTFCRAVPLVGLQFHLYENEYYPHGITLVSPLSSSEKKLVLHFCAISSEELQKFLEDLKESICEVTEME 652          
BLAST of SEC7 domain-containing protein vs. Ensembl Xenopus
Match: abo.2 (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) gene 2 [Source:Xenbase;Acc:XB-GENE-969944])

HSP 1 Score: 155.606 bits (392), Expect = 7.450e-40
Identity = 97/336 (28.87%), Postives = 167/336 (49.70%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLV----TKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNN---TIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L            +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP I  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  D +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLLL+     K+K+   Y F R + L GL+  L+  EYY HG+ L+  L  +     +HF         K   DL   I E+ ++E
Sbjct:  318 RKRLYRIGLNLFNVNPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNHDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEIVQQFHNPDTIFILAFAIILLNTDMYSPSIKPDRKMMLEDFIRNLRGVDDGADIPKDMVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKSVLSVPHRRLVCCSRLFEVTDVNKVQKQAAHQREVFLFNDLLLILKLCPKKKTSSTYTFCRAVPLVGLQFHLYENEYYPHGITLVSPLSSSEKKLVLHFCAISSEELQKFLEDLKESICEVTEME 652          
BLAST of SEC7 domain-containing protein vs. Ensembl Xenopus
Match: abo.2 (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) gene 2 [Source:Xenbase;Acc:XB-GENE-969944])

HSP 1 Score: 154.451 bits (389), Expect = 2.877e-39
Identity = 97/336 (28.87%), Postives = 167/336 (49.70%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLV----TKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNN---TIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L            +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP I  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  D +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLLL+     K+K+   Y F R + L GL+  L+  EYY HG+ L+  L  +     +HF         K   DL   I E+ ++E
Sbjct:  566 RKRLYRIGLNLFNVNPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNHDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEIVQQFHNPDTIFILAFAIILLNTDMYSPSIKPDRKMMLEDFIRNLRGVDDGADIPKDMVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKSVLSVPHRRLVCCSRLFEVTDVNKVQKQAAHQREVFLFNDLLLILKLCPKKKTSSTYTFCRAVPLVGLQFHLYENEYYPHGITLVSPLSSSEKKLVLHFCAISSEELQKFLEDLKESICEVTEME 900          
BLAST of SEC7 domain-containing protein vs. Ensembl Xenopus
Match: abo.2 (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) gene 2 [Source:Xenbase;Acc:XB-GENE-969944])

HSP 1 Score: 154.066 bits (388), Expect = 3.333e-39
Identity = 97/336 (28.87%), Postives = 167/336 (49.70%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLV----TKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNN---TIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L            +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP I  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  D +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLLL+     K+K+   Y F R + L GL+  L+  EYY HG+ L+  L  +     +HF         K   DL   I E+ ++E
Sbjct:  563 RKRLYRIGLNLFNVNPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNHDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEIVQQFHNPDTIFILAFAIILLNTDMYSPSIKPDRKMMLEDFIRNLRGVDDGADIPKDMVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKSVLSVPHRRLVCCSRLFEVTDVNKVQKQAAHQREVFLFNDLLLILKLCPKKKTSSTYTFCRAVPLVGLQFHLYENEYYPHGITLVSPLSSSEKKLVLHFCAISSEELQKFLEDLKESICEVTEME 897          
BLAST of SEC7 domain-containing protein vs. Ensembl Xenopus
Match: IQSEC2 (IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:100485600])

HSP 1 Score: 147.132 bits (370), Expect = 7.728e-37
Identity = 90/338 (26.63%), Postives = 176/338 (52.07%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTK--EKSKGI--YRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            +RR   +G N+FN+   KGI +LI+   + + P  +   +L  +G+S  + GE+L        +   +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  + F+   + +   E I  D L  +Y+ ++ +++    D   QV+ +   + G+ P  L   +R+ +C     E+   N+      H R ++LFNDLL+VTK  +K K +  Y F++   L  ++++LF   YY +G++L+  + G      I FN      +++  SDL   I E+ ++E Y
Sbjct:  513 QRRQYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSNMDLDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCNPVLVRQFRNPDTIFILAFAIILLNTDMYSPSVKPERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPV-LSLPHRRLVCCCQLYEVPDPNRPQRMGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVDMQMQLFQNSYYQYGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKY 849          
BLAST of SEC7 domain-containing protein vs. Ensembl Mouse
Match: Iqsec3 (IQ motif and Sec7 domain 3 [Source:MGI Symbol;Acc:MGI:2677208])

HSP 1 Score: 153.68 bits (387), Expect = 3.475e-39
Identity = 98/336 (29.17%), Postives = 167/336 (49.70%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLL----LVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGN---NTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L        +   +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  + +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLL    L  K+KS   Y F + + L G+R  LF  EYY HG+ L   L G+     +HF         K   DL   I E+ +LE
Sbjct:  655 RKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKTVLSMPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSSFTYTFCKAVGLLGMRFHLFENEYYSHGITLATPLSGSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELE 989          
BLAST of SEC7 domain-containing protein vs. Ensembl Mouse
Match: Iqsec1 (IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:MGI:1196356])

HSP 1 Score: 150.984 bits (380), Expect = 2.202e-38
Identity = 93/347 (26.80%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   + E+ ++E +
Sbjct:  522 RKRHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVAEVQEMEKH 868          
BLAST of SEC7 domain-containing protein vs. Ensembl Mouse
Match: Iqsec1 (IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:MGI:1196356])

HSP 1 Score: 151.369 bits (381), Expect = 2.293e-38
Identity = 93/347 (26.80%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   + E+ ++E +
Sbjct:  612 RKRHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVAEVQEMEKH 958          
BLAST of SEC7 domain-containing protein vs. Ensembl Mouse
Match: Iqsec1 (IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:MGI:1196356])

HSP 1 Score: 150.984 bits (380), Expect = 2.709e-38
Identity = 93/347 (26.80%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   + E+ ++E +
Sbjct:  508 RKRHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVAEVQEMEKH 854          
BLAST of SEC7 domain-containing protein vs. Ensembl Mouse
Match: Iqsec2 (IQ motif and Sec7 domain 2 [Source:MGI Symbol;Acc:MGI:3528396])

HSP 1 Score: 144.436 bits (363), Expect = 3.614e-36
Identity = 91/338 (26.92%), Postives = 172/338 (50.89%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTK--EKSKGI--YRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            +RR   +G N+FN+   KGI +LI+   + + P  +   +L  +G+S  + GE+L        +   +  + ++ F    ++  LR+  S +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  + F+   + +   E I  D L  +Y+ ++ +++    D   QV+ +   + G+ P  L   +R+ +C     E+   N+      H R ++LFNDLL+VTK  +K K +  Y F++   L  + ++LF   YY  G++L+  + G      I FN      +++  SDL   I E+ ++E Y
Sbjct:  548 QRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPV-LSLPHRRLVCCCQLYEVPDPNRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKY 884          
BLAST of SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DN90|IQEC1_HUMAN (IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.026e-38
Identity = 93/347 (26.80%), Postives = 179/347 (51.59%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KG+ +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL  ++ G +    I+FN  +   + K   DL   I E+ ++E +
Sbjct:  524 RKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKH 870          
BLAST of SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3TES0|IQEC3_MOUSE (IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Iqsec3 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.431e-38
Identity = 98/336 (29.17%), Postives = 167/336 (49.70%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLL----LVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGN---NTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L        +   +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  + +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLL    L  K+KS   Y F + + L G+R  LF  EYY HG+ L   L G+     +HF         K   DL   I E+ +LE
Sbjct:  655 RKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKTVLSMPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSSFTYTFCKAVGLLGMRFHLFENEYYSHGITLATPLSGSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELE 989          
BLAST of SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UPP2|IQEC3_HUMAN (IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=IQSEC3 PE=2 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 2.531e-38
Identity = 97/336 (28.87%), Postives = 168/336 (50.00%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLL----LVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGN---NTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  + +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLL    L  K+KS   Y F + + L G++ +LF  EYY HG+ L+  L G+     +HF         K   DL   I E+ +LE
Sbjct:  651 RKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELE 985          
BLAST of SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q76M68|IQEC3_RAT (IQ motif and SEC7 domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Iqsec3 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.979e-38
Identity = 98/336 (29.17%), Postives = 167/336 (49.70%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLL----LVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGN---NTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN N +KGI FLI    I + P  +   LL  +G+S  + GE+L        +   +  + ++ F +  +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  +  N +TI ILA+ I++L+T +++       K+  E F+   + + +   I  + +  +YE +++K++    D    V  +  S+ G     L   +R+ +C     E+  +NK     +H R ++LFNDLL    L  K+KS   Y F + + L G+R  LF  EYY HG+ L   L G+     +HF         K   DL   I E+ +LE
Sbjct:  653 RKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNEDHVTYVTKVEKSIVG-MKTVLSMPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSSFTYTFCKAVGLLGMRFHLFENEYYSHGITLATPLSGSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELE 987          
BLAST of SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R0S2|IQEC1_MOUSE (IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Iqsec1 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 1.540e-37
Identity = 93/347 (26.80%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   + E+ ++E +
Sbjct:  522 RKRHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVAEVQEMEKH 868          
BLAST of SEC7 domain-containing protein vs. TrEMBL
Match: A0A0X3P489 (SEC7 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR148901 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.102e-49
Identity = 106/303 (34.98%), Postives = 179/303 (59.08%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNP-HISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRF-PKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTK------EKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETL 1275
            R+R+  +  N FN++  KGIS LI++  +E  P  I R LL   G+S    GEYL +  + LAKAT  ++++++ F+D  +++ LR L S+ R PGESQ +V +L  F   Y+ QNP  + ++ +N ++++ILAY I+MLHT +++     + K+T + F+   + I + E ++ + L  +Y  ++ ++MSV+ D TDQVR I   LTG   P  L+   R+ +C     E+   +K+  + +H R ++LFNDLLLVTK      + +  IY+ +  ++L GLRV  F    Y +G+ L +++
Sbjct:  725 RKRMYRVCLNYFNKSPVKGISMLIKYRFLETSPRQIARFLLTRRGLSRSAIGEYLGEMKDDLAKATTRQFMRELDFRDKDVDEALRTLMSRFRTPGESQKIVHLLTEFQSAYVEQNPARVKAQFQNPDSVMILAYAIVMLHTDLYSPSIRPQAKMTGQEFVKNLRGIDDGEDLDRNLLLSIYNRIQAQEMSVLPDHTDQVRKIQRLLTGPLTPPSLVLSQRRLVCYCRLYEVPDRSKRDRAGAHEREIFLFNDLLLVTKAFQKRRKDAPYIYQVRACVNLMGLRVSTFETPAYSNGIALYKSV 1027          
BLAST of SEC7 domain-containing protein vs. TrEMBL
Match: A0A183ND20 (SEC7 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS6 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 2.321e-49
Identity = 113/309 (36.57%), Postives = 180/309 (58.25%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPH-ISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTG-RFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG------IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTI 1293
            R+R   +G NIFN++  KGI FLI++  +E  P+ I R LL  +G+S    GEYL    N +AK T  ++++++ F++  +++ LR L    R PGESQ +V +L  F   Y+ QN   + S+ +N +T++ILAY I+MLHT +++     + K+TKE F+   + +   E ++ DFL  +Y+ +K ++MSV SD TDQVR I   LTG + P +L    R+ +C     E+   NK+  S +H R L+LFNDLLL+TK   K        Y+ +  I L G+++  F   ++ +GL L+  L+ N  +
Sbjct:  631 RKRTYRIGLNIFNKSPVKGIDFLIKNGFLENSPQLIARFLLTRKGLSRVAIGEYLGNTKNEIAKLTTRQFIRELKFRNKEVDEALRILLGCFRTPGESQKIVHLLNEFQSAYVEQNASLVKSQFRNSDTVMILAYAIVMLHTDMYSPNVRPQSKMTKEEFVRNLRGVDSGEDLDRDFLLGIYDRIKSQEMSVQSDHTDQVRKIQKHLTGPQKPLNLSVPQRRLVCYCRLYEVPDKNKRERSGAHQRELFLFNDLLLITKSVQKRRRDASVAYQVRMTIQLFGVKLVPFETVHHPNGLELLAPLEQNQNV 939          
BLAST of SEC7 domain-containing protein vs. TrEMBL
Match: A0A2L2Y426 (IQ motif and SEC7 domain-containing protein 1 (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.450e-48
Identity = 113/367 (30.79%), Postives = 193/367 (52.59%), Query Frame = 1
Query:  337 VDMIHS-------DLDDPFDVLNNP--------ERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
             DM HS       D+  P D+   P        +R+R   +G N+FN+   +G+ +LIQ   +E  P+++ R LL  +G+S  + GEYL    NS   A    +++++      ++  LR+  +  R+PGE+Q +  ++E FS  Y+  N  I+SK  N +T+ +LA+ I+ML+T +H      + ++  E F+   + I +   ++ D L  +YE +K  +  + SD   QV  +  ++ G+ P +L   +R+ +C     E+Y ++KK     H R ++LFNDLL+VT    K+K+   Y F++   L G+ V LF A YY HG+RL + +     I FN ++E  + K   DL   I E+ ++E
Sbjct:   81 ADMSHSFNVHNYPDVRTPHDLPGTPTIYKLTEIQRKRQYRVGLNLFNKKPERGVRYLIQRGFLEASPQAVARFLLTRKGLSKQMIGEYLGNLQNSFNMAVLECFVQELDLAGMQVDVALRKFQTFFRMPGEAQKIERLVEVFSHRYIDCNHDIASKFHNADTVFVLAFAIIMLNTDLHTPNMKAEKRMKIEEFIRNLRSIDDGHDLDRDMLVGIYERIKTNEFKMGSDHVTQVLKVQQTIVGKKP-NLALPHRRLVCYCRLYEVYDVSKKERPGVHQREVFLFNDLLMVTKIFSKKKNSVTYTFRQSFPLCGMSVTLFEAPYYPHGIRLSQRVDDKVLITFNARNEHDRSKFVEDLKESILEMDEME 446          
BLAST of SEC7 domain-containing protein vs. TrEMBL
Match: A0A2L2Y4K0 (IQ motif and SEC7 domain-containing protein 1 (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.749e-48
Identity = 113/367 (30.79%), Postives = 193/367 (52.59%), Query Frame = 1
Query:  337 VDMIHS-------DLDDPFDVLNNP--------ERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
             DM HS       D+  P D+   P        +R+R   +G N+FN+   +G+ +LIQ   +E  P+++ R LL  +G+S  + GEYL    NS   A    +++++      ++  LR+  +  R+PGE+Q +  ++E FS  Y+  N  I+SK  N +T+ +LA+ I+ML+T +H      + ++  E F+   + I +   ++ D L  +YE +K  +  + SD   QV  +  ++ G+ P +L   +R+ +C     E+Y ++KK     H R ++LFNDLL+VT    K+K+   Y F++   L G+ V LF A YY HG+RL + +     I FN ++E  + K   DL   I E+ ++E
Sbjct:   81 ADMSHSFNVHNYPDVRTPHDLPGTPTIYKLTEIQRKRQYRVGLNLFNKKPERGVRYLIQRGFLEASPQAVARFLLTRKGLSKQMIGEYLGNLQNSFNMAVLECFVQELDLAGMQVDVALRKFQTFFRMPGEAQKIERLVEVFSHRYIDCNHDIASKFHNADTVFVLAFAIIMLNTDLHTPNMKAEKRMKIEEFIRNLRSIDDGHDLDRDMLVGIYERIKTNEFKMGSDHVTQVLKVQQTIVGKKP-NLALPHRRLVCYCRLYEVYDVSKKERPGVHQREVFLFNDLLMVTKIFSKKKNSVTYTFRQSFPLCGMSVTLFEAPYYPHGIRLSQRVDDKVLITFNARNEHDRSKFVEDLKESILEMDEME 446          
BLAST of SEC7 domain-containing protein vs. TrEMBL
Match: A0A4E0RD19 (IQ motif and SEC7 domain-containing protein 1 OS=Fasciola hepatica OX=6192 GN=D915_004509 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 2.847e-48
Identity = 106/318 (33.33%), Postives = 185/318 (58.18%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQN-PHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRF-PKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG------IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWV 1320
            R+R+  +G NIFN++  KG+ FLI++  ++  PE+I R LL  +G+S    G+YL    + LA  T  ++++++ F++  +++ LR L S  R PGESQ +V +L  F   Y+ QN   + ++ +N +++++LAY I+MLHT +++     + K+T++ F+   + +   E ++ + L  +Y+ +++++MSV +D TDQVR I   LTG   P +L    R+ +C     E+   NK+    SH R ++LFNDLLL+TK   K        Y+ +  +SL G+R+  F   Y+ HGL L+  + G + I  N K+  +
Sbjct:  680 RKRVYRIGLNIFNKSPLKGVEFLIKYGFLDCAPETIARFLLTRKGLSRVAIGDYLGNTKDELAMTTTRQFMRELDFREQEVDEALRSLLSCFRTPGESQKIVHLLTEFQAAYVEQNSARVKAQFRNVDSVMVLAYAIVMLHTDMYSPNVRPQSKMTRDEFVRNLRGVDAGEDLDRNLLLAIYDRIQQREMSVAADHTDQVRKIQQHLTGPLRPLNLAIPQRRLVCYCRLYEVPDKNKRERPGSHQREVFLFNDLLLITKAVQKKRRDAAVAYQVRISLSLLGIRLTAFETAYHPHGLELLLPV-GESNISLNSKESGL 996          
BLAST of SEC7 domain-containing protein vs. Ensembl Cavefish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 159.073 bits (401), Expect = 5.319e-41
Identity = 97/353 (27.48%), Postives = 180/353 (50.99%), Query Frame = 1
Query:  382 NNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYFSQENT*EKQE 1416
            N+  +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  + F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  +   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   +Y HG+RL   + G      I F    +  + +  SDL   I E+  +E Y   E+  EKQ+
Sbjct:  677 NDVVQRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKPERKMKLDDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-ISLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSFYPHGVRLTSAIPGGERKVLIVFTAPSQQDRTRFVSDLRESIAEVQDMEKY-RVESELEKQK 1027          
BLAST of SEC7 domain-containing protein vs. Ensembl Cavefish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 157.918 bits (398), Expect = 1.181e-40
Identity = 97/353 (27.48%), Postives = 180/353 (50.99%), Query Frame = 1
Query:  382 NNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYFSQENT*EKQE 1416
            N+  +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  + F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  +   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   +Y HG+RL   + G      I F    +  + +  SDL   I E+  +E Y   E+  EKQ+
Sbjct:  804 NDVVQRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKPERKMKLDDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-ISLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSFYPHGVRLTSAIPGGERKVLIVFTAPSQQDRTRFVSDLRESIAEVQDMEKY-RVESELEKQK 1154          
BLAST of SEC7 domain-containing protein vs. Ensembl Cavefish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 157.918 bits (398), Expect = 1.183e-40
Identity = 97/353 (27.48%), Postives = 180/353 (50.99%), Query Frame = 1
Query:  382 NNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYFSQENT*EKQE 1416
            N+  +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  + F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P  +   +R+ +C     E+   N+   S  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   +Y HG+RL   + G      I F    +  + +  SDL   I E+  +E Y   E+  EKQ+
Sbjct:  813 NDVVQRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKPERKMKLDDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPV-ISLPHRRLVCCCQLYEVPDPNRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSFYPHGVRLTSAIPGGERKVLIVFTAPSQQDRTRFVSDLRESIAEVQDMEKY-RVESELEKQK 1163          
BLAST of SEC7 domain-containing protein vs. Ensembl Cavefish
Match: iqsec1b (IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Acc:ZDB-GENE-120813-1])

HSP 1 Score: 155.606 bits (392), Expect = 6.788e-40
Identity = 95/347 (27.38%), Postives = 179/347 (51.59%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +LI+   + + P  +   LL  +G+S  + GE+L        +   +  + ++ F    +++ LR+  + +R+ GE+Q +  ++E +S  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C  S  E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   I E+ ++E Y
Sbjct:  502 RKRHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAYSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRKRELRTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCSLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGVRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKY 848          
BLAST of SEC7 domain-containing protein vs. Ensembl Cavefish
Match: iqsec2b (IQ motif and Sec7 domain ArfGEF 2b [Source:ZFIN;Acc:ZDB-GENE-081105-73])

HSP 1 Score: 154.836 bits (390), Expect = 9.177e-40
Identity = 98/353 (27.76%), Postives = 178/353 (50.42%), Query Frame = 1
Query:  361 DDP-FDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKD---LIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            D P FD  N+  +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  + ++ F    ++  LR+  +Q+++ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++       K+  + F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P     L   +R+ +C     E+   N+   +  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   YY HG+RL   + G      I FN      + +  SDL   I E+ ++E Y
Sbjct:  407 DSPAFD--NDVMQRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVVDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLIEAFSQRYCVCNPALVRQFQNPDTIFILAFAIILLNTDMYSPSVKADRKMKLDDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPVSIYVLSLPHRRLVCCCQLYEVPDPNRPQRTGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYPHGVRLTSAIPGGERKVLIVFNAPSLQDRTRFVSDLRESIAEVQEMEKY 757          
BLAST of SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007609.1 (pep scaffold:Pmarinus_7.0:GL477333:80854:108205:-1 gene:ENSPMAG00000006851.1 transcript:ENSPMAT00000007609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 1.803e-40
Identity = 93/343 (27.11%), Postives = 177/343 (51.60%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKD-------LIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            R+RL  +G N+FN+   KG+ FL++   I + P  + + LL  +G+S  + G++L        +   +  ++++ F    I++ LR+   QVR+ GE+Q +  ++E FS  Y   N  +  + +N +TI ILA+ I++L+T  ++     + K+  E F+   + + + + I  + L  +Y+ + +K++    D   QV  +  S+ G+ P         L   +R+ +C     E+   N+      H R ++LFND L+VT    K+K+   Y F++  SL G++V LF  +YY +G++++  + G +T   + FN  +   + K   DL   I E+ ++E
Sbjct:   36 RKRLYRIGLNLFNKKAEKGLQFLMERGFIPDTPYGVAQFLLQRKGLSRQMIGDFLGNRQKQFNRDVLDCVVEEMDFAGMDIDEALRKFQGQVRVQGEAQKVERMIEAFSQRYCVCNSVLLRQFRNPDTIFILAFAIILLNTDRYSPNVKAERKMKLEDFIKNLRGVDDGKDIPREMLLSIYDRISKKELKTNEDHVSQVAKVEKSIVGKKPVRGLHVHCVLALPHRRLVCYCRLFEVPDTNRPQKLGLHQREIFLFNDFLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIKIVSAVPGADTKVLMVFNAPNPTDRKKFVDDLRESIAEVQEME 378          
BLAST of SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: iqsec1b (IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Acc:ZDB-GENE-120813-1])

HSP 1 Score: 153.295 bits (386), Expect = 7.428e-40
Identity = 93/348 (26.72%), Postives = 175/348 (50.29%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFP----------KDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KG+++L++   + + P  +   LL  +G+S  + GE+L     +  +   +  + ++ F    +++ LR   + +R+ GE+Q +  ++E FS  Y   NP +    +N +TI ILA+ I++L+T +++     + K+  + F+   + + +   I  + L  +YE ++R ++    D   QV N+  ++ G+ P          K L   +R+ +C     E+   N+      H R ++LFNDLL+VT    K K    Y F++   L G++V LF  +YY HG+RL+ +  G+ T   + FN  +   + K   DL     E+ ++E Y
Sbjct:  459 RKRQYRIGLNLFNKKPEKGVAYLMERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQRAFNRDVLDCVVDEMDFSGMELDEALRMFQAHIRVQGEAQKVERLIEAFSQRYCMCNPGVVKNFQNPDTIFILAFAIVLLNTDMYSPNVKPERKMKLDDFVKNLRGVDDGADIPREILVGIYERIQRGELKTNDDHVTQVANVEKTIVGKKPVIVLIHKNIQKVLSLPHRRLVCYCRLFEVPDPNRPQKLGLHQREIFLFNDLLVVTKIFHKRKHSTSYSFRQSFPLYGMQVHLFENQYYQHGIRLVSSTPGSETEILVIFNAPNPEDRKKFVEDLKESTSEVQEMEKY 806          
BLAST of SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: iqsec1b (IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Acc:ZDB-GENE-120813-1])

HSP 1 Score: 96.6709 bits (239), Expect = 1.164e-21
Identity = 63/237 (26.58%), Postives = 118/237 (49.79%), Query Frame = 1
Query:  715 SDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPK-------DLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTK----EKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            S  Y   NP +  +  N +TI ILA+ I++L+T +++     + K+  + F+   + + +   I  + L  +YE ++++++    D   QV  +  S+ G+ P         L   +R+ +C     E+    K      H R ++LFNDLL+VTK    +K+  +Y F++  SL G++V LF  ++Y HG++++  + G  T     FN  +   + K   DL   I E+ ++E +
Sbjct:    1 SQRYCLCNPDVVQQYHNPDTIFILAFAIILLNTDMYSPNVKPERKMRLDDFVKNLRGVDDGADIPREILVGIYERIQKQELRTNDDHVTQVTKVEKSIVGKKPVIPLHPFLALSLPHRRLVCYCRLFEVPDPTKPQKLGLHQREIFLFNDLLVVTKIFQRKKNAVMYSFRQSFSLYGMQVHLFENQFYPHGIKIMSAVPGAETKVLALFNAPNPQDRKKFVDDLKESIAEVQEMEKH 237          
BLAST of SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: iqsec1b (IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Acc:ZDB-GENE-120813-1])

HSP 1 Score: 94.3597 bits (233), Expect = 1.296e-21
Identity = 63/246 (25.61%), Postives = 118/246 (47.97%), Query Frame = 1
Query:  715 SDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFP----------------KDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTK----EKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            S  Y   NP +  +  N +TI ILA+ I++L+T +++     + K+  + F+   + + +   I  + L  +YE ++++++    D   QV  +  S+ G+ P                  L   +R+ +C     E+    K      H R ++LFNDLL+VTK    +K+  +Y F++  SL G++V LF  ++Y HG++++  + G  T     FN  +   + K   DL   I E+ ++E +
Sbjct:    1 SQRYCLCNPDVVQQYHNPDTIFILAFAIILLNTDMYSPNVKPERKMRLDDFVKNLRGVDDGADIPREILVGIYERIQKQELRTNDDHVTQVTKVEKSIVGKKPVMPATSRPSVRGHGDKNALSLPHRRLVCYCRLFEVPDPTKPQKLGLHQREIFLFNDLLVVTKIFQRKKNAVMYSFRQSFSLYGMQVHLFENQFYPHGIKIMSAVPGAETKVLALFNAPNPQDRKKFVDDLKESIAEVQEMEKH 246          
BLAST of SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001471.1 (pep scaffold:Pmarinus_7.0:GL477283:166775:173339:-1 gene:ENSPMAG00000001328.1 transcript:ENSPMAT00000001471.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.780e-18
Identity = 47/178 (26.40%), Postives = 93/178 (52.25%), Query Frame = 1
Query:  430 NRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLS---QPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRK 951
            NR   KG++FL+    +     +    LL  +G+S  + GE+L    +P N         ++ ++ F    +++ LR   + VR+ GE+Q +  ++E FS  Y   NP + S L +E+T+ +LA+ I++L+T +++       K+  + F+   + + + E I  DFL  +YE ++++
Sbjct:    1 NRKPEKGLAFLVSRGFVGATASAAAHFLLQRKGLSRQMIGEFLGNRQRPFNRDVLEVSRCFVDEMDFSGLELDEALRLFQTHVRLQGEAQKVERLVEVFSRRYCACNPAVVSALCSEDTVFVLAFAIVLLNTDMYSPSVRHDRKMRLDDFIKNLRGVDDGEDIPRDFLVGIYERIRKQ 178          
BLAST of SEC7 domain-containing protein vs. Ensembl Yeast
Match: SEC7 (Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors; involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles [Source:SGD;Acc:S000002577])

HSP 1 Score: 82.4185 bits (202), Expect = 7.061e-17
Identity = 60/208 (28.85%), Postives = 107/208 (51.44%), Query Frame = 1
Query:  355 DLDDPFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEED-PESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISD 972
            D DDP    N   R+  L+    IFN    K I  LI+   +++D P SI + LL +EG+ +   G+YL + ++    A  + ++ +  F   SI   LR      R+PGE Q +   +  F++ ++ QNP + SK    +T  +L+Y ++ML+T +H+  +  K+K++ + FL   + I     +  DFL  L+  +   ++ +IS+
Sbjct:  814 DADDPTQFENLKLRKTALSECIAIFNNKPKKAIPVLIKKGFLKDDSPISIAKWLLETEGLDMAAVGDYLGEGDDK-NIAIMHAFVDEFDFTGMSIVDALRSFLQSFRLPGEGQKIDRFMLKFAERFVDQNPGVFSK---ADTAYVLSYSLIMLNTDLHS--SQIKNKMSLQEFLENNEGIDNGRDLPRDFLEGLFNEIANNEIKLISE 1015          
BLAST of SEC7 domain-containing protein vs. Ensembl Yeast
Match: GEA2 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA2 has a paralog, GEA1, that arose from the whole genome duplication [Source:SGD;Acc:S000000748])

HSP 1 Score: 62.3882 bits (150), Expect = 1.242e-10
Identity = 45/177 (25.42%), Postives = 76/177 (42.94%), Query Frame = 1
Query:  370 FDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLLNSEGISVFVKGEYLSQPNNSLAKAT-------------KNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLK------------NENTIVILAYGILMLHTGVHN 825
             ++L   +R+       N FN    KGI  LI+   I  D +  +              E+L   NN + K T              N+Y++   F    +++ +R L ++ R+PGESQ +  I+E FS  Y     +  SK+             + +++ IL+Y I+ML+T +HN
Sbjct:  551 MEILKKRDRKTEFIECTNAFNEKPKKGIPMLIEKGFIASDSDKDI-------------AEFLFNNNNRMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQDYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHN 714          
BLAST of SEC7 domain-containing protein vs. Ensembl Yeast
Match: GEA1 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA1 has a paralog, GEA2, that arose from the whole genome duplication [Source:SGD;Acc:S000003792])

HSP 1 Score: 59.6918 bits (143), Expect = 8.860e-10
Identity = 52/221 (23.53%), Postives = 100/221 (45.25%), Query Frame = 1
Query:  373 DVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR---LLNSEGISVFVKGEYLSQPN-NSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNE----------------------NTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKM 957
            D+L   +R+    L    FN    KGI  LI+   I+ D    +     LN+  ++    G  L  P   SL K    +++    F+   +++ +R L ++ R+PGESQ +  I+E FS +Y     +   +L+++                      +++ +L+Y I+ML+T  HN     KD +T + + +  +  Y  +     +L ++Y ++K K++
Sbjct:  534 DILKQRDRKTEFILCVETFNEKAKKGIQMLIEKGFIDSDSNRDIASFLFLNNGRLNKKTIGLLLCDPKKTSLLK----EFIDLFDFKGLRVDEAIRILLTKFRLPGESQQIERIVEAFSSKYSADQSNDKVELEDKKAGKNGSESMTEDDIIHVQPDADSVFVLSYSIIMLNTDSHNPQV--KDHMTFDDYSNNLRGCYNGKDFPRWYLHKIYTSIKVKEI 748          
BLAST of SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO34882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN35])

HSP 1 Score: 154.066 bits (388), Expect = 5.541e-41
Identity = 99/354 (27.97%), Postives = 178/354 (50.28%), Query Frame = 1
Query:  343 MIHSDLDDPFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLLNSE-GISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFI-CVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG-------IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLE 1377
            MI S   DP    +   ++  + +G N FNR   KG+++LI H +I+++PE++ + L SE G+S    GEYL    N    A    + +   F    I+  LR   +Q RIPGE+Q +  ++E F+++Y+  NP  +     ++ ++ILA+ I+ML+T +H+    K  ++T+E F+   +         ++ L  +Y  V +K+ +   D       +   + G+ P   +    +++  +    EI   NKK    +H RV+++FND+++VTKE+ +         Y +K    LSG+++ +F+ +YY  G++L   LQ      FN  DE  +     +L   I+E   +E
Sbjct:   15 MIQSSEFDPVPAADLKPQKLEMRIGINQFNRKPEKGVTYLIAHQVIDDNPEAVAKFLLSEHGVSKQRLGEYLGNLQNDFNMAVLKCFAESFDFTGMEIDVALRTFLAQFRIPGEAQKIERLMEVFAEQYISCNP--TDDTSAQDKVLILAFAIVMLNTDLHSPNVKK--RMTQEDFIRNLEGTNNGGNFPSESLAGIYRRVFKKEFTPARDHVTMTAKLEKKIVGKMPWTTLAALHRYLRMLTPLFEIRDPNKK--EKTHPRVIFVFNDMIVVTKERGRPGQRDGYHFYSYKHSFLLSGVKISVFTNDYYPWGIQLYSRLQSQVVATFNATDERTRKVFVEELLECIEETNAME 362          
BLAST of SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO38004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA8])

HSP 1 Score: 93.2041 bits (230), Expect = 1.437e-20
Identity = 58/212 (27.36%), Postives = 108/212 (50.94%), Query Frame = 1
Query:  373 DVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMS 1005
            DV     + +   +GK  F+ +  KGI +L+ H ++   PE +   LL  EG++    G YL + N         K++    F+D  + + LR+     R+PGE+Q +  ++E F+ +Y   NP +     + +T  +L++ I++L+T +HN     KDK T E F+ + + I   E ++ DFL  LY+++K ++  +  D    + + F +
Sbjct:   50 DVTGEDPKMKQKQIGKKKFSMDPQKGIDYLVMHGLLNNTPEDLADFLLKEEGLNKTQIGNYLGE-NKEFNLDVFAKFVDLHKFKDMILVQALRQFLWSFRLPGEAQKIDRMMEAFAQKYCADNPGL---FTSTDTCYVLSFAIILLNTSLHNPNV--KDKPTVEKFIQMNRGINCGEDLDRDFLVALYDSIKSEEFKIPEDDGSDITHTFFN 255          
BLAST of SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO31538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXN1])

HSP 1 Score: 87.4261 bits (215), Expect = 5.110e-18
Identity = 55/206 (26.70%), Postives = 104/206 (50.49%), Query Frame = 1
Query:  391 ERRRLLTLGKNIFNRNCNKGISFLIQHNIIEE--DPESIVRLLNSEG-ISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIF 999
            +R++LL  G   FN    KGI FL +H ++    DPE + RLL     +     GEY+ + +NS      + +++   F D  +++GLR+     R+PGES  +  I+E FS+ +   NP + +   N++ +  LAY ++ML+   HN    ++  +  E F    + I          L E++  +K +++ + ++ T ++R+ +
Sbjct:  675 QRKKLLQAGSEHFNNKPKKGIEFLQEHGLLHTPLDPEEMARLLRENPRLDKKTIGEYIGKKDNS---KVLDAFVRSFEFHDLRVDEGLRQFLESFRLPGESPVIEHIMEFFSEVFFECNPEVYA---NKDAVFTLAYAVIMLNVDQHNANIKQQKPMVLEDFKRNLRKINGGNDFPATMLEEIFTCIKNEEIVMPAERTGRIRDTY 874          
BLAST of SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO41902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S350])

HSP 1 Score: 77.411 bits (189), Expect = 6.542e-15
Identity = 52/200 (26.00%), Postives = 100/200 (50.00%), Query Frame = 1
Query:  382 NNPER-------RRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLLNS-EGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKM 957
            +NPE+       + L+  G   FN+N  KG+ FL ++ ++      +   L+  E +     GE +   N+  +K    +Y+ K+ F D      LR   +  R+PGE+Q +  ++E F+  Y   NP+ +S   + +   +LAY I+ML T +HN     K K+TKE +  + + I + + +  ++L  +Y+ ++  ++
Sbjct:  669 DNPEQFESLKQMKGLMEQGIAKFNKNPKKGMKFLQENGLLGMSAGEVAEFLHGDERLDKMQIGELIGD-NDDFSKQVMYEYVDKLDFTDMEFVSSLRLFLTNFRLPGEAQKIDRLMEKFASRYFDTNPN-NSVFASADAAYVLAYSIIMLTTDLHN--PQVKRKITKEQYCSMNRGINDSKDLPQEYLEGIYDEIQHNEI 864          
BLAST of SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO29369 (pep supercontig:ASM20922v1:NEMVEscaffold_1160:24851:31523:-1 gene:NEMVEDRAFT_v1g144802 transcript:EDO29369 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 3.806e-11
Identity = 33/113 (29.20%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  667 RIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMS 1005
            R+PGE+Q +  ++E F+ +Y   NP +     + +T  +L++ I++L+T +HN     KDK T E F+ + + I   E ++ DFL  LY+++K ++  +  D    + + F +
Sbjct:    8 RLPGEAQKIDRMMEAFAQKYCADNPGL---FTSTDTCYVLSFAIILLNTSLHN--PNVKDKPTVEKFIQMNRGINCGEDLDRDFLVALYDSIKSEEFKIPEDDGSDITHTFFN 115          
BLAST of SEC7 domain-containing protein vs. Ensembl Medaka
Match: iqsec2b (IQ motif and Sec7 domain ArfGEF 2 [Source:NCBI gene;Acc:101171165])

HSP 1 Score: 155.221 bits (391), Expect = 8.900e-40
Identity = 101/360 (28.06%), Postives = 179/360 (49.72%), Query Frame = 1
Query:  349 HSDLDDPF--DVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ-----KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            HS    PF  DV+    +RR   +G N+FN+   KGI +LI+   + + P  I R +L  +G+S  + GE+L        K   +  L ++ F    I+  LR+  +Q+R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + +   + I  D L  +Y+ +++ ++    D   QV+ +   + G+ P   +       +R+ +C     E+   N+   +  H R ++LFNDLL+VT    K+K+   Y F++   L  ++V +F   YY HG+RL     G      I F    +  + +  SDL   I E+ ++E Y
Sbjct:  449 HSWDSPPFNSDVV----QRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDIDDALRKFQAQIRVQGEAQKVERLIEAFSQRYCVCNPTLVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPVSSVMCVLSLPHRRLVCCCQLYEVPDPNRPQRTGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYPHGIRLTSASLGGERKVLIVFMAPSQQDRTRFVSDLRESIAEVQEMEKY 804          
BLAST of SEC7 domain-containing protein vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 154.836 bits (390), Expect = 1.159e-39
Identity = 96/347 (27.67%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +L +   I + P  +   LL  +G+S  + GE+L        +   +  + ++ FQ   +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   I E+ ++E Y
Sbjct:  588 RKRHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICNPTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKY 934          
BLAST of SEC7 domain-containing protein vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 154.451 bits (389), Expect = 1.507e-39
Identity = 96/347 (27.67%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +L +   I + P  +   LL  +G+S  + GE+L        +   +  + ++ FQ   +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   I E+ ++E Y
Sbjct:  547 RKRHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICNPTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKY 893          
BLAST of SEC7 domain-containing protein vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 154.451 bits (389), Expect = 1.521e-39
Identity = 96/347 (27.67%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +L +   I + P  +   LL  +G+S  + GE+L        +   +  + ++ FQ   +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   I E+ ++E Y
Sbjct:  529 RKRHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICNPTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKY 875          
BLAST of SEC7 domain-containing protein vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 154.451 bits (389), Expect = 1.629e-39
Identity = 96/347 (27.67%), Postives = 178/347 (51.30%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQ---------KYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNT---IHFNFKDEWVKVKMQSDLSIYIDEIFQLEAY 1383
            R+R   +G N+FN+   KGI +L +   I + P  +   LL  +G+S  + GE+L        +   +  + ++ FQ   +++ LR+  + +R+ GE+Q +  ++E FS  Y   NP +  + +N +TI ILA+ I++L+T +++     + K+  E F+   + + + E I  + L  +YE ++++++    D   QV+ +   + G+ P   +           +R+ +C     E+   NK      H R ++LFNDLL+VT    K+K+   Y F++  SL G++V LF  +YY +G+RL   + G +    I+FN  +   + K   DL   I E+ ++E Y
Sbjct:  640 RKRHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICNPTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKY 986          
BLAST of SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000081851.1 (SMESG000081851.1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 452/454 (99.56%), Postives = 453/454 (99.78%), Query Frame = 1
Query:   40 MVTIKHKDPEFMNNRARAAISLYLMDHFVESKRIEFLENIYGGKVAAHRSAKIIQRYFRNYKAGKLIKPSTSDLPPLSPNXXXXXXXXXXXXXXXXXXXVDMIHSDLDDPFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYFSQENT 1401
            MVTIKHKDPEFMNNRARAAISLYLMDHFVESKRIEFLENIYGGKVAAHRSAKIIQRYFRNYKAGKLIKPSTSDLPPLSPNLSIDTSITSDSLSEISLDSVDMIHSDLDDPFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPE IVRLLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYF+QENT
Sbjct:    1 MVTIKHKDPEFMNNRARAAISLYLMDHFVESKRIEFLENIYGGKVAAHRSAKIIQRYFRNYKAGKLIKPSTSDLPPLSPNLSIDTSITSDSLSEISLDSVDMIHSDLDDPFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPEFIVRLLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYFAQENT 454          
BLAST of SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000057299.1 (SMESG000057299.1)

HSP 1 Score: 184.496 bits (467), Expect = 3.295e-50
Identity = 111/301 (36.88%), Postives = 175/301 (58.14%), Query Frame = 1
Query:  391 ERR--RLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKL-KNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRF-PKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGI-YRFKRVISLSGLRVELFSAEYYGHGLRL 1263
            ERR  RL  +  NIFN+N  KG+S+LI+   +E  P  + + L++ +GIS F  G+YL    + LA  T   +++ +  ++  I+  LR L S  +IPGESQ + SI+E F + Y+ QN     ++ KN +TI+ILAY I+MLHT ++N    K+ K++KE F+H  + + + + IN + L  +Y+ +K  +M   SD TDQVR I    +G   P++L Q +R+ +C     E+    KK    +H R ++LFNDLL++T    K K  G+ Y+ +  ISL  + + LF   YY  G++L
Sbjct:  352 ERRHKRLYRICLNIFNKNSLKGVSYLIRFKFVEPSPNILAKFLMSRKGISRFSIGDYLGHTKDDLATETLKFFVRMVDMRNKEIDIALRHLLSFFQIPGESQKIKSIMEEFQESYMEQNQQFWPQICKNPDTIMILAYAIIMLHTDMYNPNIRKQHKMSKEEFIHNLRNVDDGQDINPNILTAIYDRIKTAEMKTFSDHTDQVRKIDQHFSGHLRPRNLNQPHRRLVCYCRLFEVIDCYKKDRIGAHQREVFLFNDLLVITKGVQKRKKDGVMYQCRNTISLGKVEIYLFETIYYPFGIQL 652          
BLAST of SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000057299.1 (SMESG000057299.1)

HSP 1 Score: 184.111 bits (466), Expect = 4.235e-50
Identity = 111/301 (36.88%), Postives = 175/301 (58.14%), Query Frame = 1
Query:  391 ERR--RLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKL-KNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRF-PKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVT----KEKSKGI-YRFKRVISLSGLRVELFSAEYYGHGLRL 1263
            ERR  RL  +  NIFN+N  KG+S+LI+   +E  P  + + L++ +GIS F  G+YL    + LA  T   +++ +  ++  I+  LR L S  +IPGESQ + SI+E F + Y+ QN     ++ KN +TI+ILAY I+MLHT ++N    K+ K++KE F+H  + + + + IN + L  +Y+ +K  +M   SD TDQVR I    +G   P++L Q +R+ +C     E+    KK    +H R ++LFNDLL++T    K K  G+ Y+ +  ISL  + + LF   YY  G++L
Sbjct:  370 ERRHKRLYRICLNIFNKNSLKGVSYLIRFKFVEPSPNILAKFLMSRKGISRFSIGDYLGHTKDDLATETLKFFVRMVDMRNKEIDIALRHLLSFFQIPGESQKIKSIMEEFQESYMEQNQQFWPQICKNPDTIMILAYAIIMLHTDMYNPNIRKQHKMSKEEFIHNLRNVDDGQDINPNILTAIYDRIKTAEMKTFSDHTDQVRKIDQHFSGHLRPRNLNQPHRRLVCYCRLFEVIDCYKKDRIGAHQREVFLFNDLLVITKGVQKRKKDGVMYQCRNTISLGKVEIYLFETIYYPFGIQL 670          
BLAST of SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000042180.1 (SMESG000042180.1)

HSP 1 Score: 168.318 bits (425), Expect = 1.495e-44
Identity = 108/333 (32.43%), Postives = 182/333 (54.65%), Query Frame = 1
Query:  394 RRRLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVR-LLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTG-RFPKDLIQKYRKFICVYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKSKG----IYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQL 1374
            ++R+  +G N+FNRN   GI++LI++  I+  P  I + LL   GIS    G+Y+   N+ LA      +L++I+ ++  +++ LR     V +PGESQ +  ++E F + Y+ QN    S+ K+ +TI++LAY I+ML T  HN    K +K+T E F++  + + E   I+ + L  +Y  V  K++  + D TDQVR +   + G   P DL+ + R+F+C    +EI   NKK    +H R ++LFNDLL++TK ++K      Y+ +  + L  L+V+ F    Y  G+ L++     + I  N   +  + K   DLS  I E  ++
Sbjct:  368 QKRMYRVGLNLFNRNPVVGINYLIKNQFIKPHPSHIAKFLLTKNGISRNAVGDYIGLLNDPLALQVTKYFLRRINMKNKEVDEALRSFIYYVHLPGESQKISHLMEEFKETYVHQNDR--SQFKSLDTIMVLAYAIIMLQTDAHNLSIKKNEKMTLEQFVNNLRGVDENNDIDRNILEPIYMRVTGKELKTMPDHTDQVRRLNDIICGPNKPADLVNRVRRFMCYCRLSEIVDDNKKNKPAAHQREVFLFNDLLMITKLQNKSRKEDQYQCRYALPLVDLQVKQFRMTNYEFGIHLMKRKANESIIKLNALCQLDQKKFFFDLSDCIFESLEM 698          
BLAST of SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000053199.1 (SMESG000053199.1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.486e-15
Identity = 50/184 (27.17%), Postives = 87/184 (47.28%), Query Frame = 1
Query:  400 RLLTLGKNIFNRNCNKGISFLIQHNIIEEDPESIVRLLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILAYGILMLHTGVHNKCAAKKDK--LTKESFLHLFKCIYEEEIINNDFLGELYENVK 945
            R L +G   FN N  +GI +L+    I+E P++I   L  + ++    G+YL   +         +Y+    F +      +R   S   +PGESQ +  I+  ++  Y  QNP I    KNEN   I+ Y ++ML+T +HN  A K++     +E F+ +      +      F+  +++N+K
Sbjct:   59 RNLRIGTKKFNHNPEEGIEYLVSKKAIQETPKAIATFLTDKSLNKRAVGDYLGNISKPFNCDVLQEYISLFDFSEMEFIDSIRFFLSGFHLPGESQKIDKIISLWAKYYHEQNPSI---FKNENETYIMTYAVIMLNTCLHNPTAKKENGGFGREEDFIKIMGNFNSDTQFELSFVKRIFKNIK 239          
The following BLAST results are available for this feature:
BLAST of SEC7 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQSEC38.610e-4028.87IQ motif and Sec7 domain ArfGEF 3 [Source:HGNC Sym... [more]
IQSEC38.610e-4028.87IQ motif and Sec7 domain ArfGEF 3 [Source:HGNC Sym... [more]
IQSEC12.172e-3926.80IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
IQSEC12.348e-3926.80IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
IQSEC13.709e-3926.80IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bris-18.963e-2423.30BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-19.769e-2423.30BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-11.218e-2323.30BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-11.921e-2323.30BRag/Iqsec/Schizo related Arf GEF family member [... [more]
grp-18.514e-1827.92GTP exchange factor for ARFs 1 [Source:UniProtKB/... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
siz6.797e-4129.64gene:FBgn0026179 transcript:FBtr0078289[more]
siz1.094e-4029.64gene:FBgn0026179 transcript:FBtr0111038[more]
siz1.183e-4029.64gene:FBgn0026179 transcript:FBtr0301602[more]
siz1.333e-4029.64gene:FBgn0026179 transcript:FBtr0078290[more]
step1.811e-1825.81gene:FBgn0086779 transcript:FBtr0085910[more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iqsec2a2.261e-4328.61IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a1.648e-4128.40IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a1.885e-4128.40IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a5.529e-4128.40IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a5.640e-4128.40IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abo.22.570e-4028.87ABO blood group (transferase A, alpha 1-3-N-acetyl... [more]
abo.27.450e-4028.87ABO blood group (transferase A, alpha 1-3-N-acetyl... [more]
abo.22.877e-3928.87ABO blood group (transferase A, alpha 1-3-N-acetyl... [more]
abo.23.333e-3928.87ABO blood group (transferase A, alpha 1-3-N-acetyl... [more]
IQSEC27.728e-3726.63IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iqsec33.475e-3929.17IQ motif and Sec7 domain 3 [Source:MGI Symbol;Acc:... [more]
Iqsec12.202e-3826.80IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:... [more]
Iqsec12.293e-3826.80IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:... [more]
Iqsec12.709e-3826.80IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:... [more]
Iqsec23.614e-3626.92IQ motif and Sec7 domain 2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SEC7 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DN90|IQEC1_HUMAN2.026e-3826.80IQ motif and SEC7 domain-containing protein 1 OS=H... [more]
sp|Q3TES0|IQEC3_MOUSE2.431e-3829.17IQ motif and SEC7 domain-containing protein 3 OS=M... [more]
sp|Q9UPP2|IQEC3_HUMAN2.531e-3828.87IQ motif and SEC7 domain-containing protein 3 OS=H... [more]
sp|Q76M68|IQEC3_RAT2.979e-3829.17IQ motif and SEC7 domain-containing protein 3 OS=R... [more]
sp|Q8R0S2|IQEC1_MOUSE1.540e-3726.80IQ motif and SEC7 domain-containing protein 1 OS=M... [more]
back to top
BLAST of SEC7 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P4891.102e-4934.98SEC7 domain-containing protein OS=Schistocephalus ... [more]
A0A183ND202.321e-4936.57SEC7 domain-containing protein OS=Schistosoma matt... [more]
A0A2L2Y4261.450e-4830.79IQ motif and SEC7 domain-containing protein 1 (Fra... [more]
A0A2L2Y4K01.749e-4830.79IQ motif and SEC7 domain-containing protein 1 (Fra... [more]
A0A4E0RD192.847e-4833.33IQ motif and SEC7 domain-containing protein 1 OS=F... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iqsec2a5.319e-4127.48IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a1.181e-4027.48IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a1.183e-4027.48IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec1b6.788e-4027.38IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Ac... [more]
iqsec2b9.177e-4027.76IQ motif and Sec7 domain ArfGEF 2b [Source:ZFIN;Ac... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007609.11.803e-4027.11pep scaffold:Pmarinus_7.0:GL477333:80854:108205:-1... [more]
iqsec1b7.428e-4026.72IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Ac... [more]
iqsec1b1.164e-2126.58IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Ac... [more]
iqsec1b1.296e-2125.61IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Ac... [more]
ENSPMAT00000001471.11.780e-1826.40pep scaffold:Pmarinus_7.0:GL477283:166775:173339:-... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SEC77.061e-1728.85Guanine nucleotide exchange factor (GEF) for ADP r... [more]
GEA21.242e-1025.42Guanine nucleotide exchange factor for ADP ribosyl... [more]
GEA18.860e-1023.53Guanine nucleotide exchange factor for ADP ribosyl... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348825.541e-4127.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380041.437e-2027.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315385.110e-1826.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419026.542e-1526.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293693.806e-1129.20pep supercontig:ASM20922v1:NEMVEscaffold_1160:2485... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iqsec2b8.900e-4028.06IQ motif and Sec7 domain ArfGEF 2 [Source:NCBI gen... [more]
IQSEC11.159e-3927.67IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
IQSEC11.507e-3927.67IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
IQSEC11.521e-3927.67IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
IQSEC11.629e-3927.67IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
back to top
BLAST of SEC7 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081851.10.000e+099.56SMESG000081851.1[more]
SMESG000057299.13.295e-5036.88SMESG000057299.1[more]
SMESG000057299.14.235e-5036.88SMESG000057299.1[more]
SMESG000042180.11.495e-4432.43SMESG000042180.1[more]
SMESG000053199.11.486e-1527.17SMESG000053199.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025408 ID=SMED30025408|Name=SEC7 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1542bp
CTATATAAATCTTATATGATTTGTTAACAATAATTCATAATGGTTACAAT
TAAACATAAAGATCCGGAATTTATGAATAATCGAGCCAGAGCAGCTATTT
CACTTTATCTAATGGATCACTTTGTTGAATCGAAAAGAATTGAATTTTTA
GAAAATATTTATGGTGGAAAAGTTGCCGCTCATAGATCAGCCAAAATTAT
TCAACGATATTTTCGCAACTATAAAGCTGGGAAATTAATAAAACCGTCTA
CTTCAGATCTGCCACCACTTTCACCTAATTTATCAATAGATACCTCAATA
ACCAGTGATAGTTTATCCGAAATTTCTCTTGATTCTGTGGATATGATACA
TAGTGATTTAGATGATCCGTTTGATGTTTTAAATAACCCGGAAAGAAGGC
GTTTGCTTACTCTGGGGAAAAATATTTTTAATAGAAATTGCAACAAAGGT
ATTAGTTTTCTCATTCAACACAACATTATAGAAGAAGATCCAGAATCTAT
TGTACGTCTTTTGAATAGTGAAGGTATAAGTGTATTCGTCAAGGGTGAAT
ATTTGAGTCAGCCTAATAATAGCTTAGCAAAAGCAACTAAAAACAAATAT
TTAAAGAAAATATCCTTTCAAGATTGTTCAATTGAAAAAGGCTTACGACG
ATTATTTTCTCAAGTCCGAATTCCGGGAGAATCTCAGAATTTAGTAAGCA
TCCTAGAAGGTTTTTCTGATGAATATTTATTTCAAAATCCTCATATAAGT
TCAAAATTAAAAAATGAAAACACAATTGTAATACTTGCATATGGTATATT
AATGCTCCACACTGGTGTTCACAATAAATGTGCTGCAAAAAAAGATAAAC
TTACAAAAGAAAGTTTTTTGCACCTTTTCAAATGTATATATGAAGAAGAA
ATTATCAATAACGATTTTCTTGGTGAACTATATGAAAATGTAAAGAGAAA
AAAAATGTCAGTAATTTCTGATATTACGGATCAGGTTCGCAATATATTCA
TGTCACTAACTGGCCGTTTTCCAAAAGATCTAATACAAAAATACCGAAAA
TTTATATGCGTATATTCTTGCAATGAAATTTATCAAATTAATAAAAAACC
GGATTCCCATTCTCATAGTCGAGTATTATACCTTTTTAATGACTTACTTC
TAGTTACTAAAGAGAAATCTAAAGGAATATATAGATTCAAACGGGTTATT
TCTCTATCTGGTCTACGGGTTGAATTATTCTCAGCAGAATATTACGGGCA
TGGATTGAGACTTATTGAAACCCTTCAAGGAAACAATACCATACATTTTA
ATTTTAAAGATGAATGGGTCAAAGTTAAAATGCAATCGGATCTGTCAATT
TATATAGATGAAATTTTTCAACTTGAAGCATATTTCTCTCAAGAGAATAC
CTAAGAAAAGCAAGAATGAATTCAGTTTTGCTGACATTGGCTTGTCTCTT
TGCTTATCTCATAATATTTTGTGCAAATTGATATTTTTGTTATTTTGCTA
TATAAATGAAACAAGATAATTATTGAAAATCTTTGATAATTG
back to top

protein sequence of SMED30025408-orf-1

>SMED30025408-orf-1 ID=SMED30025408-orf-1|Name=SMED30025408-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=455bp
MVTIKHKDPEFMNNRARAAISLYLMDHFVESKRIEFLENIYGGKVAAHRS
AKIIQRYFRNYKAGKLIKPSTSDLPPLSPNLSIDTSITSDSLSEISLDSV
DMIHSDLDDPFDVLNNPERRRLLTLGKNIFNRNCNKGISFLIQHNIIEED
PESIVRLLNSEGISVFVKGEYLSQPNNSLAKATKNKYLKKISFQDCSIEK
GLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISSKLKNENTIVILA
YGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYEN
VKRKKMSVISDITDQVRNIFMSLTGRFPKDLIQKYRKFICVYSCNEIYQI
NKKPDSHSHSRVLYLFNDLLLVTKEKSKGIYRFKRVISLSGLRVELFSAE
YYGHGLRLIETLQGNNTIHFNFKDEWVKVKMQSDLSIYIDEIFQLEAYFS
QENT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR033742IQSEC_PH
IPR035999Sec7_dom_sf
IPR000904Sec7_dom
IPR023394Sec7_C_sf
IPR001849PH_domain
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0032012regulation of ARF protein signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005086ARF guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000904Sec7 domainSMARTSM00222sec7_5coord: 116..306
e-value: 2.2E-23
score: 93.7
IPR000904Sec7 domainPFAMPF01369Sec7coord: 120..305
e-value: 1.3E-35
score: 122.7
IPR000904Sec7 domainPROSITEPS50190SEC7coord: 112..304
score: 23.45
IPR033742IQ motif and SEC7 domain-containing protein, PH domainPFAMPF16453IQ_SEC7_PHcoord: 331..448
e-value: 3.7E-20
score: 72.3
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 327..452
e-value: 5.2E-24
score: 86.6
IPR023394Sec7, C-terminal domain superfamilyGENE3DG3DSA:1.10.1000.11coord: 193..309
e-value: 7.8E-25
score: 88.9
NoneNo IPR availableGENE3DG3DSA:1.10.220.20coord: 101..192
e-value: 9.7E-10
score: 40.1
NoneNo IPR availablePANTHERPTHR10663:SF342FI21420P1coord: 106..447
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 106..447
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 317..430
IPR035999Sec7 domain superfamilySUPERFAMILYSSF48425Sec7 domaincoord: 118..311