Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2

Overview
NameRetrovirus-related Pol polyprotein from type-1 retrotransposable element R2
Smed IDSMED30025406
Length (bp)4809
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30025406) t-SNE clustered cells

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30025406) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30025406) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (SMED30025406) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025406

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025406SMESG000010825.1 Contig2265newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025406SMESG000017213.1 Contig2265newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30025406SMESG000061623.1 SMESG000041246.1 SMESG000010825.1 dd_Smed_v4_13241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025406SMESG000071708.1 SMESG000061623.1 SMESG000060519.1 SMESG000059054.1 SMESG000033494.1 SMESG000019964.1 SMESG000015116.1 SMESG000014208.1 SMESG000008378.1 Contig13501newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025406SMESG000071708.1 SMESG000061623.1 SMESG000060519.1 SMESG000059054.1 SMESG000033494.1 SMESG000019964.1 SMESG000015116.1 SMESG000014208.1 SMESG000008378.1 Contig13501uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025406SMESG000061623.1 SMESG000041246.1 SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000014208.1 SMESG000010825.1 Contig46662newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025406SMESG000061623.1 SMESG000041246.1 SMESG000024947.1 SMESG000024945.1 SMESG000024886.1 SMESG000014208.1 SMESG000010825.1 Contig46662uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30025406SMESG000061623.1 SMESG000041246.1 SMESG000014208.1 Contig29920uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30025406SMESG000061623.1 SMESG000041246.1 SMESG000014208.1 Contig29920newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30025406SMESG000078596.1 SMESG000067305.1 SMESG000046455.1 SMESG000044750.1 SMESG000029087.1 SMESG000014208.1 SMESG000002398.1 Contig47584newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025406SMESG000078596.1 SMESG000067305.1 SMESG000046455.1 SMESG000044750.1 SMESG000029087.1 SMESG000014208.1 SMESG000002398.1 Contig47584uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025406SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025406SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: CU462878.3 (pep chromosome:GRCz11:17:8542203:8545189:1 gene:ENSDARG00000103562.2 transcript:ENSDART00000158873.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU462878.3)

HSP 1 Score: 74.3294 bits (181), Expect = 1.132e-12
Identity = 53/164 (32.32%), Postives = 85/164 (51.83%), Query Frame = 1
Query: 3763 NTSPGIDGIQYKDLALLDPE-GILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFI 4251
            N +PG DG   +      P+   +L   FN ++    IP SW+     +IPK  K  N  + SS+RPI++L+V YK+FASIL+ RL   V+ ++++ + Q G   +    ++       + H      S + ++ LD + AF SV  DYL+ VL   G + +FI
Sbjct:  282 NKTPGTDGYPSEMYKTFKPQITPMLLKCFNYVLRGGEIPQSWQEAVISIIPKQGKDKN--ECSSYRPISVLNVDYKLFASILSKRLE--VVISELVDLDQTGFIQNRQTQDNLRRTLQIMSHITTENISAMLLS-LDAEKAFDSVGWDYLYQVLARFGFNNKFI 440          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: CR848788.1 (pep chromosome:GRCz11:16:5607138:5612480:-1 gene:ENSDARG00000103037.2 transcript:ENSDART00000157944.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR848788.1)

HSP 1 Score: 71.2478 bits (173), Expect = 9.938e-12
Identity = 66/215 (30.70%), Postives = 106/215 (49.30%), Query Frame = 1
Query: 3673 ILKDCRSTTNVLNLVDILPFEVIYELKRA----DNTSPGIDGIQYKDLALLDPEGILLSF-MFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIA-WLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKITNEKFHLIFGR 4299
            +LK  ++T N L+L     F  ++ELKRA      T+PG D I YK L+ +    + +   +FN+I     +P +WK    + I KP K  N    SS+RPI+L S + K+   ++T R+T ++   ++    Q G  F  G    +S+L    +  K   N  + IA + DI+ A+  +  + L   LK++GV+G      K  N     +FGR
Sbjct:  426 LLKKVKTTENPLDL----QFN-MFELKRAIISARQTAPGKDEICYKMLSHMSEASLEIVLNLFNQIWDMGQLPIAWKQSIVVPILKPGK--NPSDPSSYRPISLTSHLCKIMERMITERITYFLESKNLFSPYQSG--FRRGRNTMDSVLCLESDIRKAQTNKEVVIAIFFDIEKAYDMLWKEGLLIKLKSLGVTG------KTYNWVMDFLFGR 625          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: BX908731.1 (pep chromosome:GRCz11:22:17838913:17844117:-1 gene:ENSDARG00000099201.2 transcript:ENSDART00000159363.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX908731.1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.002e-11
Identity = 66/215 (30.70%), Postives = 106/215 (49.30%), Query Frame = 1
Query: 3673 ILKDCRSTTNVLNLVDILPFEVIYELKRA----DNTSPGIDGIQYKDLALLDPEGILLSF-MFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIA-WLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKITNEKFHLIFGR 4299
            +LK  ++T N L+L     F  ++ELKRA      T+PG D I YK L+ +    + +   +FN+I     +P +WK    + I KP K  N    SS+RPI+L S + K+   ++T R+T ++   ++    Q G  F  G    +S+L    +  K   N  + IA + DI+ A+  +  + L   LK++GV+G      K  N     +FGR
Sbjct:  426 LLKKVKTTENPLDL----QFN-MFELKRAIISARQTAPGKDEICYKMLSHMSEASLEIVLNLFNQIWDMGQLPIAWKQSIVVPILKPGK--NPSDPSSYRPISLTSHLCKIMERMITERITYFLESKNLFSPYQSG--FRRGRNTMDSVLCLESDIRKAQTNKEVVIAIFFDIEKAYDMLWKEGLLIKLKSLGVTG------KTYNWVMDFLFGR 625          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: BX511246.1 (pep chromosome:GRCz11:23:9353552:9357627:1 gene:ENSDARG00000100234.2 transcript:ENSDART00000163298.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511246.1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.280e-10
Identity = 58/179 (32.40%), Postives = 89/179 (49.72%), Query Frame = 1
Query: 3736 VIYELKRADNTSPGIDGIQ---YKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSK--NSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
             ++ +K+  N SPGIDG     Y     L  + +L+  ++N+ I+ K + T+ K     LIPKP+K      + +WRPI LL+V YK+ A + + RL + +  N I+   Q G  F  G    N+I    L+   Y+   NS   I +LD   AF ++ H +L   LK  G    FI +
Sbjct:  465 ALFSMKK--NKSPGIDGFSVEFYTHFWYLIQDILLM--LYNECIAEKEMSTTMKQGIISLIPKPEKDSLL--IDNWRPITLLTVDYKILALVFSNRLKTKL--NLIITESQSG--FLNGRHISNNI-RLVLDLIDYADFINSKAIIFFLDFYKAFDTIEHKFLLHSLKKFGFGSTFINV 632          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Match: BX284696.1 (pep chromosome:GRCz11:7:42935126:42939263:1 gene:ENSDARG00000099710.2 transcript:ENSDART00000157747.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX284696.1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.307e-10
Identity = 56/179 (31.28%), Postives = 87/179 (48.60%), Query Frame = 1
Query: 3736 VIYELKRADNTSPGIDGIQ---YKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSK--NSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
             ++ +K+  N SPGIDG     Y     L  + +L+  ++N+ I+ K + T+ K     LIPKP+K      + +WRPI LL+V YK+ A + + RL + +     L I +    F  G    N+I    L+   Y+   NS   I +LD   AF ++ H +L   LK  G    FI +
Sbjct:  465 ALFSMKK--NKSPGIDGFSVEFYTHFWYLIQDILLI--LYNECIAEKEMSTTMKQGIISLIPKPEKDSLL--IDNWRPITLLTVDYKILALVFSNRLKTKL----NLMITESQSGFLNGRHISNNI-RLVLDLIDYADFINSKAIIFFLDFYKAFDTIEHKFLLHSLKKFGFGSTFINV 632          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: lrsam1 (leucine rich repeat and sterile alpha motif containing 1 [Source:Xenbase;Acc:XB-GENE-994894])

HSP 1 Score: 67.0106 bits (162), Expect = 1.650e-10
Identity = 67/228 (29.39%), Postives = 101/228 (44.30%), Query Frame = 1
Query: 3595 VTVRPEIQDILNQF-----SHEDPVSN-SWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPE-GILLSFMFNKIISSKIIPTSWKT------FKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVS 4239
            VT   E  D+LNQF     + E+PV   S N        TT  L    +L       +    N +PG DGI  + L  L  E    L  +F+  +SS ++P+ WK       FK  +  +P          ++RP++L SV+ K+F  +L   + ++V+ N I+   Q G      C + N I        K      + I +LD   AF +VPH  L S L++IG+S
Sbjct:    2 VTADTEKADVLNQFFSSVYTVEEPVGQVSPNSFTVASAPTTQWLAQDTVLKGLHTINV----NKAPGPDGIHPRVLRELGAELQWPLFLIFSDSLSSGMVPSDWKKANVTPIFKKGIRSQP---------GNYRPVSLTSVVGKLFEGLLRDHIQNYVVENAIMSSNQHGFMKDRSC-QTNLIAFYDEVSKKLDSGDAVDIIYLDFAKAFDTVPHKRLLSKLRSIGLS 215          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: ENSXETT00000047782.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:39744630:39746476:1 gene:ENSXETG00000019219.1 transcript:ENSXETT00000047782.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 2.149e-10
Identity = 67/228 (29.39%), Postives = 101/228 (44.30%), Query Frame = 1
Query: 3595 VTVRPEIQDILNQF-----SHEDPVSN-SWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPE-GILLSFMFNKIISSKIIPTSWKT------FKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVS 4239
            VT   E  D+LNQF     + E+PV   S N        TT  L    +L       +    N +PG DGI  + L  L  E    L  +F+  +SS ++P+ WK       FK  +  +P          ++RP++L SV+ K+F  +L   + ++V+ N I+   Q G      C + N I        K      + I +LD   AF +VPH  L S L++IG+S
Sbjct:   16 VTADTEKADVLNQFFSSVYTVEEPVGQVSPNSFTVASAPTTQWLAQDMVLKGLHTINV----NKAPGPDGIHPRVLRELGAELQWPLFLIFSDSLSSGMVPSDWKKANVTPIFKKGIRSQP---------GNYRPVSLTSVVGKLFEGLLRDHIQNYVVENGIMSSNQHGFMKDRSC-QTNLIAFYDEVSKKLDSGDAVDIIYLDFAKAFDTVPHKRLLSKLRSIGLS 229          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: pigr (polymeric immunoglobulin receptor [Source:Xenbase;Acc:XB-GENE-981188])

HSP 1 Score: 65.4698 bits (158), Expect = 3.631e-10
Identity = 65/222 (29.28%), Postives = 99/222 (44.59%), Query Frame = 1
Query: 3595 VTVRPEIQDILNQF-----SHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRAD-NTSPGIDGIQYKDLALLDPE-GILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVS 4239
            VT   E  D+LNQF     + E+PV            + T      D+    V+  L   + N +PG DGI  + L  L  E    L  +F+  +SS ++P  WK    I I    K     +  ++RP++L SV+ K+F  +L   + ++V+ N I+   Q G      C + N I        K      + I +LD   AF +VPH  L S L++IG+S
Sbjct:   16 VTADTEKADVLNQFFSSVYTVEEPVGQVPPNSFTVASAPTTQWLAQDM----VLKGLHTINVNKAPGPDGIHPRVLRELGAELQWPLFLIFSDSLSSGMVPRDWKKANVIPI---FKKGVRSQPGNYRPVSLTSVVGKLFEGLLRDHIQNYVVENAIMSSNQHGFMKDRSC-QTNLIAFYDEVSKKLDSGDAVDIIYLDFAKAFDTVPHKRLLSKLRSIGLS 229          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: epn1 (epsin 1 [Source:Xenbase;Acc:XB-GENE-1006332])

HSP 1 Score: 65.4698 bits (158), Expect = 3.763e-10
Identity = 51/165 (30.91%), Postives = 78/165 (47.27%), Query Frame = 1
Query: 3763 NTSPGIDGIQYKDLALLDPE-GILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFIT 4254
            N +PG DGI  + L  L  E    L  +F+  +SS ++P  WK    I I    K     +  ++RP++L SV+ K+F  +L   + ++V+ N I+   Q G      C + N I        K      + I +LD   AF +VPH  L S L++IG+S    T
Sbjct:   60 NKAPGPDGIHPRVLRELGAELQWPLFLIFSDSLSSGMVPRDWKKANVIPI---FKKGVRSQPGNYRPVSLTSVVGKLFEGLLRDHIQNYVVENAIMSSNQHGFMKDRSC-QTNLIAFYDEVSKKLDSGDAVDIIYLDFAKAFDTVPHKRLLSKLRSIGLSEAVCT 220          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Match: ENSXETT00000008172.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:143672566:143676425:-1 gene:ENSXETG00000002097.1 transcript:ENSXETT00000008172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.332e-9
Identity = 56/170 (32.94%), Postives = 78/170 (45.88%), Query Frame = 1
Query: 3757 ADNTSPGIDGIQ---YKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLT--SWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFI 4251
            A   +PG DG+    YK     D    +L  +F   +   I+P S +    IL+    K  +  +V +WRPIALL+   K+ A IL TRL   S  + + +     KG S  E  +     +  ALE  K  +N       LD   AF  V H+YLW+VL   G+ G FI
Sbjct:  480 AKKKAPGPDGLTAEFYKKFK--DQLAPVLVEVFRDCLEGGILPPSMRESSLILL---SKGKDPQRVENWRPIALLNTDRKLLARILFTRLILFSGTLLSPVQSCTVKGRSIFEAIL----TIREALELCKV-QNIGCYFLSLDQAKAFDRVDHEYLWAVLAKYGIPGTFI 639          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Match: sp|P16423|POLR_DROME (Retrovirus-related Pol polyprotein from type-2 retrotransposable element R2DM OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.002e-9
Identity = 53/163 (32.52%), Postives = 82/163 (50.31%), Query Frame = 1
Query: 3763 NTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFI 4251
            ++SPG DGI  K  A   P GI+L  M N I+    +P S +  +T+ IPK   T    +   +RPI++ SV+ +   +IL TRL S +  +      Q+G    +GC ++ +I+   L HS     S   IA LD+  AF S+ H  ++  L+  G    F+
Sbjct:  357 SSSPGPDGITPKS-AREVPSGIMLRIM-NLILWCGNLPHSIRLARTVFIPK---TVTAKRPQDFRPISVPSVLVRQLNAILATRLNSSINWDPR----QRGFLPTDGCADNATIVDLVLRHSHKHFRS-CYIANLDVSKAFDSLSHASIYDTLRAYGAPKGFV 509          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Match: sp|Q03274|PO22_POPJA (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Popillia japonica OX=7064 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.634e-7
Identity = 45/168 (26.79%), Postives = 80/168 (47.62%), Query Frame = 1
Query: 3733 EVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGV 4236
            E+   +K    ++PG DG+  + +       +  +F+   ++   + PT W   +T LIPK    +N    S+WRPI + S + ++   IL  RL + V     LH  QKG +  +G +  NS+L      S+  +     +  LD++ AF +V H  +   L+ +G+
Sbjct:   10 EIQCAIKGWKPSAPGSDGLTVQAITRTR---LPRNFVQLHLLRGHV-PTPWTAMRTTLIPKDGDLEN---PSNWRPITIASALQRLLHRILAKRLEAAV----ELHPAQKGYARIDGTLV-NSLLLDTYISSRREQRKTYNVVSLDVRKAFDTVSHSSICRALQRLGI 165          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Match: sp|P08548|LIN1_NYCCO (LINE-1 reverse transcriptase homolog OS=Nycticebus coucang OX=9470 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.399e-6
Identity = 48/166 (28.92%), Postives = 78/166 (46.99%), Query Frame = 1
Query: 3769 SPGIDGIQYKDLALLDPEGI-LLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSS--ALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            SPG DG   +       E + +L  +F  I    I+P ++      LIPKP K     +  ++RPI+L+++  K+   ILT R+   +    I+H  Q G  F  G     +I  S   ++H    KN    I  +D + AF ++ H ++   LK IG+ G F+ +
Sbjct:  469 SPGPDGFTSEFYQTFKEELVPILLNLFQNIEKEGILPNTFYEANITLIPKPGKDPT--RKENYRPISLMNIDAKILNKILTNRIQQHI--KKIIHHDQVG--FIPGSQGWFNIRKSINVIQHINKLKNKDHMILSIDAEKAFDNIQHPFMIRTLKKIGIEGTFLKL 628          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Match: sp|Q03278|PO21_NASVI (Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Nasonia vitripennis OX=7425 PE=4 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 2.748e-6
Identity = 48/179 (26.82%), Postives = 84/179 (46.93%), Query Frame = 1
Query: 3688 RSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLK 4224
            R    + NL   +  + I E++    T+ G DG+       +D     +  +FN I+     P  +   +T+LIPK   T +    + +RP+++ SV  + F  IL  R+      + +L   Q+     +G  E+ S+LS+ ++ ++  K   L IA LD+K AF SV H  +   L+
Sbjct:  307 RMQGEIKNLWRPISNDEIKEVEACKRTAAGPDGMTTTAWNSIDE---CIKSLFNMIMYHGQCPRRYLDSRTVLIPKEPGTMD---PACFRPLSIASVALRHFHRILANRIGE----HGLLDTRQRAFIVADGVAENTSLLSAMIKEARM-KIKGLYIAILDVKKAFDSVEHRSILDALR 474          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Match: sp|P21328|RTJK_DROME (RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster OX=7227 GN=pol PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.806e-6
Identity = 57/202 (28.22%), Postives = 94/202 (46.53%), Query Frame = 1
Query: 3703 VLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGI-LLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHI---GQKGGSFHEGCVEH-NSILSSALEHSKYSKNSPLAI-AWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKITNEK-FHL 4287
            V NL+  LP      LK+A    PG D +  + + LL  + +  L+ +FN ++     P +WK+   I+I K  KT     V S+RP +LL  + K+   ++  RL   + C D+       Q G     G  E  + +++ ALE     +N   A+ A+LDI+ AF  V H  L    K +     ++ ++    E+ FH+
Sbjct:  443 VKNLIAKLP------LKKA----PGEDLLDNRTIRLLPDQALQFLALIFNSVLDVGYFPKAWKSASIIMIHKTGKTPT--DVDSYRPTSLLPSLGKIMERLILNRL---LTCKDVTKAIPKFQFGFRLQHGTPEQLHRVVNFALE---AMENKEYAVGAFLDIQQAFDRVWHPGLLYKAKRLFPPQLYLVVKSFLEERTFHV 626          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A159X4Q6 (ORF2-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.789e-61
Identity = 116/231 (50.22%), Postives = 156/231 (67.53%), Query Frame = 1
Query: 3478 HEPYLGSKQNSNIISKYKS---RSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIA 4161
            H+PYLG    +++ S  K    +  +  N K    +I++++ +  RP +++ILNQF+  DP    ++ I   C  +  ++ L  I   EVI+E K+A+ +SPG D I Y+DL LLDPEG LL+ +FN II S  IP  W +FKTILIPKP K+ +YD  SSWRPIALLS  YK+F SIL+ RLT W+I N +LH GQKGGS  EGCVEHN++L++ LEHSKYSK +PLAIA
Sbjct:   90 HKPYLGKNFFNSLNSDNKMIKIKGGYFHNRKKVATRILDEINIDTRPSMENILNQFTQMDPDEFVFS-ISDYCIKSKEIIELDQITAKEVIFEYKQANASSPGDDNITYRDLRLLDPEGKLLARLFNIIIDSGQIPNDWLSFKTILIPKPGKSGDYDDTSSWRPIALLSTSYKIFTSILSRRLTKWIIENKLLHPGQKGGSRFEGCVEHNAVLTAVLEHSKYSKKAPLAIA 319          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A2R7VWV8 (Reverse transcriptase domain-containing protein (Fragment) OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS004203 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 4.088e-35
Identity = 80/215 (37.21%), Postives = 119/215 (55.35%), Query Frame = 1
Query: 3616 QDILNQFSHEDPVSNSWNKI-LKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            Q+++ +   E  +   W+   L D R+  N ++L    P EV+  L+R +N+SPG DGI Y+     DP+G  LSF  N  + S+ IP+ WK   T+LIPK  +       S WRPIAL   IYK+++ +L  RL  W   ND++   QKG   ++G  EHN ++   L+  + S    L IAWLD+ +AFGS+PHD L+  L+  G    F+ +
Sbjct:  211 QEVIQRL-QEACLRQEWDTTCLADLRTAENEIDLTHFSPEEVLARLRRFENSSPGPDGITYRQWRTADPKGKFLSFALNICLRSRRIPSDWKESNTVLIPKRAEPTT---PSDWRPIALHRTIYKIYSGLLNDRLMQWCRSNDVIAHSQKGFMPYDGVFEHNFVIDHHLKQVR-STGGELCIAWLDVSNAFGSIPHDALFDALRLRGAGTHFVDV 420          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A2R7X6Z1 (Reverse transcriptase domain-containing protein OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS018474 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.215e-33
Identity = 83/218 (38.07%), Postives = 119/218 (54.59%), Query Frame = 1
Query: 3610 EIQDILNQFSHEDPVSNSWN-KILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPK-PDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            E Q I    S ++  ++ W+   L D R   + ++L    P EV   L+R +N++PG DGI Y+     DP+G  LSF+FN  +  + IP +WK   TI+IPK PD T     VS WRPIAL   IYK ++ +L  RLT W   ND++   QKG    +G  EHN  +   L+ ++ S N  L +AWLDI + FGS+PH+ +   L+  G    F  +
Sbjct:  145 EPQRIDPPTSGDNGRTSDWDHSCLSDLRIAESEIDLTHFSPEEVSARLRRFENSAPGPDGITYRQWRTADPKGRFLSFVFNICVKFRQIPDNWKESATIMIPKRPDPT----TVSDWRPIALNRTIYKTYSGLLNDRLTQWCRSNDVIAHSQKGFMPQDGVFEHNFTIDHHLKQARSSGNQ-LYLAWLDISNVFGSIPHEAMLDALRLRGAGNHFADV 357          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A3L8D8X2 (Reverse transcriptase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_010824 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.249e-30
Identity = 76/182 (41.76%), Postives = 103/182 (56.59%), Query Frame = 1
Query: 3721 ILPF---EVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            + PF   EV   L+R  N++PG DGI Y DL   DP   LL+ +FN     + +P SWKT  T+L+    K  + D + SWRP+AL   + K+FA++   RLT WVI ND L   QKG    EGC EHN +L   L  ++ ++   + +AWLD+ +AFGSVPH  + S L   GV    I I
Sbjct:  831 MAPFTEGEVDRRLRRMTNSAPGPDGIAYNDLRAADPGARLLTALFNACYRLEAVPPSWKTSNTVLV---YKKGDRDSLESWRPLALGDTMPKLFAAVAADRLTDWVIANDKLCRAQKGFLRDEGCYEHNFVLQEILTDARRTRRHAV-VAWLDLSNAFGSVPHAAIRSALVRAGVPSGLINI 1008          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Match: A0A3L8D9A5 (Reverse transcriptase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_011136 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.079e-30
Identity = 76/182 (41.76%), Postives = 103/182 (56.59%), Query Frame = 1
Query: 3721 ILPF---EVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            + PF   EV   L+R  N++PG DGI Y DL   DP   LL+ +FN     + +P SWKT  T+L+    K  + D + SWRP+AL   + K+FA++   RLT WVI ND L   QKG    EGC EHN +L   L  ++ ++   + +AWLD+ +AFGSVPH  + S L   GV    I I
Sbjct:  756 MAPFTEGEVDRRLRRMTNSAPGPDGIAYSDLRAADPGARLLTALFNACYRLEAVPPSWKTSNTVLV---YKKGDRDSLESWRPLALGDTMPKLFAAVAADRLTDWVIANDKLCRAQKGFLRDEGCYEHNFVLQEILTDARRTRRHAV-VAWLDLSNAFGSVPHAAIRSALVRAGVPSGLINI 933          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000034560.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000712.1:195631:202616:-1 gene:ENSAMXG00000042811.1 transcript:ENSAMXT00000034560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.645e-16
Identity = 51/163 (31.29%), Postives = 88/163 (53.99%), Query Frame = 1
Query: 3733 EVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVL 4221
            E + ++KR  NT+PG D I  + L+  DP G  L  ++   + + ++P ++K  +T LIPK    +  ++V +WRPI + S+I ++F+ I+  RL      N      Q+G     GC E+  +L   + H K  + S LA+ ++D   AF S+ H+++ S L
Sbjct:  433 ENLGQIKR--NTAPGPDRITRQMLSDWDPSGEKLERLYTAWMVAGVVPKAFKECRTTLIPKSTSKEALEEVGNWRPITIGSLILRLFSKIMAERLARACPINPR----QRGFISAPGCAENLKVLQGLIGHCKKER-SQLAVVFVDFARAFDSISHEHILSAL 588          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000034831.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:16211297:16215948:1 gene:ENSAMXG00000034228.1 transcript:ENSAMXT00000034831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 1.135e-14
Identity = 55/180 (30.56%), Postives = 91/180 (50.56%), Query Frame = 1
Query: 3763 NTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSK-IIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIG-QKGG-SFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKITNEKFHLIF 4293
             ++PG +G+ Y+      P+ +   +    I+  K IIP  W     +LIPK   +   D+    RPI+LL+V  K+F S++  RL +++  N+++    QK G +   GC+EHNS++   ++ ++  K   L + +LD+ +AFGSVPH  LW       V  E   + K   E     F
Sbjct:  387 GSAPGPNGVPYRSYKSA-PDVLKFLWKLMAIVWKKGIIPKEWHRAGGVLIPKEKDSVAIDQF---RPISLLNVEGKIFFSVVARRLATYLKRNNLIDTSVQKAGIAGFSGCIEHNSMIWHQIQTARAEKKD-LHVVFLDLANAFGSVPHALLWKAFNFFRVPEEISRLVKAYFEDIQFCF 561          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000056440.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:13299579:13303381:-1 gene:ENSAMXG00000041658.1 transcript:ENSAMXT00000056440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 1.147e-13
Identity = 69/250 (27.60%), Postives = 115/250 (46.00%), Query Frame = 1
Query: 3511 NIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDL-ALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
             +  KY S+S  + + +       +D  +      +++LN    EDP + S  + + D  +T      V +     I  LK  +  + GID +  + L A L+    +L+ +F  I   ++IP  W     + +PK     N D   +WR I LLSV  KVF  IL  R+ S +  +  L   Q G     GC++    L + +E S    N+PL I ++D + AF S+  D LW +++  GV  + +T+
Sbjct:  441 QLTGKYTSQSAPVKDKQGNILTTESDQILRWVEHFREVLNCPEPEDPANPSSAERVFDIETTPPSKEEVKL----AIKALK--NGKAAGIDSVHAEMLKADLNTSVNVLTDLFKDIWEKEVIPQDWDKGLIVKLPKKGNPQNCD---NWRGITLLSVPSKVFCRILLARIESAI--DQELRQEQAGFRRGRGCIDQIFALRNIIEQS-VEWNTPLHINFIDFRKAFDSLHRDTLWKIVRAYGVPPKLVTL 678          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000055550.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:16555187:16560144:-1 gene:ENSAMXG00000035203.1 transcript:ENSAMXT00000055550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 2.526e-13
Identity = 54/167 (32.34%), Postives = 92/167 (55.09%), Query Frame = 1
Query: 3733 EVIYELKRADNTS-PGIDGIQYKDLALLDPEGILLSFMFNKIISSK-IIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIG-QKGG-SFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVL 4221
            EV+  +K+A   S PG +G+ Y+ L    P  + L +   K++ +K  IP +W+    +LIPK     N   +  +R I LL+V  KVF SI+  RLT ++  N+++    QK G     GC+EH S++   ++ ++  +   L + +LD+ +AFGS+PH  +W+  
Sbjct:  319 EVVEAVKKARAASAPGPNGVPYR-LYKNSPNVLRLLWKQMKVMWTKQTIPKAWRRAGGVLIPKEKDASN---IGQFRQINLLNVEGKVFFSIVAKRLTKYLKENNMIDTSVQKAGIPGFSGCLEHISMIWHQIQSAR-KEGRDLHVLFLDLANAFGSIPHSLIWAAF 480          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Match: ENSAMXT00000033573.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:31407009:31410218:-1 gene:ENSAMXG00000030324.1 transcript:ENSAMXT00000033573.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 8.038e-13
Identity = 53/170 (31.18%), Postives = 93/170 (54.71%), Query Frame = 1
Query: 3751 KRADNTSPGIDGIQYKDLALLDPEGILLSFMFN--KIISSK-IIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIG-QKGG-SFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGE 4245
            K   +++PG  G+ YK   +     +LL  ++   K+I  +  +   W+  + + IPK + + N D+   +R I+LLSV  K+F SIL  RLT ++  N  +    QKGG     GC+EH  +++  +  ++ +K   LA+ WLD+ +A+GS+PH  + + L+   V G+
Sbjct:  268 KARSSSAPGPSGVPYK---VYKNCPLLLERLWKILKVIWRRGKVARQWRFAEGVWIPKEEVSKNIDQ---FRIISLLSVEGKIFFSILARRLTDFLSSNHYIDTSVQKGGIPGVPGCLEHTGVVTQLIREARENKGD-LAVLWLDLANAYGSIPHKLVQTTLERHHVPGQ 430          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000041934.1 (uncharacterized LOC111947977 [Source:NCBI gene;Acc:111947977])

HSP 1 Score: 72.4034 bits (176), Expect = 3.879e-12
Identity = 44/140 (31.43%), Postives = 78/140 (55.71%), Query Frame = 1
Query: 3832 LSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVS-SWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEF 4248
            L  +F     +  IP+ W  +K+I+ P P       +V  ++R I+LLS +YKVF+SIL  RL+ ++  N++L   Q G   +  C+++  +LSS +  ++  ++    + ++D K AF S+  D L   L T G++G+F
Sbjct:  532 LHCLFRFCFKNGFIPSIW--YKSIIKPIPKSPQADPRVPLNYRGISLLSTVYKVFSSILNNRLSEYLETNEVLVEEQNGFRRNRACIDNIYVLSSVV-RARLQESKSTFVCFVDFKKAFDSIDRDLLQYKLLTYGINGQF 668          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000036683.1 (pep primary_assembly:ASM223467v1:19:23029986:23032853:-1 gene:ENSORLG00000028041.1 transcript:ENSORLT00000036683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.224e-10
Identity = 54/183 (29.51%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 3733 EVIYELKRADN-TSPGIDGIQYKDLA----LLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKI 4266
            E++  LK+ +N  SPG DG+  +       +++P    L  M+ + I  + +  + K     LIPKP+K      + +WRPI LL+V YK+ A +   RL S +  ++I+   Q G   +     +  ++   L++S++  +  L I +LD   AF +V H +L++ LK  G    FI+I K+
Sbjct:  174 ELLNALKKMNNGKSPGNDGLSKEFYCHFWDVINPH---LMEMYKECIVQQEMTATMKQGLITLIPKPNKDP--VMIENWRPITLLNVDYKILALVYAQRLKSNL--HEIISETQSGFMKNRHISNNIRLILDLLDYSEHIDSEAL-ILFLDFYKAFDTVEHPFLYNALKLFGFGENFISIAKM 348          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000028058.1 (pep primary_assembly:ASM223467v1:18:21516917:21520645:1 gene:ENSORLG00000027382.1 transcript:ENSORLT00000028058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 3.437e-10
Identity = 54/183 (29.51%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 3733 EVIYELKRADN-TSPGIDGIQYKDLA----LLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKI 4266
            E++  LK+ +N  SPG DG+  +       +++P    L  M+ + I  + +  + K     LIPKP+K      + +WRPI LL+V YK+ A +   RL S +  ++I+   Q G   +     +  ++   L++S++  +  L I +LD   AF +V H +L++ LK  G    FI+I K+
Sbjct:  461 ELLNALKKMNNGKSPGNDGLSKEFYCHFWDVINPH---LMEMYKECIVQQEMTATMKQGLITLIPKPNKDPVM--IENWRPITLLNVDYKILALVYAQRLKSNL--HEIISETQSGFMKNRHISNNIRLILDLLDYSEHIDSEAL-ILFLDFYKAFDTVEHPFLYNALKLFGFGENFISIAKM 635          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000042239.1 (pep primary_assembly:ASM223467v1:5:6656021:6661644:1 gene:ENSORLG00000029419.1 transcript:ENSORLT00000042239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.165e-9
Identity = 56/184 (30.43%), Postives = 92/184 (50.00%), Query Frame = 1
Query: 3763 NTSPGIDGIQYKDLALLDPE-GILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSK-NSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKITNEKFHLIFGRIHV 4308
            N SPG DG   +   +   E   +L   FN  + +   P SWK     ++PK  K   Y    S+RPI++L+V YK+F SI++ RL  ++   D++   Q G  F +G    ++I  +    ++ +K N P A+  LD + AF  V  D+L++VL+ +G +   I   +     +H   GRI +
Sbjct:  470 NKSPGGDGYPNEWYKIFKEELAPILLESFNWTLKNAKTPPSWKEAIISVLPKEGKNKEY--CESYRPISILNVDYKIFTSIISKRLEQFL--PDLIDEDQTG--FIKGRQTQDNIRRTIHVINEVNKLNIPAALISLDAEKAFDRVCWDFLFAVLRRMGFNNTCIMYLQAL---YHKPVGRIKI 644          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Match: ENSORLT00000040357.1 (pep primary_assembly:ASM223467v1:14:28942701:28945517:1 gene:ENSORLG00000024817.1 transcript:ENSORLT00000040357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.202e-9
Identity = 53/174 (30.46%), Postives = 82/174 (47.13%), Query Frame = 1
Query: 3757 ADNTSPGIDGI--QYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWV--ICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKI 4266
            A   SPG DGI  ++      D   +L    FN+ I  +++  + K     L+PKP K  +   + +WRPI LL   YK+ A I   RL S +  I ++      KG   H     H  ++   L++++      L I +LD   AF S+ H +L++ LKT G   +F  I K+
Sbjct:  477 ASGKSPGPDGITAEFYKHFWTDIREMLFE-AFNECIDEQMLSPTMKRGIISLLPKPGK--DVLLIDNWRPITLLCCDYKILAHIYANRLKSGISQIIDESQSAFIKGRHIHH----HTRLILDILDYNQIIPQDSL-ILYLDFFKAFDSLEHAFLFNALKTFGFESKFCNIIKM 642          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 1210.28 bits (3130), Expect = 0.000e+0
Identity = 676/1441 (46.91%), Postives = 926/1441 (64.26%), Query Frame = 1
Query:    1 RNGNLCISIKLSEIKKTDA-TEKIITKSANFQNKNKTIISNLINTDNYCSKLIKAPLAIKKFLFVFSHKLAETVSIKNELHKRAVINKTLDNLKFQKQLPYFLVKSDLKYADGDFIMKDLLTSEDADNESFNIGSSNLTRSQLDKLYFDFPEIKEMFFTEGMHKDSDKISSLINHLKVNKEYPKDISFSGGKFI-INQKSNKIEPDLSNASDVMFNFGLFDLFKISKDDIELERLISLPASSNKIVEIIFHLNYLNLKGNIKYFSNITYGTYVLNYFRNVLLLHSIIDSEKCNSLIIDTLEIWGSELTDQIPSTSYFKFSCQEKLIKYKKWLLNGEIDKLKNIISPLTXXXXXXXXXXXXXXXSEKTNRLSMIDSLLTYINDFRPES--------KKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVELTDKIDNFNKGSSCNVTNNEKKVILPVNIDEEAVSSLELKITENKKMMTRQNLKVSKAMSK*RYVPASVLESATISEETDAECT-------KLKNTKLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPNNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFS-MKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSE---INNKDKEKILTKAKETIKFDLQQRKNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKS-HEPYLGSKQNSNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            RNGN+C+SI  S   KT+   +K I K++        I SN+I + N   K   A  AIK+FLFV S+KL+ET +I N   +   IN TL+ LK Q+ LP +L+KS +KY DGDF+M DLL+  D +  +  + SS L+RSQ+  L+  FPE+ E+FF+E    ++DK  +LIN+LK    +P+ ISF GGKFI +N+  +         SD+MFN GL +  ++   D  L  L S P SS KI++IIFHLNYL LKG +K+ SN +YG YV NY RN L L+SI D E  N+L +D +E W   L   IP  SY   SC+E+L++ ++W L+ EID+L NIISP TIK IN+F +  +K+  +K  +L  + +L   IN  + ES        K+ + FVIRDKKKFLL ++  ++I + CRK CT  M+  IF +I+SL   +T  +     + +D I   N   S  +    +   +   +D   +S +E   TE+ ++  R  + + +  S    +  ++ +SA ISEETDA+ T       K  N   RDP +WFTDDDID YL+ HIS+  FA + CFI+ IL ++  E++  IP+ VFKA +ILCPLNI+  HWI FVY K+ L SYFIDPI  YR+ F NK   L++ +ALN++F L+ A   HP +N +YQENS+DCG +ICAY ++IS    +FP +FID IR+EVH  Q+F  +K  +V GGGLP        F + I     ++  +   +  +K   Q SC+S LL ++FK+  N  VLSP+LT+N++AQN  +I ENV FRQF  + H+ISI+PN++ W L ++S       IF+F    +++RL  IG N T+YLN+F  S  K+ F   H I H    SDD    A+AFI+ +E LI  +   H +  + L  +  K+  EI LNLN IN KI + I  KYF+NL L+++F+LL  TMCTAILDDCT +L + LNY+ L  A+V+FAI APPK RE L++IDY TDE+Y ++PTTL  + +   +C++   KINEI+ + G  I  G  P+D+RGSGL+SK+LICAFI NYA+D+ L N+NLREI   I+S+LPI+SE   I   D  KI TK K++   +L+QRK K+ EL+    +  VN+I++ I+RQ P       +KS H+PYLG+K     I+K     +F+ +MK T  K+ N+  V++RP  Q I+  F  + P   +WN  L  C+ +   LNL     FE++++LKRADNTSPGIDGIQY+DL LLDPEG LL+F+FNKII +KIIP SWK+FKT+L PKP+K   YD VSSWRPIALLSVIYKVFAS L +RLT W+  N++LHIGQKGGS H+GCVEHNSILS+ALEHSKYSKN PLAIAWLDIKDAFGSVPHDY+WS+L+ IGV  +F +I
Sbjct: 4184 RNGNICVSINFSVNNKTEPLVKKTILKTS-------IIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAKVRGEQINNTLNLLKKQRALPDYLMKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSES-DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSI---VD---ISVVETGSTEHARVKRRLEVDIDEVES---IIHTTISKSALISEETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPK-------FMEIIKRNGVRKTSSATQAFLLK---QNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFIRENVTFRQFTGIDHIISIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKI-TKIKKS-NLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPD-----RVKSKHKPYLGNKTRPQKINKGILVRKFMTDMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFHGNWNNPLNFCKRSKQALNLELFSNFEIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSI 5590          

HSP 2 Score: 1152.5 bits (2980), Expect = 0.000e+0
Identity = 657/1447 (45.40%), Postives = 904/1447 (62.47%), Query Frame = 1
Query:    1 RNGNLCISIKLSEIKKTDA-TEKIITKSANFQNKNKTIISNLINTDNYCSKLIKAPLAIKKFLFVFSHKLAETVSIKNELHKRAVINKTLDNLKFQKQLPYFLVKSDLKYADGDFIMKDLLTSEDADNESFNIGSSNLTRSQLDKLYFDFPEIKEMFFTEGMHKDSDKISSLINHLKVNKEYPKDISFSGGKFI-INQKSNKIEPDLSNASDVMFNFGLFDLFKISKDDIELERLISLPASSNKIVEIIFHLNYLNLKGNIKYFSNITYGTYVLNYFRNVLLLHSIIDSEKCNSLIIDTLEIWGSELTDQIPSTSYFKFSCQEKLIKYKKWLLNGEIDKLKNIISPLTXXXXXXXXXXXXXXXSEKTNRLSMIDSLLTYINDFRPES--------KKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVELTDKIDNFNKGSSCNVTNNEKKVILPVNIDEEAVSSLELKITENKKMMTRQNLKVSKAMSK*RYVPAS----VLESATISEETDAECT-------KLKNTKLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPNNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVIS--IIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFS-MKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSE---INNKDKEKILTKAKETIKFDLQQRKNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKS-HEPYLGSKQNSNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            RNGN+C+SI  S   K +   +K I K++        I SN+I + N   K   A  AIK+FLFV S+KL+ET +I N                 Q+ LP +L+KS +KY DGDF+M DLL+  D +  +  + SS L+RSQ+  L+  FPE+ E+FF+E    ++DK  +LIN+LK    +P+ ISF GGKFI +N+  +         SD+MFN GL +  ++   D  L  L S P SS KI++IIFHLNYL LKG +K+ SN +YG YV NY RN L L+SI D E  N+L +D +E W   L   IP  SY   SC+E+L++ ++W L+ EID+L NIISP TIK IN+F +  +K+  +K  +L  + +L   IN  + ES        K+ + FVIRDKKKFLL ++  ++I + CRK CT  M+  IF +I+SL   +T  +     + +D I   N   S  +    +   +   +D   +S +E   TE+ ++  R  + + +  S       +    + +SA IS+ETDA+ T       K  N   RDP +WFTDDDID YL+ HIS+  FA + CFI+ IL ++  E++  IP+ VFKA +ILCPLNI+  HWI FVY K+ L SYFIDPI  YR+ F NK   L++ +ALN++F L+ A   HP +N +YQENS+DCG +ICAY ++IS    +FP +FID IR+EVH  Q+F  +K  +V GGGLP        F + I     ++  +   +  +K   Q SC+S LL ++FK+  N  VLSP+LT+N++AQ                + H +   I+PN++ W L ++S       IF+F    +++RL  IG N T+YLN+F  S  K+ F   H I H    SDD    A+AFI+ +E LI  +   H +  + L  +  K+  EI LNLN IN KI + I  KYF+NL L+++F+LL  TMCTAILDDCT +L + LNY+ L  A+V+FAI APPK RE L++IDY TDE+Y ++PTTL  + +   +C++   KINEI+ + G  I  G  P+D+RGSGL+SK+LICAFI NYA+D+ L N+NLREI   I+S+LPI+SE   I   D  KI TK K++   +L+QRK K+ EL+    +  VN+I++ I+RQ P       +KS H+PYLG+K     I+K     +F+ +MK T  K+ N+  V++RP  Q I+  F  + P   +WN  L  C+ +   LNL     FE++++LKRADNTSPGIDGIQY+DL LLDPEG LL+F+FNKII +KIIP SWK+FKT+L PKP+K   YD VSSWRPIALLSVIYKVFAS L +RLT W+  N++LHIGQKGGS H+GCVEHNSILS+ALEHSKYSKN PLAIAWLDIKDAFGSVPHDY+WS+L+ IGV  +F +I
Sbjct: 1850 RNGNICVSINFSVNNKMEPLVKKTILKTS-------IIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAK---------------QRALPDYLMKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSES-DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSI---VD---ISVVETGSTEHARVKRRLEVDIDEVESIIHTTSGTQQNHISKSALISKETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLPK-------FMEIIKRNGVRKTSSATQAFLLK---QNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ----------------ISHSLEKIIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKI-TKIKKS-NLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFPD-----RVKSKHKPYLGNKTRPQKINKGILVRKFMTDMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFQGNWNNPLNFCKRSKQALNLELFSNFEIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSI 3234          

HSP 3 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 389/895 (43.46%), Postives = 559/895 (62.46%), Query Frame = 1
Query: 1150 ESKKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVE----LTDKIDNFN-------KGSSCNVTNN--EKKVI----LPVNIDE----EAVSSLELKITENKKMMTRQNLKVSKAM---SK*RYVPASVLESATISEETDAECTKLKNTKLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPNNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFSMKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSEINN---KDKEKILTKAKETIKFDLQQRKNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKSHEPYLGSKQNSNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELK 3753
            +SK+ I F++RD KK+L++N+  F++   C K CT EMS  I  +I  L+ ++   + V+ +E    L   I+N +       +   C   N+  EK ++    + VNI E    +A+S +E    E+ +  +  +  +++ +      R    + ++    S+     C K      RDP++WF+D+DID YLE HI NP   ++ CFI++IL S+I+E +++IP ++  A ++ CPLNINN+HWI FVY K    SYFIDPI   RN   NKQ  LKINIALN+ F L++A   +P +NL YQ N+FDCG F CAY ++IS+ LD FP  FID IRR+VH  Q+   + V  +IGG     ++   NFKKAIA T  K   N  N+ NI  K Q  CVS ++ K++++N  + VLS +LT+NLIAQNN++I +NV F+QFK + H++ +IP  N WCL +YS +    +IFDF    I DRL EIG   TDYLN+F  +  +KF  NH I H  F+S D  + A+ FIV  EKL+ +     DK+Y  L  I T+ C+EIS  LNLINGKITD I+ +YFN L LS D++LL  T+C AI DDCT Y+ + LN +C+  A V+FAI +PPK  E L+VIDY+T+EHY+L P T D+++     C  ++ KINE+R S+G A++ G C HD+RGSGLLSKILICAFI NYA D SLENINL EI +I+NS++PIV   +N   + +EK+  KA  T+K +L+QRK K+ +L+I   ++DV++I+ +I+  IP L N  + +  EPYLG  +N N   K+ + +EFL NMK T Y+I+ND  V + P  Q+I+N F+H D V   W+ +LK  + +  +L L  I   E++  L+
Sbjct:   17 KSKRFIYFLLRDSKKYLIRNQT-FRLFETCNKYCTSEMSQQISLIITKLKPIVINVKDVDLIEQDCDLDKPIENIDITKPIVIEEIHCMKCNSILEKCILVREGMNVNICENCLLDAISVVEPDSNESNQTNSNHDSPITENIINPPTKRTGQRNTVKKQP-SKPKSTICNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHRNQM---EIVGNLIGGAKTKMDMSSFNFKKAIAKT--KYSNNNPNTSNIL-KSQMPCVSSIICKYYENNCKVSVLSAELTLNLIAQNNSFIADNVTFKQFKGIDHILCVIPKFNDWCLFIYSIKLKHSHIFDFNYRTIDDRLIEIGVKITDYLNQFCLNRNVKFLANHHISHSTFLSYDTQYFASHFIVLFEKLVYEIHLDCDKVYDSLSKIKTETCIEISPGLNLINGKITDKIIFEYFNKLKLSDDYILLNKTLCVAISDDCTQYMKDFLNIECMMKANVIFAIISPPKVHELLLVIDYSTEEHYYLSPVTTDLNVVSQHFCYNILIKINELRESKGRAMKTGHCRHDIRGSGLLSKILICAFIRNYALDYSLENINLHEIGKIVNSLVPIVDGSDNVKYEKREKL--KAANTLKLNLKQRKEKINQLLIKLSDSDVDEIICTILTNIPRLENLQKKEFREPYLG--KNHNKPKKFNNPAEFLTNMKTTVYRILNDQSVKIEPPFQEIINNFTHPDVVPECWDNVLKFSKISDELLELTYISSEEILSNLQ 899          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 1189.87 bits (3077), Expect = 0.000e+0
Identity = 665/1434 (46.37%), Postives = 911/1434 (63.53%), Query Frame = 1
Query:    1 RNGNLCISIKLSEIKKTDA-TEKIITKSANFQNKNKTIISNLINTDNYCSKLIKAPLAIKKFLFVFSHKLAETVSIKNELHKRAVINKTLDNLKFQKQLPYFLVKSDLKYADGDFIMKDLLTSEDADNESFNIGSSNLTRSQLDKLYFDFPEIKEMFFTEGMHKDSDKISSLINHLKVNKEYPKDISFSGGKFI-INQKSNKIEPDLSNASDVMFNFGLFDLFKISKDDIELERLISLPASSNKIVEIIFHLNYLNLKGNIKYFSNITYGTYVLNYFRNVLLLHSIIDSEKCNSLIIDTLEIWGSELTDQIPSTSYFKFSCQEKLIKYKKWLLNGEIDKLKNIISPLTXXXXXXXXXXXXXXXSEKTNRLSMIDSLLTYINDFRPES--------KKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVELTDKIDNFNKGSSCNVTNNEKKVILPVNIDEEAVSSLELKITENKKMMTRQNLKVSKAMSK*RYVPASVLESATISEETDAECTKLKNTKLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPNNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFS-MKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSE---INNKDKEKILTKAKETIKFDLQQRKNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKS-HEPYLGSKQNSNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            RNGN+C+SI  S   KT+   +K I K++        I SN+I + N   K   A  AIK+FLFV S+KL+ET +I N   +   IN TL+ LK Q+ LP +L+KS +KY DGDF+M DLL+  D +  +  + SS L+RSQ+  L+  FPE+ E+FF+E    ++DK  +LIN+LK    +P+ ISF GGKFI +N+  +         SD+MFN GL +  ++   D  L  L S P SS KI++IIFHLNYL LKG +K+ SN +YG YV NY RN L L+SI D E  N+L +D +E W   L   IP  SY   SC+E+L++ ++W L+ EID+L NIISP TIK IN+F +  +K+  +K  +L  + +L   IN  + ES        K+ + FVIRDKKKFLL ++  ++I + CRK CT  M+  IF +I+SL   +T  +     + +D I   N   S  +    +   +   +D   +S +E   TE+ ++  R  + +                          E   + +T  RDP +WFTDDDID YL+ HIS+  FA + CFI+ IL ++  E++  IP+ VFKA +ILCPLNI+  HWI FVY K+ L SYFIDPI  YR+ F NK   L++ +ALN++F L+ A   HP +N +YQENS+DCG +ICAY ++IS    +FP +FID IR+EVH  Q+F  +K  +V GGGLP        F + I     ++  +   +  +K   Q SC+S LL ++FK+  N  VLSP+LT+N++AQN  +I ENV FRQF  + H+ISI+PN++ W L ++S       IF+F    +++RL  IG N T+YLN+F  S  K+ F   H I H    SDD    A+AFI+ +E LI  +   H +  + L  +  K+  EI LNLN IN KI + I  KYF+NL L+++F+LL  TMCTAILDDCT +L + LNY+ L  A+V+FAI APPK RE L++IDY TDE+Y ++PTTL  + +   +C++   KINEI+ + G  I  G  P+D+RGSGL+SK+LICAFI NYA+D+ L N+NLREI   I+S+LPI+SE   I   D  KI TK K++   +L+QRK K+ EL+    +  VN+I++ I+RQ P       +KS H+PYLG+K     I+K     +F+ +MK T  K+ N+  V++RP  Q I+  F  + P   +WN  L  C+ +   LNL     FE++++LKRADNTSPGIDGIQY+DL LLDPEG LL+F+FNKII +KIIP SWK+FKT+L PKP+K   YD VSSWRPIALLSVIYKVFAS L +RLT W+  N++LHIGQKGGS H+GCVEHNSILS+ALEHSKYSKN PLAIAWLDIKDAFGSVPHDY+WS+L+ IGV  +F +I
Sbjct: 4155 RNGNICVSINFSVNNKTEPLVKKTILKTS-------IIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAKVRGEQINNTLNLLKKQRALPDYLMKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSES-DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSDSEQIADRSDSITLVNTTQSVEINPGTQSGSI---VD---ISVVETGSTEHARVKRRLEVDID-------------------------EVESIIHTTNRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLP-------KFMEIIKRNGVRKTSSATQAFLLK---QNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQNLTFIRENVTFRQFTGIDHIISIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKI-TKIKKS-NLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFP-----DRVKSKHKPYLGNKTRPQKINKGILVRKFMTDMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFHGNWNNPLNFCKRSKQALNLELFSNFEIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSI 5532          

HSP 2 Score: 1142.49 bits (2954), Expect = 0.000e+0
Identity = 653/1443 (45.25%), Postives = 900/1443 (62.37%), Query Frame = 1
Query:    1 RNGNLCISIKLSEIKKTDA-TEKIITKSANFQNKNKTIISNLINTDNYCSKLIKAPLAIKKFLFVFSHKLAETVSIKNELHKRAVINKTLDNLKFQKQLPYFLVKSDLKYADGDFIMKDLLTSEDADNESFNIGSSNLTRSQLDKLYFDFPEIKEMFFTEGMHKDSDKISSLINHLKVNKEYPKDISFSGGKFI-INQKSNKIEPDLSNASDVMFNFGLFDLFKISKDDIELERLISLPASSNKIVEIIFHLNYLNLKGNIKYFSNITYGTYVLNYFRNVLLLHSIIDSEKCNSLIIDTLEIWGSELTDQIPSTSYFKFSCQEKLIKYKKWLLNGEIDKLKNIISPLTXXXXXXXXXXXXXXXSEKTNRLSMIDSLLTYINDFRPES--------KKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVELTDKIDNFNKGSSCNVTNNEKKVILPVNIDEEAVSSLELKITENKKMMTRQNLKVSKAMSK*RYVPASVLESATISEETDAECT-------KLKNTKLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPNNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVIS--IIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFS-MKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSE---INNKDKEKILTKAKETIKFDLQQRKNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKS-HEPYLGSKQNSNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITI 4257
            RNGN+C+SI  S   K +   +K I K++        I SN+I + N   K   A  AIK+FLFV S+KL+ET +I N                 Q+ LP +L+KS +KY DGDF+M DLL+  D +  +  + SS L+RSQ+  L+  FPE+ E+FF+E    ++DK  +LIN+LK    +P+ ISF GGKFI +N+  +         SD+MFN GL +  ++   D  L  L S P SS KI++IIFHLNYL LKG +K+ SN +YG YV NY RN L L+SI D E  N+L +D +E W   L   IP  SY   SC+E+L++ ++W L+ EID+L NIISP TIK IN+F +  +K+  +K  +L  + +L   IN  + ES        K+ + FVIRDKKKFLL ++  ++I + CRK CT  M+  IF +I+SL   +T  +   S ++ D+ D      S  + N  + V   +N   ++ S +++ + E     + ++ +V + +                 EETDA+ T       K  N   RDP +WFTDDDID YL+ HIS+  FA + CFI+ IL ++  E++  IP+ VFKA +ILCPLNI+  HWI FVY K+ L SYFIDPI  YR+ F NK   L++ +ALN++F L+ A   HP +N +YQENS+DCG +ICAY ++IS    +FP +FID IR+EVH  Q+F  +K  +V GGGLP        F + I     ++  +   +  +K   Q SC+S LL ++FK+  N  VLSP+LT+N++AQ                + H +   I+PN++ W L ++S       IF+F    +++RL  IG N T+YLN+F  S  K+ F   H I H    SDD    A+AFI+ +E LI  +   H +  + L  +  K+  EI LNLN IN KI + I  KYF+NL L+++F+LL  TMCTAILDDCT +L + LNY+ L  A+V+FAI APPK RE L++IDY TDE+Y ++PTTL  + +   +C++   KINEI+ + G  I  G  P+D+RGSGL+SK+LICAFI NYA+D+ L N+NLREI   I+S+LPI+SE   I   D  KI TK K++   +L+QRK K+ EL+    +  VN+I++ I+RQ P       +KS H+PYLG+K     I+K     +F+ +MK T  K+ N+  V++RP  Q I+  F  + P   +WN  L  C+ +   LNL     FE++++LKRADNTSPGIDGIQY+DL LLDPEG LL+F+FNKII +KIIP SWK+FKT+L PKP+K   YD VSSWRPIALLSVIYKVFAS L +RLT W+  N++LHIGQKGGS H+GCVEHNSILS+ALEHSKYSKN PLAIAWLDIKDAFGSVPHDY+WS+L+ IGV  +F +I
Sbjct: 1850 RNGNICVSINFSVNNKMEPLVKKTILKTS-------IIDSNIITSYNNRLKFTGASTAIKRFLFVLSNKLSETATISNAK---------------QRALPDYLMKSHIKYHDGDFVMLDLLSDSDLNVGNATLSSSELSRSQMRDLFKSFPELAELFFSES-DCNTDKFKNLINNLKSEHGFPEQISFVGGKFIKLNETKDSDHSQAEGESDIMFNIGLLNFHEMCLKDTTLRSLFSQPKSSEKIIDIIFHLNYLQLKGELKHTSNGSYGDYVCNYVRNCLSLYSISDIETYNTLSLDDIEKWAPSLVKMIPPLSYHSSSCKERLLRLRQWKLSSEIDRLHNIISPETIKHINSFLSEIDKVYPQKATQLKALQNLSNNINAIKSESDDETIAKAKRFLFFVIRDKKKFLLGSKYSYRIPLHCRKICTTNMTTHIFSIIQSLLLTLTVSD---SEQIADRSD------SITLVNTTQSV--EINPGTQSGSIVDISVVETG---STEHARVKRRL-----------------EETDADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSGGGLP-------KFMEIIKRNGVRKTSSATQAFLLK---QNSCISSLLDEYFKTRTNTTVLSPELTMNIVAQ----------------ISHSLEKIIVPNDSNWSLFVFSLVLGNSYIFNFHDRIVTERLIAIGENMTEYLNKFIISNRKVIFISEHNIEHASITSDDSLLFASAFIILIESLIFSKQVSHTRTSEFLKSVKIKQANEICLNLNSINCKINEEITAKYFSNLKLNSNFMLLNETMCTAILDDCTRHLTKFLNYEDLIKAQVIFAIIAPPKHREILLIIDYITDEYYIINPTTLCGTESSQSVCRIFRNKINEIKETPGRVINMGDIPNDIRGSGLVSKLLICAFIKNYANDLPLINLNLREIGTNISSLLPIISESKKILMSDLTKI-TKIKKS-NLNLEQRKLKIDELLHDVSHLTVNEIIDIIVRQFP-----DRVKSKHKPYLGNKTRPQKINKGILVRKFMTDMKWTVDKVFNNTNVSIRPTFQKIVLNFLIKSPFQGNWNNPLNFCKRSKQALNLELFSNFEIMFQLKRADNTSPGIDGIQYRDLLLLDPEGKLLTFLFNKIIVNKIIPDSWKSFKTLLTPKPNKDGKYDDVSSWRPIALLSVIYKVFASCLASRLTYWINTNNLLHIGQKGGSRHDGCVEHNSILSAALEHSKYSKNCPLAIAWLDIKDAFGSVPHDYMWSLLRFIGVGEDFTSI 3205          

HSP 3 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 389/895 (43.46%), Postives = 559/895 (62.46%), Query Frame = 1
Query: 1150 ESKKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVE----LTDKIDNFN-------KGSSCNVTNN--EKKVI----LPVNIDE----EAVSSLELKITENKKMMTRQNLKVSKAM---SK*RYVPASVLESATISEETDAECTKLKNTKLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPNNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFSMKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSEINN---KDKEKILTKAKETIKFDLQQRKNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKSHEPYLGSKQNSNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELK 3753
            +SK+ I F++RD KK+L++N+  F++   C K CT EMS  I  +I  L+ ++   + V+ +E    L   I+N +       +   C   N+  EK ++    + VNI E    +A+S +E    E+ +  +  +  +++ +      R    + ++    S+     C K      RDP++WF+D+DID YLE HI NP   ++ CFI++IL S+I+E +++IP ++  A ++ CPLNINN+HWI FVY K    SYFIDPI   RN   NKQ  LKINIALN+ F L++A   +P +NL YQ N+FDCG F CAY ++IS+ LD FP  FID IRR+VH  Q+   + V  +IGG     ++   NFKKAIA T  K   N  N+ NI  K Q  CVS ++ K++++N  + VLS +LT+NLIAQNN++I +NV F+QFK + H++ +IP  N WCL +YS +    +IFDF    I DRL EIG   TDYLN+F  +  +KF  NH I H  F+S D  + A+ FIV  EKL+ +     DK+Y  L  I T+ C+EIS  LNLINGKITD I+ +YFN L LS D++LL  T+C AI DDCT Y+ + LN +C+  A V+FAI +PPK  E L+VIDY+T+EHY+L P T D+++     C  ++ KINE+R S+G A++ G C HD+RGSGLLSKILICAFI NYA D SLENINL EI +I+NS++PIV   +N   + +EK+  KA  T+K +L+QRK K+ +L+I   ++DV++I+ +I+  IP L N  + +  EPYLG  +N N   K+ + +EFL NMK T Y+I+ND  V + P  Q+I+N F+H D V   W+ +LK  + +  +L L  I   E++  L+
Sbjct:   17 KSKRFIYFLLRDSKKYLIRNQT-FRLFETCNKYCTSEMSQQISLIITKLKPIVINVKDVDLIEQDCDLDKPIENIDITKPIVIEEIHCMKCNSILEKCILVREGMNVNICENCLLDAISVVEPDSNESNQTNSNHDSPITENIINPPTKRTGQRNTVKKQP-SKPKSTICNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHRNQM---EIVGNLIGGAKTKMDMSSFNFKKAIAKT--KYSNNNPNTSNIL-KSQMPCVSSIICKYYENNCKVSVLSAELTLNLIAQNNSFIADNVTFKQFKGIDHILCVIPKFNDWCLFIYSIKLKHSHIFDFNYRTIDDRLIEIGVKITDYLNQFCLNRNVKFLANHHISHSTFLSYDTQYFASHFIVLFEKLVYEIHLDCDKVYDSLSKIKTETCIEISPGLNLINGKITDKIIFEYFNKLKLSDDYILLNKTLCVAISDDCTQYMKDFLNIECMMKANVIFAIISPPKVHELLLVIDYSTEEHYYLSPVTTDLNVVSQHFCYNILIKINELRESKGRAMKTGHCRHDIRGSGLLSKILICAFIRNYALDYSLENINLHEIGKIVNSLVPIVDGSDNVKYEKREKL--KAANTLKLNLKQRKEKINQLLIKLSDSDVDEIICTILTNIPRLENLQKKEFREPYLG--KNHNKPKKFNNPAEFLTNMKTTVYRILNDQSVKIEPPFQEIINNFTHPDVVPECWDNVLKFSKISDELLELTYISSEEILSNLQ 899          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000044750.1 (SMESG000044750.1)

HSP 1 Score: 1058.9 bits (2737), Expect = 0.000e+0
Identity = 613/1333 (45.99%), Postives = 835/1333 (62.64%), Query Frame = 1
Query:  331 DGDFIMKDLLTSEDADNESFNIGS--SNLTRSQLDKLYFDFPEIKEMFFTE--GMHKDSDKISSLINHLKVNKEYPKDISFSGGKFIINQKSNKIE-PDLSNASDVMFNFGLFDLFKISKDDIELERLISLPASSNKIVEIIFHLNYLNLKGNIKYFSNITYGTYVLNYFRNVLLLHSIIDSEKCNSLIIDTLEIWGSELTDQIPSTSYFKFSCQEKLIKYKKWLLNGEIDKLKNIISPLTXXXXXXXXXXXXXXXSEKTNRLSMIDSLLTYINDFRPE--------SKKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVELTDKIDNFNKGSSCNVTNNEKKVILPVNIDEEAVSSLELKITENKKMMTRQNLKVSKAMSK*RYVPASVLESATISEETDAECTKLKNT-KLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPN----NNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFS-MKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSEINN-KDKEKILTKAKETIKFDLQQRKNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKSHEPYLGSKQN-------SNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEF 4248
            DGDF+M DLL S + + E   +G   + L+RSQ+ +L+  FPEI+E+FF E   + ++ +K+ +LIN  K+ + +P+ ISF GGKF+   K N  + P + + SD+MFN GLF LF +S+ D  L  L+  P S  K+V+IIFHLNYLNLKGN    +N TY  YV NY  N LL+HSI+D E C  L +D +E+W  +L + IPS+S++  SC+EKL+K K+W L+GEID++ NII P TI  INNF  + ++  + K+++L  +  L   IN+   +        +K+++ F+IRDKK+FL K+  ++ I   CRK CT +MS  I  LI+S E    +EE                          ++ ++  NID     +L + I E                      P +      I E TDA+ T +      RD K+WFTDDDID YLE HI NP FA + CFI+ ILSS+ K+ I  +PD +FKA +ILCPLNIN +HWI FVY K    SYF+DPI   R+   NK + LKI +ALN +F L+ A   HP  NL+YQ+N++DCG +ICAY +LISQ   TFP NFI+ IR+ VH FQ    +   +V GGG+           +     +AL  +   +N N           SCV  L+ +WF +   I VLSP+LT+NLIA NN +I ENV FRQF  V++VI++IPN  +WCL ++S       I +F+   +++RL  IG + TDYLN+FF S  K+ F +NH   H  F S+DP F A+AFI FLE+          KI + L     +   EI  NLNLIN  I D I+ KYF NL+L ++F+ L   MCTAI+DDCT YLN+ LNY  +  A+V+FAI APPK RE L +IDYNTDE+Y L+PTTL  + NY   CK+L  KINEIR S    +  G+CPHD+RGSGL+SKIL C++++NYA+D+ L  +NLR+I  +++S LPI SEI   K  E  +         +L++RKNK+ +L+I     +V++IV+ I+ QI    +   + +H+PYLG+ +        SN+I  + S      +MK T   IIND+ V VRP+ ++I+  F H+ P+  +W+K+ K C  +   L L  +   EV++ELK+ADNTSPG+DGI+Y+D+ +LDPEG LL+F+FNKIIS K+IP SWK+FKT+LIPKP K D YD VSSWRPIALLSVIYK+FAS L  RLT W+  N++LHIGQKGGS H+GCVEHNSILSSALEHSKYSKNS LAIAWLDIKDAFGSVPH Y+WS+L+ +G+   F
Sbjct:  199 DGDFLMLDLLNSFEIEGE---LGQKITELSRSQIKELFNSFPEIQELFFIEKKSIDENPEKLINLINKFKIEETFPQQISFVGGKFVKIDKLNDSQFPQVESESDIMFNLGLFSLFGLSEYDNILNSLLCQPKSPEKLVDIIFHLNYLNLKGNFDTSTNGTYENYVQNYIVNCLLMHSILDLETCAFLNLDNIELWAPKLIELIPSSSHYSSSCKEKLLKLKQWKLSGEIDRIHNIICPETIIEINNFLGVIDQSYTTKSDQLKFLTCLGEKINNIEIDNDVDDLVKAKRMLYFIIRDKKRFLNKDNFNYHIPFNCRKICTLKMSDFITKLIQSNE---LFEE--------------------------REAVVDNNIDVSPNENLNILIVE----------------------PVNPTPDTVIVE-TDADSTIINYFFPERDSKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWILFVYCKLTKISYFVDPILRKRHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVYQDNNYDCGPYICAYAMLISQEWQTFPNNFIETIRKNVHRFQTTKFQNPPKVSGGGITTLPIFKRFQNVTRPPKVALPYKASLQNEN-----------SCVPSLIKEWFSNKNYITVLSPELTLNLIAHNNQFIRENVTFRQFTRVKYVIAVIPNNPHWCLYIFSPVFERSYILNFQGRVLNERLVSIGESMTDYLNKFFISTAKVNFIVNHNQTHFSFRSEDPHFFASAFIEFLERFFFGNILSFTKINETLKSFKLQITNEICKNLNLINFSINDEIITKYFKNLNLPSNFIFLNSAMCTAIMDDCTRYLNDFLNYDNIIKAQVIFAIVAPPKFREILFIIDYNTDEYYLLNPTTLLGNDNYLSACKILRNKINEIRESPNRVLNLGECPHDIRGSGLVSKILFCSYMSNYANDLPLVGLNLRQIGNVVSSFLPIASEIKKVKSLENNIINENHKESENLKERKNKIDQLLIKVFKMNVDEIVDVILDQI----SIKTVPTHKPYLGNIERVESQINKSNLIKNFNS------DMKTTVNTIINDVDVDVRPKYENIITNFEHKIPLDRTWDKVFKFCNRSDKKLKLKYLSNSEVLFELKKADNTSPGVDGIKYRDMVMLDPEGKLLTFLFNKIISKKVIPDSWKSFKTLLIPKPGKGDKYDSVSSWRPIALLSVIYKLFASCLANRLTFWINKNNLLHIGQKGGSRHDGCVEHNSILSSALEHSKYSKNSQLAIAWLDIKDAFGSVPHAYMWSLLRFVGLMRNF 1455          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000061623.1 (SMESG000061623.1)

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 345/369 (93.50%), Postives = 349/369 (94.58%), Query Frame = 1
Query: 1624 VWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPNNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFSMKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLL 2730
            +WFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKA VILCPLNINNAHWI FVYSKSLLESYFIDPIF  RNLFKNKQAT+KINIALNKIFKLQVAS CHPFQNLIYQENSFDCG FICAY ILISQGLDTFP NFIDGIRREV+DFQ+FGS KVSQVIGGGLP NNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSN NILVLS DLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMT NIFDFRKTDISDRLTEIGGN TDYLN FF SMKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDF HDKI   L
Sbjct:   75 MWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKAEVILCPLNINNAHWILFVYSKSLLESYFIDPIFANRNLFKNKQATIKINIALNKIFKLQVASSCHPFQNLIYQENSFDCGPFICAYAILISQGLDTFPNNFIDGIRREVYDFQIFGSNKVSQVIGGGLPKNNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNTNILVLSRDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTYNIFDFRKTDISDRLTEIGGNITDYLNSFFLSMKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFHHDKILSYL 443          

HSP 2 Score: 521.161 bits (1341), Expect = 4.280e-163
Identity = 259/266 (97.37%), Postives = 261/266 (98.12%), Query Frame = 1
Query: 3364 KNKVFELIISFENADVNQIVESIIRQIPHLNNFTEIKSHEPYLGSKQNSNIISKYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALEHSKYSKNSPLAIA 4161
            KNKVFELIISFENADVNQIVE+IIRQIPHLNN TEIKSHEPYLGSKQ SNIISKYKSRSEFLINMKLTFYKI NDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSF+FNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGS HEGCVEHNSILSSALEH KYSKNSPLAIA
Sbjct:  457 KNKVFELIISFENADVNQIVENIIRQIPHLNNLTEIKSHEPYLGSKQISNIISKYKSRSEFLINMKLTFYKITNDLPVTVRPEIQDILNQFSHEDPVSNSWNKILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPEGILLSFLFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALLSVIYKVFASILTTRLTSWVICNDILHIGQKGGSVHEGCVEHNSILSSALEHLKYSKNSPLAIA 722          
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Match: SMESG000013454.1 (SMESG000013454.1)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 408/910 (44.84%), Postives = 555/910 (60.99%), Query Frame = 1
Query:  607 PDLSNASDVMFNFGLFDLFKISKDDIELERLISLPASSNKIVEIIFHLNYLNLKGNIKYFSNITYGTYVLNYFRNVLLLHSIIDSEKCNSLIIDTLEIWGSELTDQIPSTSYFKFSCQEKLIKYKKWLLNGEIDKLKNIISPLTXXXXXXXXXXXXXXXSEKTNRLSMIDSLLTYINDFRPE--------SKKIIGFVIRDKKKFLLKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVELTDKIDNFNKGSSCNVTNNEKKVILPVNIDEEAVSSLELKITENKKMMTRQNLKVSKAMSK*RYVPASVLESATISEETDAECTKLKNT-KLRDPKVWFTDDDIDQYLERHISNPTFAHLPCFIISILSSDIKENIISIPDAVFKANVILCPLNINNAHWI*FVYSKSLLESYFIDPIFGYRNLFKNKQATLKINIALNKIFKLQVASFCHPFQNLIYQENSFDCGRFICAYVILISQGLDTFPYNFIDGIRREVHDFQVFGSKKVSQVIGGGLPN----NNLMGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINILVLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYSTRRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFS-MKIKFQINHGILHRCFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLNLNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLNYKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFICKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDMSLENINLREIARIINSVLPIVSEI 3294
            P + + SD+MFN GLF LF +S+ D  L  L+  P S  K+V+IIFHLNYLNLKGN    +N TY  YV NY  N LL+HSI+D E C  L +D +E+W  +L + IPS+S++  SC+EKL+K K+W L+GEID++ NII P TI  INNF  + ++  + K+++L  + SL   IN+   +        +K+++ F+IRDKK+FL K+  +++I   CRK CT +MS  I  LI+S E    +EE                          ++ ++  NID     +L + I E   ++T++             VPASV  S  ISEETDA+ T +      RDPK+WFTDDDID YLE HI NP FA + CFI+ ILSS+ K+ I  +PD +FKA +ILCPLNIN +HWI FVY K    SYF+DPI   R+   NK + LKI +ALN +F L+ A   HP  NL+ Q+N++DCG +ICAY +LISQ   TFP NFI+ IR+ VH FQ    +   +V G G+           +     +AL  +   +N           + SCV  L+ +WF +   I VLSPDLT+NLIA NN +I ENV FRQF  V++VI++IPN  +WCL ++S       I +F+   +++RL  IG + TDYLN+FF S  K+ F +NH   H  F S+DP F A+AFI FLE+          KI + L     +   EI  NLNLIN  I D I+ KYF NL+L ++F+ L   MCTAI+DDC  YLN+ LNY  +  A+V+FAI APPK RE L +IDYNTDE+Y L+PTTL  + NY   CK+L  KINEIR S    +  G+C HD+RGSGL+SKIL C++++NYA+D+ L  +NLR+I  +++S LPIVSEI
Sbjct:  157 PQVESESDIMFNLGLFSLFGLSEYDNILNSLLCQPKSPEKLVDIIFHLNYLNLKGNFDTSTNGTYENYVQNYIVNCLLMHSILDLETCAFLNLDNIELWAPKLIELIPSSSHYSSSCKEKLLKLKQWKLSGEIDRIHNIICPETIIEINNFLGVIDQSYTTKSDQLKFLTSLSEKINNIEIDNDVDDLVKAKRMLYFIIRDKKRFLNKDNFNYRIPFNCRKICTLKMSDFITKLIQSNE---LFEE--------------------------REAVVDNNIDVSPNENLNILIVEPVNLLTQE-------------VPASVSISVPISEETDADSTIINYFFPERDPKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWIVFVYCKLTKISYFVDPILRKRHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVCQDNNYDCGPYICAYAMLISQEWQTFPNNFIETIRKNVHRFQTSKFQNPPKVSGDGITTLPIFKRFQNVTRPPKVALPYKASLQN-----------ENSCVPSLIKEWFSNKNYITVLSPDLTLNLIAHNNQFIRENVTFRQFTRVKYVIAVIPNNPHWCLYIFSPAFERSYILNFQDRVLNERLVSIGESMTDYLNKFFISTAKVNFIVNHNQTHFSFRSEDPHFFASAFIEFLERFFFGNILSFTKINETLKSFKLQITNEICKNLNLINFSINDEIITKYFKNLNLPSNFIFLNSAMCTAIMDDCIRYLNDFLNYDNIIKAQVIFAIVAPPKFREILFIIDYNTDEYYLLNPTTLLGNDNYLSTCKILRNKINEIRESPNRVLNLGECSHDIRGSGLVSKILFCSYMSNYANDLPLVGLNLRQIGNVVSSFLPIVSEI 1013          
The following BLAST results are available for this feature:
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU462878.31.132e-1232.32pep chromosome:GRCz11:17:8542203:8545189:1 gene:EN... [more]
CR848788.19.938e-1230.70pep chromosome:GRCz11:16:5607138:5612480:-1 gene:E... [more]
BX908731.11.002e-1130.70pep chromosome:GRCz11:22:17838913:17844117:-1 gene... [more]
BX511246.12.280e-1032.40pep chromosome:GRCz11:23:9353552:9357627:1 gene:EN... [more]
BX284696.13.307e-1031.28pep chromosome:GRCz11:7:42935126:42939263:1 gene:E... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrsam11.650e-1029.39leucine rich repeat and sterile alpha motif contai... [more]
ENSXETT00000047782.12.149e-1029.39pep primary_assembly:Xenopus_tropicalis_v9.1:8:397... [more]
pigr3.631e-1029.28polymeric immunoglobulin receptor [Source:Xenbase;... [more]
epn13.763e-1030.91epsin 1 [Source:Xenbase;Acc:XB-GENE-1006332][more]
ENSXETT00000008172.11.332e-932.94pep primary_assembly:Xenopus_tropicalis_v9.1:5:143... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16423|POLR_DROME2.002e-932.52Retrovirus-related Pol polyprotein from type-2 ret... [more]
sp|Q03274|PO22_POPJA7.634e-726.79Retrovirus-related Pol polyprotein from type-1 ret... [more]
sp|P08548|LIN1_NYCCO1.399e-628.92LINE-1 reverse transcriptase homolog OS=Nycticebus... [more]
sp|Q03278|PO21_NASVI2.748e-626.82Retrovirus-related Pol polyprotein from type-1 ret... [more]
sp|P21328|RTJK_DROME4.806e-628.22RNA-directed DNA polymerase from mobile element jo... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A159X4Q61.789e-6150.22ORF2-like protein (Fragment) OS=Schmidtea mediterr... [more]
A0A2R7VWV84.088e-3537.21Reverse transcriptase domain-containing protein (F... [more]
A0A2R7X6Z12.215e-3338.07Reverse transcriptase domain-containing protein OS... [more]
A0A3L8D8X21.249e-3041.76Reverse transcriptase domain-containing protein OS... [more]
A0A3L8D9A52.079e-3041.76Reverse transcriptase domain-containing protein OS... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034560.11.645e-1631.29pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034831.11.135e-1430.56pep primary_assembly:Astyanax_mexicanus-2.0:3:1621... [more]
ENSAMXT00000056440.11.147e-1327.60pep primary_assembly:Astyanax_mexicanus-2.0:19:132... [more]
ENSAMXT00000055550.12.526e-1332.34pep primary_assembly:Astyanax_mexicanus-2.0:1:1655... [more]
ENSAMXT00000033573.18.038e-1331.18pep primary_assembly:Astyanax_mexicanus-2.0:3:3140... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041934.13.879e-1231.43uncharacterized LOC111947977 [Source:NCBI gene;Acc... [more]
ENSORLT00000036683.12.224e-1029.51pep primary_assembly:ASM223467v1:19:23029986:23032... [more]
ENSORLT00000028058.13.437e-1029.51pep primary_assembly:ASM223467v1:18:21516917:21520... [more]
ENSORLT00000042239.11.165e-930.43pep primary_assembly:ASM223467v1:5:6656021:6661644... [more]
ENSORLT00000040357.11.202e-930.46pep primary_assembly:ASM223467v1:14:28942701:28945... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021486.10.000e+046.91SMESG000021486.1[more]
SMESG000021486.10.000e+046.37SMESG000021486.1[more]
SMESG000044750.10.000e+045.99SMESG000044750.1[more]
SMESG000061623.14.280e-16393.50SMESG000061623.1[more]
SMESG000013454.10.000e+044.84SMESG000013454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025406 ID=SMED30025406|Name=Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2|organism=Schmidtea mediterranea sexual|type=transcript|length=4809bp
AGAAATGGAAATCTCTGTATTTCAATCAAGTTAAGTGAAATTAAAAAAAC
AGATGCTACTGAAAAGATAATTACAAAATCAGCAAATTTTCAAAATAAAA
ATAAAACCATTATTTCGAACCTTATTAATACTGATAATTATTGTTCCAAG
CTGATTAAAGCTCCATTAGCAATAAAGAAATTTTTATTTGTCTTTTCACA
TAAATTAGCCGAAACAGTTTCTATTAAAAACGAACTGCATAAAAGAGCTG
TCATTAATAAAACTTTGGATAATTTGAAATTTCAAAAACAATTACCATAC
TTTCTTGTAAAATCTGACTTAAAATATGCTGATGGTGACTTTATTATGAA
GGATCTTTTAACTTCTGAAGATGCTGATAATGAATCTTTTAATATTGGGT
CATCTAATTTAACAAGATCGCAGCTTGATAAACTTTATTTTGATTTTCCA
GAGATTAAAGAGATGTTCTTTACTGAAGGCATGCACAAAGATTCTGATAA
GATAAGTAGTTTAATTAATCACTTAAAGGTAAATAAAGAATATCCAAAAG
ATATTTCATTTTCTGGTGGTAAATTCATTATAAATCAAAAATCAAATAAA
ATAGAACCCGATTTAAGCAATGCTTCTGACGTTATGTTTAATTTTGGATT
ATTCGACTTATTTAAGATATCTAAAGACGATATAGAACTTGAGAGGCTTA
TTTCATTACCTGCTTCTTCAAATAAAATTGTTGAAATAATTTTCCACCTA
AATTATTTAAACTTAAAGGGTAATATAAAATATTTTAGTAACATAACATA
TGGTACTTATGTTTTAAATTATTTCCGTAATGTTTTACTATTACATTCTA
TTATTGATAGTGAAAAATGCAATTCGTTGATAATTGATACTCTTGAAATA
TGGGGGTCTGAATTAACTGATCAAATTCCTTCTACTTCCTATTTTAAATT
TAGTTGTCAAGAAAAACTAATTAAATATAAAAAGTGGTTACTTAATGGCG
AAATTGATAAGTTAAAAAATATAATTTCACCACTTACAATTAAAAGAATA
AATAATTTTTTTAATTTATTTAATAAAATAATTTCGGAAAAAACTAACCG
ATTGAGTATGATAGACTCGCTCCTTACTTACATCAATGATTTTCGTCCTG
AAAGCAAAAAGATTATTGGATTTGTTATTAGAGATAAGAAAAAATTTCTA
CTTAAAAATAGAGACGACTTTCAGATATCAATGAAATGTCGGAAAAACTG
TACTAAGGAAATGAGCTTGATTATTTTTGATCTCATTGAATCTCTTGAAA
ATTTGATAACTTATGAAGAACATGTTAACTCTGTCGAACTCACCGATAAA
ATTGATAACTTTAATAAAGGAAGTAGTTGTAACGTAACAAATAACGAAAA
AAAAGTAATTTTACCTGTTAATATTGACGAGGAAGCTGTATCTTCTTTGG
AATTAAAAATTACAGAAAATAAAAAAATGATGACTAGGCAAAATCTAAAA
GTGTCAAAGGCAATGTCCAAGTGAAGGTACGTGCCAGCATCAGTCTTAGA
ATCTGCCACAATCTCTGAAGAGACTGATGCAGAATGCACTAAATTAAAAA
ATACTAAACTTCGTGATCCAAAAGTGTGGTTTACCGACGATGACATTGAC
CAATACCTTGAACGGCATATCAGTAATCCTACATTTGCACATTTACCGTG
CTTTATTATTAGTATTCTATCTTCAGACATTAAAGAAAATATTATCTCAA
TTCCAGATGCAGTATTTAAAGCTAATGTTATTCTTTGTCCGCTAAATATA
AACAATGCCCATTGGATTTGATTTGTGTACAGCAAATCGTTGCTTGAGTC
ATATTTTATTGACCCAATATTTGGATATAGAAATCTGTTTAAAAATAAAC
AAGCTACTCTTAAGATTAACATTGCTTTAAATAAGATTTTCAAACTTCAA
GTGGCTTCATTTTGTCACCCTTTCCAAAATCTTATATATCAAGAGAACAG
TTTTGATTGCGGTCGTTTTATTTGTGCTTATGTAATTCTTATAAGTCAAG
GTTTGGACACTTTTCCTTACAATTTTATTGATGGGATAAGACGAGAGGTG
CATGATTTTCAAGTTTTTGGCTCAAAAAAAGTATCCCAAGTTATCGGTGG
GGGCCTTCCTAACAATAATTTGATGGGAATCAATTTTAAAAAAGCAATTG
CGCTTACTCTTGAAAAACAAAAACGAAATATCAATAACAGTATTAATATT
AAACCAAAATTTCAAAAGTCATGTGTGTCATTCCTCTTAAGTAAATGGTT
TAAAAGCAATATTAATATACTTGTTCTTTCCCCGGATCTAACTATCAATT
TAATAGCCCAAAATAATAATTATATCATTGAGAACGTCAACTTTCGGCAG
TTCAAAGACGTTCAACATGTCATTAGCATAATTCCCAATGAAAATTATTG
GTGTTTACTTCTCTATTCGACTCGTCGTATGACTTGTAATATTTTCGATT
TTCGAAAGACTGATATTTCTGATAGACTAACCGAAATAGGAGGAAACTTT
ACGGATTATTTAAATCGTTTTTTCTTTAGTATGAAAATAAAATTTCAAAT
AAATCATGGTATTCTCCACCGCTGCTTCATTTCAGATGATCCAACTTTTC
ATGCCACTGCTTTCATTGTGTTTTTGGAAAAATTGATTTTAGATCGGGAT
TTTCAACATGATAAAATATATAAGCTACTTGATGATATCAACACTAAAGA
GTGTGTTGAAATTTCATTAAATTTAAATCTAATAAATGGAAAGATTACCG
ACAGCATTTTAATAAAATATTTTAATAATTTAAGTTTATCAACAGACTTC
GTTCTTTTGGGTTTCACAATGTGTACTGCTATTCTTGACGATTGTACTCA
TTATTTGAATGAACATTTGAATTATAAGTGCCTCCAAAACGCGAAAGTTG
TATTTGCCATTTTTGCTCCACCAAAGTCTCGGGAAACACTAATGGTAATT
GATTATAACACTGACGAGCATTACTTTCTGGATCCAACAACACTTGATGT
CAGCCTAAACTATACATTTATTTGTAAAGTATTAGTTACTAAAATAAATG
AAATAAGAAACTCACGTGGTTGTGCCATTAGAGCAGGCAAATGTCCACAT
GATGTTCGTGGTTCAGGTTTGCTCAGTAAAATTCTAATATGTGCTTTCAT
CAACAACTATGCGCATGATATGTCCCTTGAAAACATTAATTTGAGAGAAA
TAGCAAGAATTATCAACTCTGTTCTTCCAATTGTTTCTGAGATCAATAAC
AAAGATAAAGAGAAAATTTTAACAAAAGCAAAAGAAACAATTAAATTTGA
CTTACAACAGCGTAAAAATAAAGTCTTTGAATTAATTATTAGTTTTGAAA
ATGCTGATGTTAACCAAATAGTTGAAAGCATTATTCGACAAATTCCTCAC
TTAAATAATTTCACTGAAATTAAATCCCACGAACCATACCTAGGAAGTAA
ACAAAACTCAAATATAATAAGTAAATATAAAAGTAGATCAGAATTTTTAA
TTAATATGAAATTAACTTTTTATAAAATTATTAATGACTTACCAGTCACT
GTCAGGCCTGAAATTCAGGATATTCTGAACCAATTTAGCCACGAGGACCC
AGTATCGAATTCATGGAATAAAATTCTTAAAGATTGTCGAAGCACGACAA
ATGTTCTCAATCTTGTAGATATTTTACCGTTTGAAGTTATTTACGAATTA
AAGAGAGCTGATAACACTTCACCGGGTATTGATGGTATTCAATACAAAGA
TCTTGCTCTTCTTGACCCTGAAGGTATCTTGTTAAGTTTCATGTTTAATA
AAATCATCAGTAGTAAAATCATTCCGACTAGCTGGAAAACTTTCAAGACT
ATACTAATTCCGAAACCTGATAAGACAGATAATTATGATAAAGTTTCATC
TTGGCGACCAATAGCTCTGCTGTCTGTTATTTATAAAGTCTTTGCGTCTA
TTTTAACTACACGCCTAACATCATGGGTGATTTGTAACGATATTTTGCAT
ATTGGGCAAAAGGGTGGCTCTTTCCATGAAGGTTGTGTCGAGCACAATTC
AATACTTTCTTCTGCACTTGAGCATTCGAAATATAGCAAGAATTCCCCAT
TAGCTATTGCTTGGTTAGATATTAAGGACGCATTTGGAAGTGTTCCTCAT
GACTACTTGTGGAGTGTTCTGAAAACTATTGGCGTTAGCGGAGAGTTTAT
TACTATTGAAAAAATTACTAATGAAAAATTTCACTTGATATTTGGCCGCA
TTCATGTTCAATTGCTTCTCTCAATTCAGCAACAGTTGCTGGTTTTTTAG
CGTATACTTTTTCTTTTAGGTATCCTTAAAACAAAAAATCTAGTGGTGTG
AGGTCTGGTTAACGGGGAGGAAATTCAACAAAACCCATTTGTCGAATCCA
CCATCGCGATGTTAGGTCTTTCATTGATTATCTCCTGCCAAATAATACTT
GTAAATATTTGTACTTTTTTAAATCAATAAAATTCTAATAAACGGTCGTT
ACTGTAATTATTTTTAATATGTATTCATTATTTTTTATAGTAGACTTTAA
TTTGTGAGGTAACTGATGGTAAGTTATTGGTTAAGGAATAGCATTTTTTT
CTCGCTACAAAATTACTTTAATAAAAAACGCTATCAAACTACACTAAAAC
CCACCTGAATACACTCAATTTGATTATTCATGCGGATTTCATCCATTTTT
GAAATGGCTAATTAGTAAATTTTTTTACTAGTAAGTTTCATAATATGAGA
ATATAACTT
back to top

protein sequence of SMED30025406-orf-1

>SMED30025406-orf-1 ID=SMED30025406-orf-1|Name=SMED30025406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=508bp
RNGNLCISIKLSEIKKTDATEKIITKSANFQNKNKTIISNLINTDNYCSK
LIKAPLAIKKFLFVFSHKLAETVSIKNELHKRAVINKTLDNLKFQKQLPY
FLVKSDLKYADGDFIMKDLLTSEDADNESFNIGSSNLTRSQLDKLYFDFP
EIKEMFFTEGMHKDSDKISSLINHLKVNKEYPKDISFSGGKFIINQKSNK
IEPDLSNASDVMFNFGLFDLFKISKDDIELERLISLPASSNKIVEIIFHL
NYLNLKGNIKYFSNITYGTYVLNYFRNVLLLHSIIDSEKCNSLIIDTLEI
WGSELTDQIPSTSYFKFSCQEKLIKYKKWLLNGEIDKLKNIISPLTIKRI
NNFFNLFNKIISEKTNRLSMIDSLLTYINDFRPESKKIIGFVIRDKKKFL
LKNRDDFQISMKCRKNCTKEMSLIIFDLIESLENLITYEEHVNSVELTDK
IDNFNKGSSCNVTNNEKKVILPVNIDEEAVSSLELKITENKKMMTRQNLK
VSKAMSK*
back to top

protein sequence of SMED30025406-orf-2

>SMED30025406-orf-2 ID=SMED30025406-orf-2|Name=SMED30025406-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=726bp
MGINFKKAIALTLEKQKRNINNSINIKPKFQKSCVSFLLSKWFKSNINIL
VLSPDLTINLIAQNNNYIIENVNFRQFKDVQHVISIIPNENYWCLLLYST
RRMTCNIFDFRKTDISDRLTEIGGNFTDYLNRFFFSMKIKFQINHGILHR
CFISDDPTFHATAFIVFLEKLILDRDFQHDKIYKLLDDINTKECVEISLN
LNLINGKITDSILIKYFNNLSLSTDFVLLGFTMCTAILDDCTHYLNEHLN
YKCLQNAKVVFAIFAPPKSRETLMVIDYNTDEHYFLDPTTLDVSLNYTFI
CKVLVTKINEIRNSRGCAIRAGKCPHDVRGSGLLSKILICAFINNYAHDM
SLENINLREIARIINSVLPIVSEINNKDKEKILTKAKETIKFDLQQRKNK
VFELIISFENADVNQIVESIIRQIPHLNNFTEIKSHEPYLGSKQNSNIIS
KYKSRSEFLINMKLTFYKIINDLPVTVRPEIQDILNQFSHEDPVSNSWNK
ILKDCRSTTNVLNLVDILPFEVIYELKRADNTSPGIDGIQYKDLALLDPE
GILLSFMFNKIISSKIIPTSWKTFKTILIPKPDKTDNYDKVSSWRPIALL
SVIYKVFASILTTRLTSWVICNDILHIGQKGGSFHEGCVEHNSILSSALE
HSKYSKNSPLAIAWLDIKDAFGSVPHDYLWSVLKTIGVSGEFITIEKITN
EKFHLIFGRIHVQLLLSIQQQLLVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003964RNA-directed DNA polymerase activity
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002056medial muscle cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
Vocabulary: biological process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis